BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033E09

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    264   4e-80   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   8e-80   Nicotiana tomentosiformis
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    258   2e-77   Solanum tuberosum [potatoes]
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    251   1e-74   Sesamum indicum [beniseed]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    251   1e-74   Solanum lycopersicum
emb|CDO98898.1|  unnamed protein product                                246   1e-72   Coffea canephora [robusta coffee]
gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  237   2e-72   Citrus sinensis [apfelsine]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   7e-69   Vitis vinifera
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    234   5e-68   
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             233   1e-67   Citrus clementina [clementine]
emb|CAN77820.1|  hypothetical protein VITISV_043441                     235   1e-67   Vitis vinifera
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   1e-67   Citrus sinensis [apfelsine]
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   2e-66   Prunus mume [ume]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   2e-66   Populus euphratica
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            229   2e-66   Gossypium arboreum [tree cotton]
gb|KJB72598.1|  hypothetical protein B456_011G187500                    228   3e-66   Gossypium raimondii
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            229   3e-66   Gossypium arboreum [tree cotton]
gb|KJB72601.1|  hypothetical protein B456_011G187500                    228   3e-66   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                    228   5e-66   Gossypium raimondii
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   6e-66   
gb|KJB72596.1|  hypothetical protein B456_011G187500                    228   6e-66   Gossypium raimondii
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             224   6e-66   
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   Elaeis guineensis
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   Elaeis guineensis
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   1e-65   Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   1e-65   Populus euphratica
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   2e-65   Populus euphratica
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    226   5e-65   Phoenix dactylifera
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    225   9e-65   Pyrus x bretschneideri [bai li]
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             224   1e-64   
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   1e-64   
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   2e-64   Fragaria vesca subsp. vesca
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    209   6e-64   
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         222   9e-64   Jatropha curcas
gb|KJB38636.1|  hypothetical protein B456_006G264600                    220   1e-63   Gossypium raimondii
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   2e-63   
gb|KJB38635.1|  hypothetical protein B456_006G264600                    221   3e-63   Gossypium raimondii
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    219   9e-63   
dbj|BAH19562.1|  AT5G18590                                              219   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      219   1e-62   Gossypium arboreum [tree cotton]
gb|AAM78582.1|  RanGAP1 interacting protein                             219   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       219   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873905.1|  kelch repeat-containing protein                    218   2e-62   
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   5e-62   Solanum tuberosum [potatoes]
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   6e-62   Cucumis melo [Oriental melon]
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    217   7e-62   
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    216   1e-61   
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   5e-61   Cucumis sativus [cucumbers]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   7e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   7e-61   Nelumbo nucifera [Indian lotus]
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                213   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    212   2e-60   
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 213   2e-60   Ricinus communis
gb|KJB72597.1|  hypothetical protein B456_011G187500                    211   2e-60   Gossypium raimondii
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             212   4e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    212   6e-60   Elaeis guineensis
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    212   7e-60   
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    211   8e-60   Elaeis guineensis
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    211   8e-60   Elaeis guineensis
emb|CDY13903.1|  BnaC09g39230D                                          211   9e-60   Brassica napus [oilseed rape]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    210   1e-59   Solanum lycopersicum
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   1e-58   Cicer arietinum [garbanzo]
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             207   2e-58   
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   2e-58   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                          207   3e-58   
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   3e-58   Cicer arietinum [garbanzo]
gb|AES91803.2|  acyl-CoA-binding domain protein                         207   4e-58   Medicago truncatula
gb|KEH32273.1|  acyl-CoA-binding domain protein                         207   4e-58   Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         206   6e-58   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   6e-58   
gb|KHN47303.1|  hypothetical protein glysoja_020171                     194   4e-57   Glycine soja [wild soybean]
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             204   5e-57   Phaseolus vulgaris [French bean]
gb|AES64218.2|  acyl-CoA-binding domain protein                         202   1e-56   Medicago truncatula
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         202   3e-56   
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   8e-56   
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   8e-56   
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    200   1e-55   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    199   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             199   3e-55   Phaseolus vulgaris [French bean]
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   2e-54   Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            196   4e-54   Glycine soja [wild soybean]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   2e-53   Glycine max [soybeans]
gb|EPS74438.1|  hypothetical protein M569_00314                         190   2e-53   Genlisea aurea
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   2e-53   Glycine max [soybeans]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            188   2e-51   Glycine soja [wild soybean]
gb|AES91804.2|  acyl-CoA-binding domain protein                         185   2e-50   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         185   3e-50   
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   8e-50   Cicer arietinum [garbanzo]
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    183   8e-50   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   9e-50   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   9e-50   
ref|XP_006855461.1|  hypothetical protein AMTR_s00057p00182130          179   2e-48   
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   2e-46   Populus euphratica
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   2e-46   Populus euphratica
ref|NP_001068393.1|  Os11g0657000                                       165   8e-44   
gb|EEC68565.1|  hypothetical protein OsI_36893                          166   1e-43   Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          165   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   8e-43   
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   9e-43   Oryza brachyantha
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    162   2e-42   Setaria italica
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    160   1e-41   
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    158   6e-41   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    158   8e-41   Brachypodium distachyon [annual false brome]
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    157   2e-40   Zea mays [maize]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    155   1e-39   Brachypodium distachyon [annual false brome]
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   8e-38   Oryza brachyantha
dbj|BAK00700.1|  predicted protein                                      149   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86800.1|  predicted protein                                      149   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  145   1e-37   Citrus sinensis [apfelsine]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          145   1e-36   
ref|XP_010098333.1|  hypothetical protein L484_023581                   146   1e-36   
gb|EEC69433.1|  hypothetical protein OsI_38606                          145   3e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001066944.1|  Os12g0538800                                       145   3e-36   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    144   7e-36   
dbj|BAK00043.1|  predicted protein                                      139   9e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    144   9e-36   
ref|NP_001145999.1|  uncharacterized protein LOC100279529               144   1e-35   
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   1e-35   
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   1e-35   Setaria italica
ref|NP_001146281.1|  uncharacterized protein LOC100279856               144   1e-35   Zea mays [maize]
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    138   1e-33   
gb|EMT26901.1|  hypothetical protein F775_29769                         134   2e-32   
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    127   9e-30   
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             125   4e-29   Selaginella moellendorffii
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             125   4e-29   Selaginella moellendorffii
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            123   6e-28   Triticum urartu
gb|EMT25879.1|  hypothetical protein F775_10881                         115   2e-25   
ref|XP_001759823.1|  predicted protein                                  115   2e-25   
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            113   7e-25   Triticum urartu
ref|XP_001760924.1|  predicted protein                                  107   9e-23   
ref|XP_001751751.1|  predicted protein                                97.1    5e-19   
ref|XP_001761501.1|  predicted protein                                84.0    7e-16   
gb|ABA95166.1|  Kelch motif family protein, expressed                 86.7    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        82.8    1e-14   
emb|CDY02611.1|  BnaC02g08240D                                        70.9    1e-12   
gb|ABR25493.1|  rangap1 interacting protein                           68.9    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                65.9    3e-09   
gb|EEE53353.1|  hypothetical protein OsJ_36377                        66.2    3e-09   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  Q YEAKL+
Sbjct  434  KIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGACQQYEAKLS  493

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLKEKLA VEL
Sbjct  494  ALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDMEKRMGDTVKEVELLKEKLASVEL  553

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAFQLQVEVFH
Sbjct  554  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAFQLQVEVFH  613

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQSLENR+PTPRKPFHV
Sbjct  614  LKQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  Q YEAKL+
Sbjct  507  KIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGACQQYEAKLS  566

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLKEKLA VEL
Sbjct  567  ALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDVEKRMGDTVKEVELLKEKLASVEL  626

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAFQLQVEVFH
Sbjct  627  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAFQLQVEVFH  686

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQSLENR+PTPRKPFHV
Sbjct  687  LKQRLQSLENRSPTPRKPFHV  707



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 158/201 (79%), Gaps = 7/201 (3%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K + EE+ TI ESG++ TH +Q S NF  D+DDFVFQE D K G+ A  G  Q YEAKL+
Sbjct  508  KIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVFQEGDYKAGLPASSGACQQYEAKLS  567

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            +L+RKN                A     +A+KSKQD EKK+ADA+KE++LLKEKLA VE+
Sbjct  568  SLMRKN-------GILEGQLATALAGREAAVKSKQDMEKKMADAVKEMELLKEKLASVEM  620

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQLQVEVFH
Sbjct  621  AQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQLQVEVFH  680

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQSLENR+PTPRKPFHV
Sbjct  681  LKQRLQSLENRSPTPRKPFHV  701



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  526
            I EE   + ES N+    K GSG+  L+S+D VFQE+D K  ISAP G+YQ YEAKL +L
Sbjct  515  ITEETSLVSESDNL-NLDKHGSGSLSLESEDLVFQETDGKSRISAPSGVYQIYEAKLASL  573

Query  525  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  346
            LRKNG+LEGQLAAALA+REAA+K+LS A+KS+QD E+KL +AM+EI+LLKEKLA VELAQ
Sbjct  574  LRKNGILEGQLAAALAAREAAEKNLSLAIKSRQDMERKLGEAMREIELLKEKLASVELAQ  633

Query  345  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  166
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  634  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  693

Query  165  QRLQSLENRAPTPRKPFHV  109
            QRLQ+LE RAPTPRKPFHV
Sbjct  694  QRLQTLETRAPTPRKPFHV  712



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 158/201 (79%), Gaps = 7/201 (3%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K + EE+ TI ESG++ TH +Q S NF  D+DDFV QE D K G+ A  G  Q +EAKL+
Sbjct  507  KIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVSQEGDYKAGLPASSGACQQHEAKLS  566

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            +L+RKN               AA     +A++SKQD EKK++DA+KE++LLKEKLA VE+
Sbjct  567  SLMRKN-------GILEGQLAAALAGREAAVRSKQDMEKKMSDAVKEMELLKEKLASVEM  619

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  620  AQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERARAFQLQVEVFH  679

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQSLENR+PTPRKPFHV
Sbjct  680  LKQRLQSLENRSPTPRKPFHV  700



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ---SYEAKLTA  529
            +EI +  ESGN+ TH++QGSG+  LDSDD +FQESD K G+S P  ++Q   SYE KL A
Sbjct  511  KEISSASESGNLETHRRQGSGSLSLDSDDLLFQESDGKAGVSVPSNVHQFHQSYELKLGA  570

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++LLKEKLAGVELA
Sbjct  571  LIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMELLKEKLAGVELA  630

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  631  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  690

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQSLENRAPTPRKPFHV
Sbjct  691  KQRLQSLENRAPTPRKPFHV  710



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  469
            QG GNF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +RE
Sbjct  186  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNRE  245

Query  468  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  289
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  246  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  305

Query  288  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  306  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  365



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALL  523
            +EI ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP  +YQ YE K+ AL+
Sbjct  521  DEIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALI  579

Query  522  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  343
            RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQE
Sbjct  580  RKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQE  639

Query  342  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  163
            EAN+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQ
Sbjct  640  EANNLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQ  699

Query  162  RLQSLENRAPTPRKPFHV  109
            RLQS+ENRAPTPRKPFHV
Sbjct  700  RLQSMENRAPTPRKPFHV  717



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFN  715

Query  111  V  109
            V
Sbjct  716  V  716



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  469
            QG GNF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +RE
Sbjct  538  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNRE  597

Query  468  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  289
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  598  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  657

Query  288  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  658  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648   QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
             QG+GN  +D+DD VF ES  K    SAP  +YQ YE K+ AL+RKNG+LEGQL AALASR
Sbjct  854   QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASR  913

Query  471   eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
             EA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQEEAN+LSNIVHSDNVRLE
Sbjct  914   EAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNIVHSDNVRLE  973

Query  291   HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
             HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH
Sbjct  974   HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFH  1033

Query  111   V  109
             V
Sbjct  1034  V  1034



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  469
            QG GNF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +RE
Sbjct  538  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNRE  597

Query  468  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  289
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  598  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  657

Query  288  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  658  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -3

Query  720  IDSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYE  544
            + S+   EE+ +  E  N + H   G GN  +D++D +F E+D K G +SAP  +Y  YE
Sbjct  513  LGSRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAPSSIYHYYE  571

Query  543  AKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLA  364
            +K+ +L+RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE++LLKEK+A
Sbjct  572  SKMASLIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKEMELLKEKVA  631

Query  363  GVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  184
            GVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQV
Sbjct  632  GVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQV  691

Query  183  EVFHLKQRLQSLENRAPTPRKPF  115
            EVFHLKQRLQS+ENRAPTPRKPF
Sbjct  692  EVFHLKQRLQSMENRAPTPRKPF  714



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 165/197 (84%), Gaps = 3/197 (2%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE   + +S N    +KQ + N   +SD+    E+D   G SAP  +YQ Y++K+ AL+R
Sbjct  514  EETPFVFDSENTRPLQKQANVNLLSESDEIAIPETD---GKSAPSNVYQLYDSKIAALVR  570

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            KNG+LE QLAA+LA REAA+K+LSS +KS+QD EKKLAD MKE+++LKEKLAGVELAQEE
Sbjct  571  KNGILEAQLAASLAGREAAEKNLSSVIKSRQDIEKKLADTMKEMEMLKEKLAGVELAQEE  630

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  160
            ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  631  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  690

Query  159  LQSLENRAPTPRKPFHV  109
            LQS+ENRAPTPRKPFH+
Sbjct  691  LQSVENRAPTPRKPFHM  707



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  526
            I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+ AL
Sbjct  419  INAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKIAAL  476

Query  525  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  346
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVELAQ
Sbjct  477  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVELAQ  536

Query  345  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  166
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  537  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  596

Query  165  QRLQSLENRAPTPRKPFHV  109
            QRLQS+ENR  TPRKPFHV
Sbjct  597  QRLQSMENRTSTPRKPFHV  615



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR
Sbjct  529  EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASR  588

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLE
Sbjct  589  DTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLE  648

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  649  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  708

Query  111  V  109
            V
Sbjct  709  V  709



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  499  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  558

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  559  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  618

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  619  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  678

Query  111  V  109
            V
Sbjct  679  V  679



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR
Sbjct  553  EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASR  612

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLE
Sbjct  613  DTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLE  672

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  673  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  732

Query  111  V  109
            V
Sbjct  733  V  733



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  485  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  544

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  545  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  604

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  605  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  664

Query  111  V  109
            V
Sbjct  665  V  665



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  526  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  585

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  586  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  645

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  646  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  705

Query  111  V  109
            V
Sbjct  706  V  706



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  517  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  576

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  577  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  636

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  139
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  637  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  696

Query  138  APTPRKPFHV  109
            APTPRKPFH+
Sbjct  697  APTPRKPFHM  706



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  529  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  588

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  589  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  648

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  649  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  708

Query  111  V  109
            V
Sbjct  709  V  709



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -3

Query  663  ATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaa  487
            + H   G GN  +D++D +F E+D K G +SAP  +Y  YE+K+   +RKNG+LEGQLAA
Sbjct  345  SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAPSSIYHYYESKMATQIRKNGILEGQLAA  404

Query  486  alasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSD  307
            AL SREAA+K+LSSALKS+Q+ E+KLAD  KE++LLKEK AGVE+AQEEAN+LSNIVHSD
Sbjct  405  ALTSREAAEKNLSSALKSRQEMERKLADTAKEMELLKEKAAGVEIAQEEANNLSNIVHSD  464

Query  306  NVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  127
            NVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTP
Sbjct  465  NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTP  524

Query  126  RKPF  115
            RKPF
Sbjct  525  RKPF  528



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  139
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  722

Query  138  APTPRKPFHV  109
            APTPRKPFH+
Sbjct  723  APTPRKPFHM  732



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  540  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  599

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  600  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  659

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  139
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  660  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  719

Query  138  APTPRKPFHV  109
            APTPRKPFH+
Sbjct  720  APTPRKPFHM  729



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  526
            I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+ AL
Sbjct  524  INAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKIAAL  581

Query  525  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  346
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVELAQ
Sbjct  582  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVELAQ  641

Query  345  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  166
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  642  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  701

Query  165  QRLQSLENRAPTPRKPFHV  109
            QRLQS+ENR  TPRKPFHV
Sbjct  702  QRLQSMENRTSTPRKPFHV  720



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  160
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  159  LQSLENRAPTPRKPFHV  109
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  160
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  159  LQSLENRAPTPRKPFHV  109
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 2/190 (1%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            ES N+  ++KQG+ N   DS+     E++ +  ++ P  +YQ YE K+  L RKN LLE 
Sbjct  541  ESSNL--YQKQGNNNLMSDSNHIAPPETENRSMLTNPSNIYQLYETKIVTLTRKNVLLEE  598

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL  A+AS+EA +K+LSSA+KS+QD EKK+ADAMKE++LLKEKLA VELAQEEANSLSN+
Sbjct  599  QLNVAMASQEATEKNLSSAIKSRQDMEKKIADAMKEVELLKEKLASVELAQEEANSLSNM  658

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  139
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  659  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  718

Query  138  APTPRKPFHV  109
            APTPRKPFH+
Sbjct  719  APTPRKPFHM  728



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
             G+GN  +D++D VF E+D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +AS+
Sbjct  533  HGTGNLSMDNNDAVFPENDSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMASQ  592

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            EAA+K+LSSALKS+Q+ E+KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLE
Sbjct  593  EAAEKNLSSALKSRQEMERKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLE  652

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  653  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++  + +++  +KQGS  FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQGSETFPLETVDGALIFQEMDNISFAGSMSSSSVYQFH  561

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
             G+GN  +D++D VF E+D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +A++
Sbjct  533  HGTGNLSMDNNDAVFPENDSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMANQ  592

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            EAA+K+LSSALKS+Q+ E+KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLE
Sbjct  593  EAAEKNLSSALKSRQEMERKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLE  652

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  653  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  526
            I  E+ +I E     +H  QG GN  +D++D V  ESDC  G  A   +YQ YE K+ AL
Sbjct  510  INAEMSSIFEMETPNSHN-QGIGNVSVDNEDVVSPESDCTTG-GARASIYQLYETKIAAL  567

Query  525  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  346
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++LLKEKLAGVELAQ
Sbjct  568  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMELLKEKLAGVELAQ  627

Query  345  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  166
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  628  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  687

Query  165  QRLQSLENRAPTPRKPFHV  109
            QRLQS+ENR  TPRKPF V
Sbjct  688  QRLQSMENRTSTPRKPFRV  706



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = -3

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            +KQ    FP+++ D +F E+D     S+ +  YQ +EAK+ AL+R+NG+LEGQL AALA 
Sbjct  519  QKQCPETFPMENADGIFLETDTSLASSSSV--YQFHEAKMAALIRRNGILEGQLTAALAG  576

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            REAA+++LS A+++KQ+TEKKLADAM+E++L+KEKL G+ELAQEEANSLSN+VHSDNVRL
Sbjct  577  REAAERNLSVAMRTKQETEKKLADAMREVELMKEKLTGLELAQEEANSLSNMVHSDNVRL  636

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKPF
Sbjct  637  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKPF  696

Query  114  HV  109
            HV
Sbjct  697  HV  698



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 163/183 (89%), Gaps = 5/183 (3%)
 Frame = -3

Query  660  THKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaa  484
            ++   G GNFP+D++D +F ESD K G +SAP  +YQ YE     L+RKNG+LEGQLAAA
Sbjct  531  SNHNHGLGNFPVDNNDALFPESDGKPGALSAPSSMYQYYEK----LIRKNGVLEGQLAAA  586

Query  483  lasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDN  304
            LASREAA+K+LSSALKS+Q+ EKKLAD+ KEI+LLK+KLAGVELAQEEAN+LS+IVHSDN
Sbjct  587  LASREAAEKNLSSALKSRQEIEKKLADSGKEIELLKDKLAGVELAQEEANNLSSIVHSDN  646

Query  303  VRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPR  124
            VRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPR
Sbjct  647  VRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPR  706

Query  123  KPF  115
            KPF
Sbjct  707  KPF  709



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -3

Query  672  GNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegql  493
             +++  K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL
Sbjct  14   SDISLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQL  73

Query  492  aaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVH  313
             AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVH
Sbjct  74   LAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVH  133

Query  312  SDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP  133
            SDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAP
Sbjct  134  SDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAP  193

Query  132  TPRKPFHV  109
            TPRKPFHV
Sbjct  194  TPRKPFHV  201



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K I EE     ES N+ + +    GN P+D+DD +  E+D   G  A   +YQ YE K+ 
Sbjct  511  KIIAEEASCGFESENLNS-QNPAIGNHPVDNDDVLVPETDGMAG-GAHSSIYQLYETKIA  568

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++LLKE+LA VEL
Sbjct  569  ALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMELLKERLASVEL  628

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  629  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFH  688

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQS+ENR PTPRKPF+V
Sbjct  689  LKQRLQSMENRVPTPRKPFNV  709



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 163/191 (85%), Gaps = 3/191 (2%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNglle  502
            E+ N +  + +G  + P+ +D+FVF E + K G +SAP  +Y  YE ++ AL R+NG+LE
Sbjct  444  ENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSAPSSIY--YEMRMAALSRRNGILE  501

Query  501  gqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSN  322
             QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SN
Sbjct  502  VQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKEMDLLKEKLAGIELAQEEANNISN  561

Query  321  IVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLEN  142
            IVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+EN
Sbjct  562  IVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMEN  621

Query  141  RAPTPRKPFHV  109
            RAPTPRKPF+V
Sbjct  622  RAPTPRKPFNV  632



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  486  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  545

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  546  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  605

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  606  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  665

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  666  VEVFHLKQRLQSLENRAATPRKPFHV  691



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  561

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
             G+GN   D++D VF E+D K G +S    +Y  YE+K+  L+RKNG+LEG+LA  +AS+
Sbjct  537  HGTGNLSXDNNDAVFPENDSKLGALSTASSMYHYYESKMAXLIRKNGILEGKLATVMASQ  596

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            EAA+K+LSSALKS+Q+ E+KL+D  KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLE
Sbjct  597  EAAEKNLSSALKSRQEMERKLSDTAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLE  656

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  657  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  715



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 163/191 (85%), Gaps = 3/191 (2%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNglle  502
            E+ N +  + +G  + P+ +D+FVF E + K G +SAP  +Y  YE ++ AL R+NG+LE
Sbjct  518  ENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSAPSSIY--YEMRMAALSRRNGILE  575

Query  501  gqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSN  322
             QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SN
Sbjct  576  VQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKEMDLLKEKLAGIELAQEEANNISN  635

Query  321  IVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLEN  142
            IVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+EN
Sbjct  636  IVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMEN  695

Query  141  RAPTPRKPFHV  109
            RAPTPRKPF+V
Sbjct  696  RAPTPRKPFNV  706



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKFGIS-APIGLYQSY  547
            +K   E+  ++  + +++   KQ S  FPL++ D   +FQE D  KFG S +   +YQ +
Sbjct  502  AKITEEKTLSMVSNHDISNLHKQCSETFPLENVDGALIFQEMDNIKFGGSMSSSSVYQFH  561

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA T RKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATHRKPFHV  707



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  + P+ +D+FVF E + K G +SAP  +Y  YE ++ AL RKNG+LE QL AA+ASR
Sbjct  525  EGITSVPVGNDNFVFPEVEGKAGALSAPSSIY--YEMRMAALSRKNGILEVQLGAAMASR  582

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            ++ +++L+SALKSK++ EK+LAD +KE+DL+KEKLAG+ELAQEEAN++SNIVHSDNVRLE
Sbjct  583  DSIERNLASALKSKEEMEKRLADTVKEMDLVKEKLAGIELAQEEANNISNIVHSDNVRLE  642

Query  291  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  643  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  702

Query  111  V  109
            V
Sbjct  703  V  703



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  547
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  186  VEVFHLKQRLQSLENRAPTPRKPFHV  109
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -3

Query  654  KKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLRKNgllegqlaa  487
            +KQ S  FPL++ D   + QE D   F G ++   +YQ +EAK+TAL+R+NG+LEGQL A
Sbjct  524  QKQCSETFPLENVDGTLIIQEMDNINFAGSASSSSVYQFHEAKMTALIRRNGILEGQLEA  583

Query  486  alasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSD  307
            ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEEANSLSN+VHSD
Sbjct  584  ALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEEANSLSNMVHSD  643

Query  306  NVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  127
            NVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA TP
Sbjct  644  NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATP  703

Query  126  RKPFHV  109
            RKPFHV
Sbjct  704  RKPFHV  709



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 7/189 (4%)
 Frame = -3

Query  675  SGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegq  496
            SG+ +  ++QG+    +          D K G+ A  G  Q YEAKL++L+RKNG+LEGQ
Sbjct  481  SGDESPSQEQGAKQLDIGGPKTSSNGGDYKAGLPASSGACQQYEAKLSSLMRKNGILEGQ  540

Query  495  laaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIV  316
            LA ALA REAA KS        QD EKK+ADA+KE++LLKEKLA VE+AQEEANSLSNIV
Sbjct  541  LATALAGREAAVKSK-------QDMEKKMADAVKEMELLKEKLASVEMAQEEANSLSNIV  593

Query  315  HSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  136
            HSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+
Sbjct  594  HSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRS  653

Query  135  PTPRKPFHV  109
            PTPRKPFHV
Sbjct  654  PTPRKPFHV  662



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = -3

Query  651  KQGSGNFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaalas  475
            K+G G  P+D+ D +F E+  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA AS
Sbjct  497  KEGVGYHPIDNTD-LFSENSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATAS  555

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            REA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVRL
Sbjct  556  REAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVRL  615

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  616  EHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKPF  675

Query  114  HV  109
            H+
Sbjct  676  HM  677



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 2/190 (1%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            ES N+   +K G+ +   DS+     E+D   G+ A   +YQ YE K+  L RKN LLE 
Sbjct  528  ESSNLC--QKLGNNDLMADSNHIAPPETDGISGLLANPYIYQLYETKIVTLTRKNVLLEE  585

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL AALA++EAA+K+LSSALKS+QD EKKLADAMKE++LLKEKLAG+ELAQEEAN+LSN+
Sbjct  586  QLTAALANQEAAEKNLSSALKSRQDMEKKLADAMKEVELLKEKLAGMELAQEEANNLSNM  645

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  139
             HSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENR
Sbjct  646  SHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENR  705

Query  138  APTPRKPFHV  109
            APTPRKPFH+
Sbjct  706  APTPRKPFHI  715



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 2/204 (1%)
 Frame = -3

Query  717  DSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS-APIGLYQSYEA  541
            + K I EE     E  N++  +  G+ + P+++DD  + E++CK G   +   + Q Y+ 
Sbjct  494  ECKSIGEETALAFEDENLSP-RINGNDSLPVNNDDLAYAETNCKVGAPPSTSSICQLYKT  552

Query  540  KLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAG  361
            K+ +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE+++LKEKLA 
Sbjct  553  KIDSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEMEVLKEKLAD  612

Query  360  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVE  181
            +E+ QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR FQLQVE
Sbjct  613  LEVTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARTFQLQVE  672

Query  180  VFHLKQRLQSLENRAPTPRKPFHV  109
            VFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  673  VFHLKQRLQSIENRAPTPRKPFHV  696



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -3

Query  651  KQGSG-NFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaala  478
            K+G G + P+D+ D +F ES  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA A
Sbjct  497  KEGVGYHHPIDNTD-LFSESSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATA  555

Query  477  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  298
            SREA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVR
Sbjct  556  SREAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVR  615

Query  297  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            LEHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKP
Sbjct  616  LEHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKP  675

Query  117  FHV  109
            FH+
Sbjct  676  FHM  678



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 163/203 (80%), Gaps = 4/203 (2%)
 Frame = -3

Query  717  DSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  538
            D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K
Sbjct  507  DIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESK  562

Query  537  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  358
            + AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGV
Sbjct  563  MAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGV  622

Query  357  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  178
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  623  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEV  682

Query  177  FHLKQRLQSLENRAPTPRKPFHV  109
            F LKQRLQ++EN+APTPRKPFH+
Sbjct  683  FQLKQRLQTVENQAPTPRKPFHM  705



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 163/203 (80%), Gaps = 4/203 (2%)
 Frame = -3

Query  717  DSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  538
            D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K
Sbjct  506  DIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESK  561

Query  537  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  358
            + AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGV
Sbjct  562  MAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGV  621

Query  357  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  178
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  622  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEV  681

Query  177  FHLKQRLQSLENRAPTPRKPFHV  109
            F LKQRLQ++EN+APTPRKPFH+
Sbjct  682  FQLKQRLQTVENQAPTPRKPFHM  704



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 163/203 (80%), Gaps = 4/203 (2%)
 Frame = -3

Query  717  DSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAK  538
            D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + Q YE+K
Sbjct  512  DIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVSQLYESK  567

Query  537  LTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGV  358
            + AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LKEKLAGV
Sbjct  568  MAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILKEKLAGV  627

Query  357  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEV  178
            ELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEV
Sbjct  628  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEV  687

Query  177  FHLKQRLQSLENRAPTPRKPFHV  109
            F LKQRLQ++EN+APTPRKPFH+
Sbjct  688  FQLKQRLQTVENQAPTPRKPFHM  710



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  624  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  445
            +++D + QE+D K  ++AP G+YQ  EAKL +L+RKNG+LEGQLAAALA+REAA+K+LS+
Sbjct  531  ETEDLILQENDGKSRMTAPPGVYQVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSA  590

Query  444  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  265
            A++S+ + EKKL +AMKE+++L+EK+  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAV
Sbjct  591  AIRSRLEMEKKLGEAMKEMEMLREKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  650

Query  264  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            LDDTQKELHSTRG+L GE  RAFQLQVEVFHLKQRLQSLE RAPTPRKP+HV
Sbjct  651  LDDTQKELHSTRGVLAGEHGRAFQLQVEVFHLKQRLQSLEPRAPTPRKPYHV  702



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLTA  529
            I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+  
Sbjct  433  IEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIYT  489

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+ELA
Sbjct  490  LTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMELA  549

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHL
Sbjct  550  QEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHL  609

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQS+ENRAPTPRKPFH 
Sbjct  610  KQRLQSMENRAPTPRKPFHT  629



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  532
            K I EE   + +S N +  + QG  N  ++++D +  E D   G  A   +YQ YE K+ 
Sbjct  515  KIIAEETSCVFDSEN-SHSQNQGVENHLVENEDALVSEPDGMTG-GAHSSIYQLYETKIA  572

Query  531  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  352
            +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++LLKEKLAGVEL
Sbjct  573  SLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMELLKEKLAGVEL  632

Query  351  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  172
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  633  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERARAFQLQVEVFH  692

Query  171  LKQRLQSLENRAPTPRKPFHV  109
            LKQRLQS+ENR PTPRKPF+V
Sbjct  693  LKQRLQSMENRVPTPRKPFNV  713



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  582  GISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  403
             +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK AD
Sbjct  449  ALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFAD  508

Query  402  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  223
            AMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  509  AMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  568

Query  222  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  569  LAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = -3

Query  714  SKXIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISA---PIGLYQS  550
            +K   E+  +      M+  +KQ S  FP     D  +F   D K  ++A      +YQ 
Sbjct  496  AKITAEKTLSTVSDREMSNLQKQCSETFPFAHIDDALIFPGMD-KTNLAANASSSSVYQF  554

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL DAM++++LLKEK
Sbjct  555  HEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCDAMRDVELLKEK  614

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            L G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQL
Sbjct  615  LTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQL  674

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  675  QVEVFHLKQRLQSLENRAATPRKPFHV  701



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLTA  529
            I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+  
Sbjct  521  IEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIYT  577

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+ELA
Sbjct  578  LTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMELA  637

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHL
Sbjct  638  QEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHL  697

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQS+ENRAPTPRKPFH 
Sbjct  698  KQRLQSMENRAPTPRKPFHT  717



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLTA  529
            I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+  
Sbjct  531  IEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIYT  587

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+ELA
Sbjct  588  LTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMELA  647

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHL
Sbjct  648  QEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHL  707

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQS+ENRAPTPRKPFH 
Sbjct  708  KQRLQSMENRAPTPRKPFHT  727



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLTA  529
            I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+  
Sbjct  534  IEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIYT  590

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+ELA
Sbjct  591  LTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMELA  650

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHL
Sbjct  651  QEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHL  710

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQS+ENRAPTPRKPFH 
Sbjct  711  KQRLQSMENRAPTPRKPFHT  730



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = -3

Query  705  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLTA  529
            I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+  
Sbjct  537  IEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIYT  593

Query  528  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  349
            L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+ELA
Sbjct  594  LTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMELA  653

Query  348  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  169
            QEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FHL
Sbjct  654  QEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHL  713

Query  168  KQRLQSLENRAPTPRKPFHV  109
            KQRLQS+ENRAPTPRKPFH 
Sbjct  714  KQRLQSMENRAPTPRKPFHT  733



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = -3

Query  651  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  478
            KQ S +FP     D  +F E D    +++   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  492  KQTSESFPFAHIDDALIFPEMDNAATLASSSSVYQFHEAKMTALIRRNGILEGQLEAALA  551

Query  477  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  298
             REAA++++S AL+SKQ+++KKL+DA+++++LLKEKL G+ELAQ+EANSLSN+VHSDNVR
Sbjct  552  GREAAERNVSVALRSKQESDKKLSDALRDVELLKEKLTGLELAQDEANSLSNMVHSDNVR  611

Query  297  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  612  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  671

Query  117  FHV  109
            FHV
Sbjct  672  FHV  674



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 7/162 (4%)
 Frame = -3

Query  594  DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEK  415
            D K G+ A  G  Q +EAKL++L+RKNG+LEGQLAAALA REAA +S        QD EK
Sbjct  507  DYKAGLPASSGACQQHEAKLSSLMRKNGILEGQLAAALAGREAAVRSK-------QDMEK  559

Query  414  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  235
            K++DA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHS
Sbjct  560  KMSDAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHS  619

Query  234  TRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  620  TRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  661



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS
Sbjct  429  KNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIAS  488

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            +EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRL
Sbjct  489  KEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRL  548

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  549  EHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  608

Query  114  HV  109
            HV
Sbjct  609  HV  610



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -3

Query  597  SDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  418
            SDC  G  A   +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSALKS+Q+ E
Sbjct  501  SDCTTG-GARASIYRLYETKIAALTRKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEME  559

Query  417  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  238
            KKL D ++E++LLKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELH
Sbjct  560  KKLVDTVREMELLKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELH  619

Query  237  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            STRG+L GERARAFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  620  STRGVLSGERARAFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  662



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -3

Query  651  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  478
            KQ S  FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KQSSEPFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  477  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  298
             REAA++++S AL+SKQ+T+KKL+DA+++++LLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVELLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  297  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  117  FHV  109
            FHV
Sbjct  698  FHV  700



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -3

Query  651  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  478
            K  S +FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KPPSESFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  477  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  298
             REAA++++S AL+SKQ+T+KKL+DA++++DLLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVDLLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  297  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  117  FHV  109
            FHV
Sbjct  698  FHV  700



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS
Sbjct  528  KNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIAS  587

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            +EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRL
Sbjct  588  KEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRL  647

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  648  EHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  707

Query  114  HV  109
            HV
Sbjct  708  HV  709



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  718



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  545  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  603

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  604  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  663

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  664  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  717



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  742



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E+D +  ++ P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ 
Sbjct  542  ETDGRSVLTNPSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEV  601

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E KLAD +KE++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL
Sbjct  602  ETKLADTVKEVELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKEL  661

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  94
            +STRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  662  YSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  645  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  466
            G GN  L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREA
Sbjct  83   GFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREA  142

Query  465  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  286
            A+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHD
Sbjct  143  AEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHD  202

Query  285  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  203  VAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  261



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = -3

Query  684  IPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgll  505
            +  SGN +  +  G GN  L+SDD  F E+     +SA   ++  YE K+ +L+RK G+L
Sbjct  520  VSVSGN-SNQQNLGFGNPFLESDDVSFPENSKSGSLSAASSIHHYYETKVASLMRKFGIL  578

Query  504  egqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLS  325
            EGQL+AALASREAA+KSL+SA KS+Q+  KKLAD +KE++LL EKL   ELAQEEAN+LS
Sbjct  579  EGQLSAALASREAAEKSLASAFKSRQEMGKKLADTLKEMELLSEKLVSAELAQEEANNLS  638

Query  324  NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLE  145
            N+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQRLQS+E
Sbjct  639  NLVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQRLQSME  698

Query  144  NRAPTPRKPFHV  109
            NRAPTPRKPFHV
Sbjct  699  NRAPTPRKPFHV  710



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -3

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  517  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  576

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  577  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  636

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  637  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  696

Query  114  HV  109
            HV
Sbjct  697  HV  698



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -3

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  582  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  641

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  642  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  701

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  702  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  761

Query  114  HV  109
            HV
Sbjct  762  HV  763



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 154/197 (78%), Gaps = 3/197 (2%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  YE K+ +L+R
Sbjct  522  EEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETKVASLMR  578

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            K G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   EL QEE
Sbjct  579  KFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREKLVSAELVQEE  638

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  160
            AN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQR
Sbjct  639  ANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQR  698

Query  159  LQSLENRAPTPRKPFHV  109
            LQS+E RAPTPRKPF V
Sbjct  699  LQSMEKRAPTPRKPFQV  715



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 154/197 (78%), Gaps = 3/197 (2%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  YE K+ +L+R
Sbjct  518  EEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETKVASLMR  574

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            K G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   EL QEE
Sbjct  575  KFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREKLVSAELVQEE  634

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  160
            AN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQR
Sbjct  635  ANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQR  694

Query  159  LQSLENRAPTPRKPFHV  109
            LQS+E RAPTPRKPF V
Sbjct  695  LQSMEKRAPTPRKPFQV  711



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 3/193 (2%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDD---FVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgl  508
            ESG    H K G G   L +D    F          ++ P  +YQ YE K  +L RKN L
Sbjct  541  ESGGTTVHHKHGIGISSLTADAEHLFPLGVDGGGLVLTNPTDVYQVYETKTASLTRKNVL  600

Query  507  legqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSL  328
            LE QL AA  SRE A+++LS  ++ KQD E+KLADA++E++LLK+K+AG+E+AQEEAN L
Sbjct  601  LEEQLKAATTSREIAERNLSCTVERKQDRERKLADALREVELLKDKVAGMEVAQEEANGL  660

Query  327  SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSL  148
            SNI HSDNVRLEHDVAFLKA+L+DTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS 
Sbjct  661  SNIGHSDNVRLEHDVAFLKAILEDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSG  720

Query  147  ENRAPTPRKPFHV  109
            ++RAPTPRKPF +
Sbjct  721  DHRAPTPRKPFQM  733



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  711  KXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGI-SAPIGLYQSYEAKL  535
            + I E+I ++ ESGN +      S  FPLD++  +F ES+ K G+ SAP  +YQ YE ++
Sbjct  508  RFIMEDIPSLSESGNFSV-PSCVSEKFPLDNEAIIFPESEDKCGVFSAPSSIYQLYETRM  566

Query  534  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  355
             AL+RKNG+LEGQLAAALASREAA+K++SS LKS+Q+TEKKL D  KE++LLKEKL G+E
Sbjct  567  AALIRKNGMLEGQLAAALASREAAEKNVSSVLKSRQETEKKLVDTGKELELLKEKLGGLE  626

Query  354  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  175
            LAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ERARAFQLQVEVF
Sbjct  627  LAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGMLANERARAFQLQVEVF  686

Query  174  HLKQRLQSLENRAPTPRKPFHV  109
            HLKQRLQSLENR  TPRKPF V
Sbjct  687  HLKQRLQSLENRTATPRKPFQV  708



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = -3

Query  624  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  445
            +SD+  F E++    +S+   +Y  YE+K+ +L+RKNG+LEGQLAA+LAS+EAA+KSL+S
Sbjct  537  ESDNLSFSENNKSASLSSS-NVYHYYESKVASLIRKNGILEGQLAASLASKEAAEKSLTS  595

Query  444  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  265
             LKS+Q+ E+KLADA KE++L++EKLA +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAV
Sbjct  596  VLKSRQEMERKLADAHKEMELMREKLASLELAQEEANNLSNIVHSDNVRLEHDVAFLKAV  655

Query  264  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  109
            LDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  656  LDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+
Sbjct  535  LESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLA  593

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  594  SVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  653

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  654  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  707



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+
Sbjct  563  LESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLA  621

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  622  SVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  681

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  682  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  735



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  645  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  466
            G GN  L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREA
Sbjct  532  GFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREA  591

Query  465  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  286
            A+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHD
Sbjct  592  AEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHD  651

Query  285  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  652  VAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  710



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 142/182 (78%), Gaps = 18/182 (10%)
 Frame = -3

Query  633  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  454
            FP +SDD + Q              +  YE K+ AL++K G+LEGQLAAA A+REAA+K+
Sbjct  278  FPSESDDVLLQTRRS----------HHVYEEKIAALMKKTGILEGQLAAATAAREAAEKN  327

Query  453  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  274
             +SA +S+Q+ EKKL D +KEIDLLKEKL+ VE++QEEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  328  SASATRSRQEMEKKLVDTLKEIDLLKEKLSSVEISQEEANNLSNIVHSDNVRLEHDVAFL  387

Query  273  KAVLDDTQK--------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            KAVLDDTQK        ELHSTRG+L GERARAFQLQVEVFHLKQRLQSLE RAPTPRK 
Sbjct  388  KAVLDDTQKASWKQKRLELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLETRAPTPRKQ  447

Query  117  FH  112
            FH
Sbjct  448  FH  449



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  645  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  466
            G GN  L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREA
Sbjct  521  GFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREA  580

Query  465  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  286
            A+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHD
Sbjct  581  AEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHD  640

Query  285  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  641  VAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  699



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 150/177 (85%), Gaps = 5/177 (3%)
 Frame = -3

Query  624  DSDDFVFQES---DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  454
            +SD+ +F E+   +   G      +Y  YE+KL +L+RKNG+LEGQLAA++AS+EAA+KS
Sbjct  538  ESDNLLFSENINININSGSLTTSNVYYYYESKLASLIRKNGILEGQLAASIASKEAAEKS  597

Query  453  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  274
            L+S LKS+Q+ ++KL ++ KE++L++EKLAG+ELAQEE N+LSNIVHSDNVRLEHDVAFL
Sbjct  598  LTSVLKSRQEMDRKLTESEKEMELMREKLAGLELAQEETNNLSNIVHSDNVRLEHDVAFL  657

Query  273  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLE-NRAP-TPRKPFHV  109
            KAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  658  KAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMEKNRASTTPRKPFHV  714



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 146/174 (84%), Gaps = 10/174 (6%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 146/174 (84%), Gaps = 10/174 (6%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  734



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  544  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  602

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  603  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  662

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  663  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  715



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  518  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  576

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  577  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  636

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  637  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  610  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  668

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  669  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  728

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  729  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -3

Query  627  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  448
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  604  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  662

Query  447  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  268
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  663  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  722

Query  267  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  723  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  775



>ref|XP_006855461.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
 gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  579  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  400
            + AP   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL+++
Sbjct  536  VIAPANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSES  595

Query  399  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  220
            +KE+++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L
Sbjct  596  LKEMEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVL  655

Query  219  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  656  AGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  184
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  699  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  520
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  519  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  340
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  339  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  184
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  384  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  443

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  444  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  503

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  504  QVEVFHLKQRLQTMEGRSPTPRKP  527



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            ++ ++T L+R+N  LE QL+AAL +++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  539  HDTRITTLVRRNMALEEQLSAALTTKDEAEKNLSLVIDSKDELEKRLAERDREVEALKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQR+Q++E R+PTPRKP
Sbjct  659  QVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  291  HDVAFLKAVLDDTQKELHSTRGLL  220
            HDVAFLKAVLDDTQKELHSTRG+L
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVL  679



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  536  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  595

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  596  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  655

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  656  QVEVFHLKQRLPTMDGRSPTPRKP  679



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  539  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  659  QVEVFHLKQRLPTMDGRSPTPRKP  682



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  186  VEVFHLKQRLQSLENRAP-TPRKP  118
            VEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VEVFHLKQRLQTMEGRSPAAPRKP  692



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y +K+T L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y AK+T L++++  LE QLA ALAS++ A+K+LS  + S++  E++LA+  KE ++LKEK
Sbjct  554  YNAKITDLIKRSSALEDQLATALASKDQAEKNLSLVINSREQLERRLANKDKEAEVLKEK  613

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  614  IAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  673

Query  189  QVEVFHLKQRLQSLENRAPTPRKPF  115
            QVEVFHLKQRLQ +E RA TP+ P 
Sbjct  674  QVEVFHLKQRLQMVEGRAGTPKNPL  698



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLGAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLRAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  469
            QG GNF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +RE
Sbjct  186  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNRE  245

Query  468  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  289
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  246  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  305

Query  288  DVAFLKAVLDDTQK  247
            DVAFLKAVLDDTQK
Sbjct  306  DVAFLKAVLDDTQK  319



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  189  QVEVFHLKQRLQSLENRAPTPRK  121
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = -3

Query  720  IDSKXIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYE  544
            +  K   E++  + E  N+  H  QGS N P+DS D VF  +D K G + AP  + Q YE
Sbjct  511  VGGKLCTEDMVAVYEPENLNPHN-QGSANLPVDSSDSVFPVNDIKLGSVPAPSSVSQFYE  569

Query  543  AKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLA  364
             K+T L+RKN +LEGQLAAA ASREA +K+LSSALKSKQ+ EKKLA+ MK ++LLKEKLA
Sbjct  570  TKITQLIRKNAILEGQLAAAFASREAVEKNLSSALKSKQEMEKKLAEMMKGMELLKEKLA  629

Query  363  GVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            GVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  630  GVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQK  668



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -3

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -3

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 22/165 (13%)
 Frame = -3

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  190
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  189  --------------------QVEVFHLKQRLQSLENRAP-TPRKP  118
                                QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  713



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -3

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            ++ EKKLA+  +E+  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQ
Sbjct  173  EELEKKLAERDREVVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQ  232

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            KELH TRG+L GERARAFQLQVEVFHLKQRLQS++  +   RKP
Sbjct  233  KELHLTRGVLAGERARAFQLQVEVFHLKQRLQSMDGLSSAQRKP  276



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = -3

Query  648  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  472
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  541  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  600

Query  471  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  292
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  601  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  660

Query  291  HDVAFLKAVLDDTQKEL  241
            HDVAFLKAVLDDTQK L
Sbjct  661  HDVAFLKAVLDDTQKVL  677



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 23/166 (14%)
 Frame = -3

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  190
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  189  ---------------------QVEVFHLKQRLQSLENRAP-TPRKP  118
                                 QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  714



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFH  112
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFH  112
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -3

Query  579  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  400
             S+ +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+ 
Sbjct  535  CSSDVGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANK  594

Query  399  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  220
             KE ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L
Sbjct  595  DKEAEMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVL  654

Query  219  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRK  121
             GE++RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  655  AGEQSRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -3

Query  678  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  499
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  498  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  319
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  318  VHSDNVRLEHDVAFLKAVLDDTQKEL  241
            VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKSL  688



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 27/171 (16%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            ++ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + +K++ E++LA+  +E+  LKEK
Sbjct  439  HDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDTKEELERRLAERDREVVALKEK  498

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-------------------  247
            + G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQK                   
Sbjct  499  VGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKAKNNNIPVISNCTSVYAVV  558

Query  246  --------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
                    ELHSTRG+L GERARAFQLQVEVFHLKQRLQS++ R+PT RKP
Sbjct  559  LTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRSPTQRKP  609



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  187
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  186  VEVFHLK  166
            V  +H +
Sbjct  669  VRPYHAR  675



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  151
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  151
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   123 bits (308),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 27/167 (16%)
 Frame = -3

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
              ++ K+  L+R+N  LE +L+AA+AS++ A+K+LS  + +K++ EK+LA+  +E+  LK
Sbjct  672  HQHDTKIANLVRRNMALEEKLSAAMASKDEAEKNLSLVIDTKEELEKRLAERDREVVALK  731

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-----------------  247
            EK+ G+E A E+ N+ SN VH+DNVRLE +VAFLKAV+D+TQK                 
Sbjct  732  EKVGGLEQAHEDLNNASNTVHADNVRLEREVAFLKAVMDETQKAKKIKIPVISHCTSVYA  791

Query  246  ----------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  136
                      E +STRG+L GERARAFQLQVEVFHLKQRLQS++ R 
Sbjct  792  VALTILPPKQEFYSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRG  838



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+T L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   115 bits (289),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -3

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  195  QLQVEVFHLKQRL  157
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+T L+R+N  LE QLAAALAS+E A+K+LS  + S++  EK+LA   K+ +LLKEK
Sbjct  514  YNNKITDLIRRNAALEDQLAAALASKEQAEKNLSLVMSSREQLEKRLASRGKDAELLKEK  573

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  574  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  614

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  615  QVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  195  QLQVEVFHLKQRLQSL  148
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -3

Query  555   QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
             QS+E KL A +R+    EGQ+  AL ++E     L+SALK +Q  E +LA A+     LK
Sbjct  915   QSFEMKLAAAVRRAEQAEGQVTTALRAKEEIANRLASALKMRQHAEGQLAAALTAQAELK  974

Query  375   EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
             E +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER+++F
Sbjct  975   ETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSKSF  1034

Query  195   QLQVEVFHLKQR-LQSLENRAPTP  127
             +LQ+E+F LK++ L SL     TP
Sbjct  1035  KLQMEIFDLKKKTLLSLSEEDATP  1058



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  414  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  235
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  234  TRGLLGGERARAFQLQVEVFHL  169
             R L+  +R R+F LQ+ V HL
Sbjct  201  NRELIATKRTRSFNLQLTVDHL  222



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  545  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  604

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  605  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -3

Query  546  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  367
            + ++T L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK 
Sbjct  548  DTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEKA  607

Query  366  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
             G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  608  TGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  321  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  184
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -3

Query  228  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -3

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  127
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLP---TIPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  246  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455