BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033E02

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    455   2e-158   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                459   9e-157   Vitis vinifera
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    461   3e-155   Cucumis melo [Oriental melon]
ref|NP_001183829.1|  uncharacterized protein LOC100502422               452   8e-155   Zea mays [maize]
gb|ACN35033.1|  unknown                                                 451   9e-155   Zea mays [maize]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     457   2e-154   Vitis vinifera
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    459   2e-154   Cicer arietinum [garbanzo]
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    451   3e-154   Oryza brachyantha
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             458   3e-154   Phaseolus vulgaris [French bean]
dbj|BAJ85305.1|  predicted protein                                      441   6e-154   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    457   8e-154   Glycine max [soybeans]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    457   1e-153   Vitis vinifera
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    457   2e-153   Nelumbo nucifera [Indian lotus]
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    456   2e-153   Setaria italica
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         456   3e-153   Jatropha curcas
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    456   3e-153   Cucumis sativus [cucumbers]
gb|EEC81336.1|  hypothetical protein OsI_24516                          453   5e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   5e-153   
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   5e-153   Sesamum indicum [beniseed]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   5e-153   Sesamum indicum [beniseed]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             455   8e-153   Citrus clementina [clementine]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   9e-153   Citrus sinensis [apfelsine]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    453   1e-152   
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    452   7e-152   Tarenaya hassleriana [spider flower]
ref|NP_001058625.1|  Os06g0725900                                       451   1e-151   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          451   2e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    451   2e-151   Populus euphratica
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    451   3e-151   Eucalyptus grandis [rose gum]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    450   4e-151   Populus euphratica
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    450   4e-151   Solanum tuberosum [potatoes]
ref|XP_002301927.1|  Cell division protein ftsH                         450   4e-151   Populus trichocarpa [western balsam poplar]
emb|CDP07308.1|  unnamed protein product                                450   6e-151   Coffea canephora [robusta coffee]
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       449   8e-151   
emb|CDX96068.1|  BnaA07g26630D                                          448   1e-150   
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            449   1e-150   Morus notabilis
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    449   1e-150   Gossypium arboreum [tree cotton]
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    449   1e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    449   1e-150   Nicotiana tomentosiformis
ref|NP_001234196.1|  FtsH-like protein precursor                        449   2e-150   
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    448   2e-150   Brassica rapa
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    448   2e-150   Nicotiana sylvestris
emb|CDY01840.1|  BnaC06g28800D                                          448   3e-150   
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             448   5e-150   Arabidopsis lyrata subsp. lyrata
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    448   6e-150   Elaeis guineensis
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    447   8e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             447   9e-150   Eutrema salsugineum [saltwater cress]
ref|XP_002306970.2|  Cell division protein ftsH                         446   1e-149   Populus trichocarpa [western balsam poplar]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             447   2e-149   Capsella rubella
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    439   2e-149   Triticum urartu
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          446   3e-149   Amborella trichopoda
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    446   4e-149   Camelina sativa [gold-of-pleasure]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    446   5e-149   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    445   6e-149   Camelina sativa [gold-of-pleasure]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             445   8e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             444   2e-148   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    444   2e-148   Prunus mume [ume]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    443   4e-148   Phoenix dactylifera
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   1e-147   Brachypodium distachyon [annual false brome]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    440   4e-147   Genlisea aurea
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   2e-146   Nicotiana sylvestris
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   3e-146   Fragaria vesca subsp. vesca
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    437   3e-146   
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   3e-146   Nicotiana tomentosiformis
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    436   1e-145   Nicotiana tabacum [American tobacco]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   2e-145   
emb|CAA68141.1|  chloroplast FtsH protease                              436   2e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    435   3e-145   Gossypium arboreum [tree cotton]
gb|KJB14315.1|  hypothetical protein B456_002G118800                    434   5e-145   Gossypium raimondii
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   1e-144   Pyrus x bretschneideri [bai li]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         432   4e-144   Medicago truncatula
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-143   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                428   2e-142   Erythranthe guttata [common monkey flower]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    426   1e-141   Medicago sativa [alfalfa]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    419   8e-139   Arabis alpina [alpine rockcress]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             416   1e-138   
dbj|BAH20236.1|  AT5G42270                                              412   1e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             416   8e-138   Capsella rubella
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    416   1e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    415   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    414   4e-137   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             414   5e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             414   5e-137   Eutrema salsugineum [saltwater cress]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             414   6e-137   
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     410   2e-135   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    407   9e-135   Capsicum annuum
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    408   2e-134   Camelina sativa [gold-of-pleasure]
emb|CAA73318.1|  ATPase                                                 401   8e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001760664.1|  predicted protein                                  394   3e-130   
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    380   3e-130   Rhizophora apiculata
ref|XP_001753657.1|  predicted protein                                  392   2e-129   
gb|KJB14314.1|  hypothetical protein B456_002G118800                    387   5e-127   Gossypium raimondii
ref|XP_002510649.1|  Cell division protease ftsH, putative              384   1e-125   
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         364   3e-120   Medicago truncatula
dbj|BAH20250.1|  AT5G42270                                              325   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005650371.1|  membrane AAA-metalloprotease                       340   4e-108   Coccomyxa subellipsoidea C-169
gb|KIY93255.1|  cell division protease FtsH                             332   8e-107   Monoraphidium neglectum
gb|KIZ03250.1|  cell division protease FtsH                             334   1e-105   Monoraphidium neglectum
gb|KJB57987.1|  hypothetical protein B456_009G188700                    333   1e-105   Gossypium raimondii
ref|XP_001690889.1|  membrane AAA-metalloprotease                       330   3e-104   Chlamydomonas reinhardtii
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              330   3e-104   Volvox carteri f. nagariensis
ref|XP_007510744.1|  cell division protein FtsH2                        328   8e-104   Bathycoccus prasinos
ref|WP_025929131.1|  hypothetical protein                               310   2e-102   
ref|WP_029963924.1|  cell division protein FtsH                         309   8e-101   
ref|WP_025947145.1|  cell division protein FtsH                         308   2e-100   
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           317   3e-100   Leptolyngbya sp. PCC 7375
ref|WP_023072541.1|  membrane protease catalytic subunit                316   5e-100   Leptolyngbya sp. Heron Island J
ref|WP_025970576.1|  cell division protein FtsH                         307   2e-99    
ref|WP_025954333.1|  cell division protein FtsH                         307   1e-98    
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    315   1e-98    Auxenochlorella protothecoides
ref|WP_044452063.1|  cell division protein FtsH                         305   2e-98    Mastigocladus laminosus
ref|WP_025971093.1|  cell division protein FtsH                         307   3e-98    
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 314   3e-98    Micromonas commoda
ref|XP_003057154.1|  predicted protein                                  314   6e-98    Micromonas pusilla CCMP1545
gb|ABX08179.1|  cell division protein FtsH2                             309   1e-97    Prochlorococcus marinus str. MIT 9211
ref|WP_041391000.1|  cell division protein FtsH                         310   2e-97    Prochlorococcus marinus
gb|KGF94553.1|  cell division protein FtsH2                             308   2e-97    Prochlorococcus marinus str. MIT 9201
ref|WP_025958220.1|  cell division protein FtsH                         306   3e-97    
ref|WP_006911156.1|  cell division protein FtsH                         309   3e-97    Cyanobium sp. PCC 7001
gb|KGG30054.1|  cell division protein FtsH2                             302   3e-97    Prochlorococcus sp. MIT 0703
ref|WP_036973151.1|  cell division protein FtsH                         302   4e-97    Prochlorococcus sp. MIT 0703
ref|WP_032522853.1|  cell division protein FtsH                         308   4e-97    Prochlorococcus marinus
ref|WP_035992112.1|  cell division protein FtsH                         308   5e-97    Leptolyngbya sp. KIOST-1
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 308   6e-97    Stanieria cyanosphaera
ref|WP_025944375.1|  cell division protein FtsH                         308   6e-97    
gb|KGG03814.1|  Cell division protein FtsH                              307   6e-97    Prochlorococcus marinus str. MIT 9321
ref|WP_044106285.1|  cell division protein FtsH                         308   7e-97    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_028953545.1|  cell division protein FtsH                         308   8e-97    Synechococcus sp. CC9616
ref|WP_025969610.1|  cell division protein FtsH                         308   8e-97    
ref|WP_032515715.1|  cell division protein FtsH                         308   9e-97    Prochlorococcus marinus
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           307   9e-97    Fischerella thermalis
ref|WP_025951376.1|  cell division protein FtsH                         308   9e-97    
ref|WP_025959316.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           307   1e-96    
ref|WP_025971671.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025980194.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025922112.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           307   1e-96    
ref|WP_025892538.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           307   1e-96    Prochlorococcus sp. HOT208_60m_808M21
ref|WP_032519670.1|  cell division protein FtsH                         307   1e-96    Prochlorococcus marinus
ref|WP_025964562.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           307   1e-96    
ref|WP_017297226.1|  cell division protein FtsH                         307   1e-96    Nodosilinea nodulosa
ref|WP_025967396.1|  cell division protein FtsH                         307   1e-96    
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           307   1e-96    Prochlorococcus marinus
gb|KGG06312.1|  Cell division protein FtsH                              307   1e-96    Prochlorococcus marinus str. MIT 9322
ref|WP_032517345.1|  cell division protein FtsH                         307   1e-96    Prochlorococcus marinus
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           307   2e-96    Cyanothece
gb|KGF88464.1|  cell division protein FtsH2                             305   2e-96    Prochlorococcus marinus str. GP2
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           306   3e-96    
ref|WP_025937982.1|  cell division protein FtsH                         306   3e-96    
ref|WP_002797753.1|  cell division protein FtsH                         306   3e-96    Microcystis aeruginosa
gb|AIQ94296.1|  Cell division protein FtsH                              306   3e-96    Prochlorococcus sp. MIT 0604
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           306   3e-96    Microcystis
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    306   3e-96    Microcystis aeruginosa
ref|WP_025941250.1|  cell division protein FtsH                         306   3e-96    
ref|WP_008275101.1|  cell division protein FtsH                         306   3e-96    Cyanothece sp. CCY0110
ref|WP_002806664.1|  cell division protein FtsH                         306   3e-96    Prochlorococcus marinus
ref|WP_032523992.1|  cell division protein FtsH                         306   4e-96    Prochlorococcus marinus
ref|WP_025933036.1|  cell division protein FtsH                         306   4e-96    
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           306   4e-96    
ref|WP_010871638.1|  cell division protein FtsH                         306   4e-96    Synechocystis
ref|WP_025971407.1|  cell division protein FtsH                         305   4e-96    
ref|WP_042849723.1|  cell division protein FtsH                         306   4e-96    Prochlorococcus sp. MIT 0604
dbj|GAL91410.1|  cell division protein FtsH                             306   4e-96    Microcystis aeruginosa NIES-44
ref|WP_025979191.1|  cell division protein FtsH                         306   4e-96    
ref|WP_012007029.1|  cell division protein FtsH                         306   4e-96    Prochlorococcus marinus
ref|WP_017320405.1|  cell division protein FtsH                         306   4e-96    cyanobacterium PCC 7702
ref|WP_025937318.1|  cell division protein FtsH                         306   4e-96    
ref|WP_011817719.1|  cell division protein FtsH                         306   4e-96    Prochlorococcus marinus
ref|WP_025914082.1|  cell division protein FtsH                         306   4e-96    
ref|WP_025925903.1|  cell division protein FtsH                         306   5e-96    
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          306   5e-96    Microcystis aeruginosa
ref|WP_025965256.1|  cell division protein FtsH                         306   5e-96    Prochlorococcus sp. HOT208_60m_805A16
ref|WP_002742170.1|  cell division protein FtsH                         306   5e-96    Microcystis
ref|WP_002793446.1|  cell division protein FtsH                         306   5e-96    Microcystis aeruginosa
ref|WP_025929709.1|  cell division protein FtsH                         306   5e-96    
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           305   5e-96    
ref|WP_002771354.1|  cell division protein FtsH                         305   6e-96    Microcystis aeruginosa
ref|WP_025981174.1|  cell division protein FtsH                         305   6e-96    
ref|WP_038542994.1|  cell division protein FtsH                         305   6e-96    Synechococcus sp. KORDI-100
ref|WP_011375794.1|  cell division protein FtsH                         305   6e-96    Prochlorococcus marinus
ref|WP_011862269.1|  cell division protein FtsH                         305   7e-96    Prochlorococcus marinus
ref|WP_016862523.1|  cell division protein FtsH                         305   7e-96    Fischerella muscicola
ref|WP_017312914.1|  cell division protein FtsH                         305   7e-96    Fischerella sp. PCC 9339
ref|WP_002801795.1|  cell division protein FtsH                         305   8e-96    Microcystis aeruginosa
ref|WP_026723275.1|  cell division protein FtsH                         305   9e-96    Hapalosiphonaceae
ref|WP_012264056.1|  cell division protein FtsH                         305   1e-95    Microcystis aeruginosa
ref|WP_032514590.1|  cell division protein FtsH                         305   1e-95    Prochlorococcus marinus
ref|WP_016867387.1|  cell division protein FtsH                         305   1e-95    Fischerella muscicola
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           304   2e-95    Cyanothece
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           304   2e-95    Cyanobacterium aponinum
ref|WP_036901462.1|  cell division protein FtsH                         304   2e-95    Prochlorococcus sp. MIT 0601
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           304   2e-95    Cyanobacteria [blue-green bacteria]
ref|WP_017293936.1|  cell division protein FtsH                         304   2e-95    Geminocystis herdmanii
ref|WP_025961749.1|  hypothetical protein                               290   3e-95    
ref|WP_016876546.1|  cell division protein FtsH                         303   3e-95    Chlorogloeopsis fritschii
ref|WP_007100703.1|  cell division protein FtsH                         303   3e-95    Synechococcus sp. RS9917
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 303   4e-95    Xenococcus sp. PCC 7305
ref|WP_025922823.1|  cell division protein FtsH                         303   5e-95    
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 303   5e-95    Cyanobacteria [blue-green bacteria]
ref|WP_028949001.1|  cell division protein FtsH                         303   6e-95    Synechocystis sp. PCC 6714
ref|WP_011826974.1|  cell division protein FtsH                         302   8e-95    Prochlorococcus sp. MIT 1306
ref|WP_035832496.1|  cell division protein FtsH                         302   8e-95    
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                302   8e-95    Thermosynechococcus sp. NK55a
ref|WP_011055986.1|  cell division protein FtsH                         302   8e-95    Thermosynechococcus
ref|WP_017303138.1|  cell division protein FtsH                         302   9e-95    Spirulina subsalsa
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           302   9e-95    Prochlorococcus
ref|WP_019478058.1|  cell division protein FtsH                         302   9e-95    
ref|WP_011932280.1|  cell division protein FtsH                         302   1e-94    Synechococcus sp. WH 7803
ref|WP_032527521.1|  cell division protein FtsH                         302   1e-94    Prochlorococcus marinus
ref|WP_019477234.1|  cell division protein FtsH                         302   1e-94    
ref|WP_006042287.1|  cell division protein FtsH                         302   1e-94    Synechococcus sp. WH 7805
ref|WP_011936606.1|  cell division protein FtsH                         302   1e-94    
ref|WP_006453661.1|  cell division protein FtsH                         302   1e-94    Synechococcus sp. PCC 7335
ref|WP_026730933.1|  cell division protein FtsH                         302   1e-94    Fischerella sp. PCC 9605
ref|WP_006102026.1|  cell division protein FtsH                         302   1e-94    Coleofasciculus chthonoplastes
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 302   1e-94    Oscillatoriales cyanobacterium JSC-12
ref|WP_013320241.1|  cell division protein FtsH                         302   2e-94    Cyanothece sp. PCC 7822
ref|WP_036922150.1|  cell division protein FtsH                         302   2e-94    
ref|WP_039716361.1|  cell division protein FtsH                         301   2e-94    
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           301   2e-94    Lyngbya confervoides
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           301   3e-94    Synechococcus
ref|WP_027255466.1|  cell division protein FtsH                         301   3e-94    Planktothrix agardhii
ref|WP_043694696.1|  cell division protein FtsH                         301   3e-94    Synechococcus sp. KORDI-49
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           301   3e-94    Cyanobacteria [blue-green bacteria]
gb|KIE06858.1|  cell division protein FtsH                              301   4e-94    Tolypothrix bouteillei VB521301
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           301   4e-94    Planktothrix
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           301   4e-94    
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           301   4e-94    
ref|WP_019506377.1|  cell division protein FtsH                         300   5e-94    Pleurocapsa sp. PCC 7319
ref|WP_042152619.1|  cell division protein FtsH                         300   5e-94    Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                         300   5e-94    Planktothrix agardhii
ref|WP_019476442.1|  cell division protein FtsH                         300   5e-94    
emb|CCH67048.1|  Cell division protein FtsH                             296   5e-94    Richelia intracellularis HH01
ref|WP_026097926.1|  cell division protein FtsH                         300   6e-94    Geitlerinema sp. PCC 7105
ref|WP_011131165.1|  cell division protein FtsH                         300   8e-94    Prochlorococcus marinus
ref|WP_024546675.1|  cell division protein FtsH                         300   8e-94    Synechococcus
ref|WP_015955558.1|  cell division protein FtsH                         300   8e-94    Cyanothece sp. PCC 7424
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           300   9e-94    Synechococcus
ref|WP_017291153.1|  cell division protein FtsH                         300   9e-94    Leptolyngbya boryana
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 300   1e-93    Pleurocapsa minor
ref|WP_017715041.1|  cell division protein FtsH                         300   1e-93    Oscillatoria sp. PCC 10802
ref|WP_011819579.1|  cell division protein FtsH                         300   1e-93    Prochlorococcus marinus
ref|WP_026786321.1|  cell division protein FtsH                         300   1e-93    Planktothrix rubescens
ref|WP_035155002.1|  cell division protein FtsH                         299   1e-93    Calothrix sp. 336/3
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           300   1e-93    Leptolyngbya sp. PCC 7376
ref|WP_038331075.1|  cell division protein FtsH                         300   1e-93    filamentous cyanobacterium ESFC-1
ref|WP_017743955.1|  cell division protein FtsH                         299   2e-93    Scytonema hofmannii
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 299   2e-93    Microcoleus sp. PCC 7113
emb|CDN17247.1|  Cell division protein FtsH                             298   2e-93    Richelia intracellularis
ref|WP_040054828.1|  cell division protein FtsH                         299   2e-93    
ref|XP_001419590.1|  predicted protein                                  300   2e-93    Ostreococcus lucimarinus CCE9901
ref|WP_006172329.1|  cell division protein FtsH                         299   2e-93    Synechococcus sp. WH 5701
ref|WP_006623490.1|  cell division protein FtsH                         298   2e-93    
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           298   2e-93    Crinalium epipsammum
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           298   3e-93    Arthrospira
ref|WP_006618677.1|  FtsH peptidase                                     298   3e-93    Arthrospira platensis
ref|WP_037224718.1|  cell division protein FtsH                         298   3e-93    
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 298   3e-93    Synechocystis sp. PCC 7509
ref|WP_040935720.1|  cell division protein FtsH                         298   3e-93    
ref|WP_011131865.1|  cell division protein FtsH                         298   4e-93    Prochlorococcus marinus
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 298   4e-93    Rubidibacter lacunae
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           298   5e-93    Rivularia sp. PCC 7116
ref|WP_012954347.1|  cell division protein FtsH                         298   5e-93    Candidatus Atelocyanobacterium thalassa
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 298   5e-93    Leptolyngbya sp. PCC 6406
ref|WP_036001623.1|  cell division protein FtsH                         298   5e-93    [Leptolyngbya] sp. JSC-1
ref|WP_028090468.1|  cell division protein FtsH                         298   5e-93    Dolichospermum circinale
ref|WP_006278775.1|  cell division protein FtsH                         298   6e-93    Cylindrospermopsis
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           298   6e-93    Geitlerinema sp. PCC 7407
ref|WP_036486108.1|  cell division protein FtsH                         298   6e-93    Myxosarcina sp. GI1
ref|WP_028082599.1|  cell division protein FtsH                         298   6e-93    Dolichospermum circinale
ref|WP_010311939.1|  cell division protein FtsH                         297   7e-93    Synechococcus sp. CB0101
ref|WP_009341877.1|  cell division protein FtsH                         297   7e-93    Aphanizomenonaceae
ref|WP_006853632.1|  cell division protein FtsH                         297   8e-93    Synechococcus
ref|WP_011127179.1|  cell division protein FtsH                         297   9e-93    Synechococcus
ref|WP_012411183.1|  cell division protein FtsH                         297   1e-92    Nostoc
ref|WP_011124410.1|  cell division protein FtsH                         296   1e-92    Prochlorococcus marinus
gb|AII47735.1|  cell division protein FtsH                              296   1e-92    Synechococcus sp. KORDI-52
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 297   1e-92    
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           297   1e-92    
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 297   1e-92    
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          297   1e-92    
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           297   1e-92    
ref|WP_011618327.1|  cell division protein FtsH                         297   1e-92    
ref|WP_026099187.1|  cell division protein FtsH                         296   1e-92    
ref|WP_008230065.1|  Cell division protein FtsH                         296   1e-92    
ref|WP_011363329.1|  cell division protein FtsH                         296   2e-92    
ref|WP_027401619.1|  cell division protein FtsH                         296   2e-92    
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      296   2e-92    
ref|WP_038551333.1|  cell division protein FtsH                         296   2e-92    
ref|WP_012162910.1|  cell division protein FtsH                         296   2e-92    
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           296   2e-92    
ref|WP_027841867.1|  cell division protein FtsH                         296   2e-92    
ref|WP_036531425.1|  cell division protein FtsH                         296   3e-92    
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                295   3e-92    
ref|WP_010995433.1|  cell division protein FtsH                         296   3e-92    
ref|WP_019494535.1|  cell division protein FtsH                         296   3e-92    
gb|ADD94882.1|  FtsH peptidase                                          296   3e-92    
ref|WP_029633975.1|  cell division protein FtsH [                       295   4e-92    
ref|WP_044492620.1|  cell division protein FtsH                         295   4e-92    
gb|EHJ10086.1|  Cell division protein FtsH                              294   4e-92    
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           295   4e-92    
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           295   4e-92    
gb|KGG16707.1|  Cell division protein FtsH                              295   5e-92    
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           295   5e-92    
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           295   5e-92    
ref|WP_013189950.1|  cell division protein FtsH                         295   5e-92    
ref|WP_016949229.1|  cell division protein FtsH                         295   5e-92    
ref|WP_021830407.1|  Cell division protein FtsH                         295   6e-92    
ref|WP_007099803.1|  cell division protein FtsH                         295   7e-92    
ref|WP_041036156.1|  cell division protein FtsH                         295   7e-92    
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           295   7e-92    
ref|WP_006633639.1|  cell division protein FtsH                         295   8e-92    
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           295   8e-92    
ref|WP_021836615.1|  Cell division protein FtsH                         295   9e-92    
ref|WP_039740989.1|  cell division protein FtsH                         295   9e-92    
ref|WP_017315070.1|  cell division protein FtsH                         295   1e-91    
ref|WP_012627305.1|  cell division protein FtsH                         294   1e-91    
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 295   1e-91    
ref|WP_011360789.1|  cell division protein FtsH                         295   1e-91    
gb|KIJ85386.1|  cell division protein FtsH                              294   1e-91    
ref|WP_010314566.1|  cell division protein FtsH                         294   2e-91    
ref|WP_011317448.1|  cell division protein FtsH                         293   2e-91    
ref|WP_009788844.1|  cell division protein FtsH                         293   3e-91    
ref|WP_036906170.1|  cell division protein FtsH                         293   4e-91    
ref|WP_017653544.1|  cell division protein FtsH                         293   4e-91    
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          293   5e-91    
ref|WP_009782358.1|  cell division protein FtsH                         292   5e-91    
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 292   6e-91    
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           292   7e-91    
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                293   1e-90    
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           291   1e-90    
ref|WP_011294228.1|  cell division protein FtsH                         291   1e-90    
ref|WP_011823081.1|  cell division protein FtsH                         291   1e-90    
ref|WP_011613138.1|  cell division protein FtsH                         291   1e-90    
ref|WP_038651066.1|  cell division protein FtsH                         291   1e-90    
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           291   2e-90    
ref|WP_006198086.1|  cell division protein FtsH                         290   4e-90    
gb|AFK49239.1|  unknown                                                 279   4e-90    
gb|ADF81075.1|  FtsH                                                    270   4e-87    
ref|WP_011141915.1|  cell division protein FtsH                         280   5e-86    
ref|WP_025953358.1|  hypothetical protein                               268   6e-86    
ref|YP_002049185.1|  cell division protein ftsH                         278   2e-85    
gb|ABH09265.1|  cell division protein                                   278   3e-85    
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 278   3e-85    
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 276   1e-84    
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 275   2e-84    
ref|WP_019500986.1|  cell division protein FtsH                         273   2e-83    
ref|XP_005713345.1|  cell division protein FtsH                         275   2e-83    
gb|ACV52574.1|  FtsH-like protein                                       259   3e-83    
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              273   7e-83    
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           264   5e-80    
ref|WP_017324919.1|  hypothetical protein                               263   2e-79    
ref|XP_005708438.1|  AAA-type ATPase                                    264   1e-78    
ref|WP_011431525.1|  cell division protein FtsH                         259   4e-78    
ref|WP_011432278.1|  cell division protein FtsH                         258   9e-78    
ref|XP_005538209.1|  cell division protein FtsH                         257   3e-76    
ref|WP_010468934.1|  cell division protein FtsH                         254   3e-76    
gb|KJB14313.1|  hypothetical protein B456_002G118800                    253   8e-76    
ref|XP_005708136.1|  AAA-type ATPase                                    241   3e-70    
ref|XP_002287516.1|  metalloprotease                                    232   4e-68    
gb|EJK55379.1|  hypothetical protein THAOC_24887                        226   4e-65    
ref|XP_002177215.1|  predicted protein                                  226   4e-65    
ref|XP_002291485.1|  chloroplast ftsH                                   219   3e-63    
gb|EWM30233.1|  atp-dependent metalloprotease                           217   2e-61    
gb|ABC70534.1|  ATPase                                                  203   4e-61    
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    214   4e-61    
gb|AHJ28404.1|  Cell division protein FtsH                              209   1e-59    
ref|WP_013119121.1|  cell division protein FtsH                         211   1e-59    
ref|WP_027717445.1|  cell division protein FtsH                         209   2e-59    
ref|WP_044452899.1|  cell division protein FtsH                         204   2e-59    
ref|WP_006199059.1|  cell division protein FtsH                         209   2e-59    
emb|CBN76650.1|  FtsH protease                                          211   3e-59    
ref|WP_022451567.1|  aTP-dependent metallopeptidase HflB subfamil...    209   3e-59    
ref|WP_041274355.1|  cell division protein FtsH                         208   5e-59    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           208   6e-59    
gb|ABO48676.1|  membrane protease FtsH catalytic subunit                208   6e-59    
ref|WP_031459350.1|  cell division protein FtsH                         208   7e-59    
ref|WP_041424761.1|  cell division protein FtsH                         207   1e-58    
ref|WP_039253834.1|  cell division protein FtsH                         208   1e-58    
gb|ACZ41968.1|  ATP-dependent metalloprotease FtsH                      207   2e-58    
ref|WP_021202559.1|  ATP-dependent metalloprotease                      200   2e-58    
gb|KJB14312.1|  hypothetical protein B456_002G118800                    206   3e-58    
gb|EDS77193.1|  putative Cell division protease FtsH homolog            207   3e-58    
ref|WP_007573233.1|  cell division protein FtsH                         207   3e-58    
ref|WP_039280930.1|  cell division protein FtsH                         207   3e-58    
ref|WP_043989340.1|  cell division protein FtsH                         207   4e-58    
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        206   4e-58    
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        206   4e-58    
ref|WP_028457503.1|  cell division protein FtsH                         206   5e-58    
ref|WP_034106139.1|  cell division protein FtsH                         206   5e-58    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           206   6e-58    
ref|WP_016869882.1|  cell division protein FtsH                         206   7e-58    
ref|WP_008412160.1|  ATP-dependent zinc metalloprotease FtsH            205   7e-58    
ref|WP_035150451.1|  cell division protein FtsH                         205   7e-58    
ref|WP_036002156.1|  cell division protein FtsH                         199   8e-58    
ref|WP_017322954.1|  cell division protein FtsH                         205   9e-58    
ref|WP_027356271.1|  cell division protein FtsH                         205   1e-57    
ref|WP_040355337.1|  ATP-dependent metalloprotease                      205   1e-57    
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          204   1e-57    
emb|CCH67560.1|  Cell division protein FtsH                             200   1e-57    
emb|CEO89112.1|  cell-division protein and general stress protein...    202   1e-57    
ref|WP_016858941.1|  cell division protein FtsH                         205   1e-57    
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        205   1e-57    
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     205   1e-57    
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        205   1e-57    
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     205   1e-57    
ref|WP_019593923.1|  ATP-dependent metalloprotease                      205   2e-57    
ref|WP_026732891.1|  cell division protein FtsH                         204   2e-57    
ref|WP_026719681.1|  cell division protein FtsH                         204   2e-57    
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   204   2e-57    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           204   2e-57    
ref|WP_018948798.1|  ATP-dependent metalloprotease                      204   3e-57    
ref|WP_013191839.1|  cell division protein FtsH                         204   3e-57    
ref|WP_012408087.1|  cell division protein FtsH                         204   3e-57    
ref|WP_039738012.1|  cell division protein FtsH                         204   4e-57    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           203   4e-57    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           203   4e-57    
ref|WP_018862431.1|  MULTISPECIES: ATP-dependent metalloprotease        204   5e-57    
ref|WP_006523235.1|  cell division protein FtsH                         203   5e-57    
ref|WP_013840279.1|  cell division protein FtsH                         202   6e-57    
ref|WP_012257906.1|  MULTISPECIES: cell division protein FtsH           203   6e-57    
ref|WP_038051416.1|  ATP-dependent metalloprotease                      203   6e-57    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 203   6e-57    
ref|WP_018141827.1|  MULTISPECIES: ATP-dependent metalloprotease        203   7e-57    
ref|WP_017312271.1|  cell division protein FtsH                         202   7e-57    
emb|CCP10974.1|  cell division protease FtsH                            194   8e-57    
ref|WP_010997786.1|  cell division protein FtsH                         202   8e-57    
ref|WP_018085219.1|  cell division protein FtsH                         202   8e-57    
ref|WP_027845285.1|  cell division protein FtsH                         202   9e-57    
ref|WP_016951384.1|  cell division protein FtsH                         202   9e-57    
ref|WP_011056581.1|  cell division protein FtsH                         202   1e-56    
gb|KHD08639.1|  ATP-dependent metalloprotease                           202   1e-56    
ref|WP_011565143.1|  cell division protein FtsH                         202   1e-56    
ref|WP_012629618.1|  cell division protein FtsH                         202   1e-56    
ref|WP_017651155.1|  cell division protein FtsH                         202   1e-56    
ref|WP_031388311.1|  cell division protein FtsH                         201   1e-56    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           202   1e-56    
ref|YP_009027610.1|  putative plastid division protein                  202   1e-56    
gb|ETA79344.1|  cell division protein FtsH                              202   1e-56    
ref|YP_001293616.1|  cell division protein                              202   1e-56    
gb|AHB35104.1|  putative plastid division protein                       202   1e-56    
ref|WP_015941389.1|  cell division protein FtsH                         202   1e-56    
ref|WP_027364266.1|  cell division protein FtsH                         201   1e-56    
ref|WP_029633486.1|  cell division protein FtsH [                       202   2e-56    
ref|WP_016876491.1|  cell division protein FtsH                         202   2e-56    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 202   2e-56    
ref|WP_041570995.1|  cell division protein FtsH                         201   2e-56    
ref|WP_011564781.1|  cell division protein FtsH                         202   2e-56    
ref|WP_015740013.1|  cell division protein FtsH                         201   2e-56    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           201   2e-56    
gb|ACA58655.1|  ATP-dependent metalloprotease FtsH                      201   2e-56    
ref|WP_011319922.1|  cell division protein FtsH                         201   2e-56    
ref|WP_039716067.1|  cell division protein FtsH                         201   3e-56    
ref|WP_012162627.1|  cell division protein FtsH                         201   3e-56    
emb|CDN10469.1|  Cell division protein FtsH                             201   3e-56    
ref|WP_041282707.1|  cell division protein FtsH                         201   3e-56    
ref|WP_037216619.1|  cell division protein FtsH                         201   3e-56    
gb|AEG13855.1|  ATP-dependent metalloprotease FtsH                      201   3e-56    
ref|WP_003540641.1|  cell division protein FtsH                         201   3e-56    
ref|WP_018864965.1|  ATP-dependent metalloprotease                      201   3e-56    
dbj|BAH56755.1|  AT5G42270                                              200   3e-56    
ref|WP_013809431.1|  cell division protein FtsH                         201   4e-56    
ref|WP_019623587.1|  MULTISPECIES: ATP-dependent metalloprotease        201   4e-56    
ref|WP_002682906.1|  ATP-dependent metalloprotease                      201   4e-56    
ref|WP_040389162.1|  ATP-dependent metalloprotease                      201   4e-56    
ref|WP_011142572.1|  cell division protein FtsH                         201   4e-56    
ref|WP_024326958.1|  ATP-dependent metalloprotease                      201   4e-56    
gb|EHM53778.1|  cell division protease FtsH                             201   4e-56    
ref|WP_026082835.1|  cell division protein FtsH                         201   4e-56    
ref|WP_021954053.1|  aTP-dependent metalloprotease FtsH                 200   4e-56    
gb|AFW93266.1|  ATP-dependent metallopeptidase                          200   5e-56    
gb|AJH65894.1|  ATP-dependent zinc metalloprotease FtsH                 201   5e-56    
ref|WP_041739648.1|  cell division protein FtsH                         201   5e-56    
ref|WP_039244531.1|  cell division protein FtsH                         201   5e-56    
dbj|GAC08157.1|  ATP-dependent zinc metalloprotease FtsH                199   5e-56    
ref|WP_019584275.1|  ATP-dependent metalloprotease                      201   5e-56    
ref|WP_006456705.1|  cell division protein FtsH                         200   5e-56    
ref|WP_011721151.1|  cell division protein FtsH                         201   5e-56    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           200   5e-56    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           200   6e-56    
gb|AFZ02140.1|  membrane protease FtsH catalytic subunit                200   6e-56    
emb|CEF99105.1|  P-loop containing nucleoside triphosphate hydrolase    199   6e-56    
dbj|GAC07952.1|  ATP-dependent zinc metalloprotease FtsH                199   7e-56    
ref|WP_036533052.1|  cell division protein FtsH                         200   7e-56    
ref|WP_039238378.1|  cell division protein FtsH                         201   7e-56    
ref|WP_041457570.1|  cell division protein FtsH                         200   8e-56    
ref|WP_015137807.1|  ATP-dependent metalloprotease FtsH                 200   8e-56    
ref|WP_028575310.1|  cell division protein FtsH                         200   8e-56    
ref|WP_010477442.1|  cell division protein FtsH                         200   8e-56    
ref|WP_008931990.1|  ATP-dependent metalloprotease                      200   8e-56    
ref|NP_050804.1|  cell division protein                                 200   8e-56    
ref|WP_010073796.1|  cell division protein FtsH                         200   8e-56    
ref|WP_025891584.1|  hypothetical protein                               190   8e-56    
ref|WP_012408423.1|  cell division protein FtsH                         200   8e-56    
ref|WP_040908051.1|  cell division protein FtsH                         199   9e-56    
ref|WP_028083738.1|  cell division protein FtsH                         200   9e-56    
ref|WP_017654114.1|  cell division protein FtsH                         199   1e-55    
ref|WP_017941358.1|  MULTISPECIES: ATP-dependent metalloprotease        200   1e-55    



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   455 bits (1171),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  97   KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  156

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  157  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  216

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  217  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  276

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  277  RAYSRATHIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   459 bits (1181),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  310  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  369

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  370  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  429

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  430  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  489

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  490  KAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  538



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   461 bits (1186),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/229 (99%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  607  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  667  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   452 bits (1162),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  247  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  306

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  307  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  366

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  367  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  426

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  427  KAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  475



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   451 bits (1161),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  235  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  294

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  295  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  354

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  355  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  414

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  415  KAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  463



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   457 bits (1177),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  435  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  494

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  495  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  554

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  555  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  614

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  615  KAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  663



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   459 bits (1181),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/229 (98%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  485  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  544

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  545  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  604

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM+TQKDYSMATADVVDAEVRELVE
Sbjct  605  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMATQKDYSMATADVVDAEVRELVE  664

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQII THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  665  KAYSRATQIINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  247  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  306

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  307  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  366

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  367  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  426

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  427  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  475



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   458 bits (1179),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 224/229 (98%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  481  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  540

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  541  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  600

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  601  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  660

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  661  RAYSRATNIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  709



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   441 bits (1134),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  21   KEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISII  80

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFM
Sbjct  81   PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFM  140

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  141  QVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  200

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRATQII THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  201  TAYSRATQIINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  249



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   457 bits (1175),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  468  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  527

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  528  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  587

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  588  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  647

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  648  RAYSRATHIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  696



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   457 bits (1175),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  478  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  537

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  538  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  658  KAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  706



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   457 bits (1175),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/229 (97%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  492  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  551

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  552  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFM  611

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  612  QVSRVARQMVERFGFSKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  671

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  672  RAYARATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  720



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   456 bits (1172),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/229 (97%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  457  KEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  516

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  517  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  576

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  577  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  636

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  637  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  685



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   456 bits (1173),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  607  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RA  IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  667  RAYARAKHIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  715



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   456 bits (1173),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 224/229 (98%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  607  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRA QIITTH DILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  667  RAYSRAKQIITTHNDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   453 bits (1165),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  402  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  461

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  462  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  521

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  522  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  581

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  582  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  630



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   455 bits (1170),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 222/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  466  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  525

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  526  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  585

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  586  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  645

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRAT II+THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  646  RAYSRATHIISTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  694



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   455 bits (1170),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  475  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  534

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  535  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  594

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  595  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  654

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  655  RAYTRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  703



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   455 bits (1170),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 222/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  475  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  534

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  535  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  594

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+
Sbjct  595  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVD  654

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  655  RAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  703



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   455 bits (1171),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  495  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  554

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFM
Sbjct  555  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFM  614

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  615  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  674

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  675  TAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   455 bits (1171),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 223/229 (97%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  495  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  554

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFM
Sbjct  555  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFM  614

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  615  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  674

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  675  TAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  460  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  519

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  520  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  579

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  580  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  639

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  640  KAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  688



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   452 bits (1164),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQM+VALGGR+AEEVIFGEDNVTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMSVALGGRIAEEVIFGEDNVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  607  QVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV+
Sbjct  667  RAYARAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVS  715



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   451 bits (1159),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EK++LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  458  KEISKDEISDALERIIAGPEKKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISII  517

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  518  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  577

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  578  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  637

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  638  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   451 bits (1159),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 229/229 (100%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EK++LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  458  KEISKDEISDALERIIAGPEKKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISII  517

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  518  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  577

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  578  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  637

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  638  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   451 bits (1160),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  477  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  536

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFM
Sbjct  537  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFM  596

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD EVRELVE
Sbjct  597  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDTEVRELVE  656

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  657  TAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   451 bits (1160),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  485  KEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  544

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  545  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  604

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+
Sbjct  605  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVD  664

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRA QI+TTH+DILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  665  RAYSRAKQIMTTHVDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  713



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   450 bits (1158),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  476  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  535

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  536  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  595

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  596  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  655

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  656  TAYTRAKQIITTHIDILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   450 bits (1158),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  480  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  539

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  540  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  599

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  600  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  659

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELF++
Sbjct  660  KAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFIS  708



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   450 bits (1158),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  476  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  535

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  536  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  595

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  596  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  655

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  656  TAYTRAKQIITTHIDILHKLAQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   450 bits (1157),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  478  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  537

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  538  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVE  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEF+SLFIDGKAEL+VA
Sbjct  658  KAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFLSLFIDGKAELYVA  706



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   449 bits (1156),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 218/229 (95%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  474  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  533

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  534  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  593

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE
Sbjct  594  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVE  653

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGK EL+V+
Sbjct  654  TAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKTELYVS  702



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  447  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  506

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  507  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFM  566

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  567  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  626

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  627  KAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  675



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  482  KEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  541

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  542  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  601

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  602  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  661

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA QI+TTHIDILHKLA LLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  662  TAYSRAKQILTTHIDILHKLALLLIEKETVDGEEFMSLFIDGKAELYVS  710



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/229 (95%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  471  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  530

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYL+NQMAVALGGR+AEEVIFGE+NVTTGASNDFM
Sbjct  531  PRGQAGGLTFFAPSEERLESGLYSRSYLQNQMAVALGGRIAEEVIFGEENVTTGASNDFM  590

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE
Sbjct  591  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVE  650

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA QIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  651  TAYSRAKQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/229 (97%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  478  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  537

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  538  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAYSRA QIITTH DILHKLAQLLIEKETVDG+EFMSLFIDGKAEL+VA
Sbjct  658  RAYSRAKQIITTHSDILHKLAQLLIEKETVDGDEFMSLFIDGKAELYVA  706



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  479  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  538

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  539  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  598

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  599  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  658

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  659  RAYERATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  480  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  539

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  540  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  599

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  600  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  659

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  660  KAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  708



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   448 bits (1153),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  475  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  534

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  535  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFM  594

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  595  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  654

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  655  KAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  703



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   448 bits (1153),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  479  KEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  538

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  539  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  598

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  599  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  658

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  659  RAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   448 bits (1152),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  474  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  533

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  534  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFM  593

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  594  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  653

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  654  KAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  702



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   448 bits (1152),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 213/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  492  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  551

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  552  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  611

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  612  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  671

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  672  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  720



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   448 bits (1152),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 220/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  495  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  554

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG DNVTTGASNDFM
Sbjct  555  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGNDNVTTGASNDFM  614

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  615  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  674

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI+T +IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  675  KAYSRAKQIMTDNIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  723



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   447 bits (1150),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+ VTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEEKVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSK+IGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE
Sbjct  607  QVSRVARQMVERLGFSKRIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVE  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  667  RAYARAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   447 bits (1151),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  494  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  553

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  554  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  613

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  614  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  673

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  674  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  722



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 217/229 (95%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  477  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  536

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFM
Sbjct  537  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFM  596

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVD EVRELVE
Sbjct  597  QVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQMSSQKDYSMATADVVDTEVRELVE  656

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  657  TAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   447 bits (1149),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  490  KEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISII  549

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  550  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  609

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  610  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  669

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  670  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  718



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  266  KEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISII  325

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFM
Sbjct  326  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFM  385

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  386  QVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  445

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRATQII THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  446  TAYSRATQIINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  494



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   446 bits (1146),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  485  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  544

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  545  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKENVTTGASNDFM  604

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELV+
Sbjct  605  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVD  664

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA  IITT IDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  665  EAYSRAKHIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   446 bits (1146),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  495  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  554

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  555  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  614

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  615  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  674

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  675  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  723



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   446 bits (1146),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  494  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  553

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  554  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  613

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  614  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  673

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  674  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  722



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   445 bits (1145),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  496  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  555

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  556  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  615

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  616  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  675

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  676  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  724



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   445 bits (1144),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 228/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  488  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  547

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  548  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  607

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  608  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  667

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  668  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS  716



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   444 bits (1142),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  491  KEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISII  550

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFM
Sbjct  551  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFM  610

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  611  QVSRVARQMVERFGFSKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  670

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  671  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   444 bits (1142),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  491  KEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISII  550

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFM
Sbjct  551  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFM  610

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  611  QVSRVARQMVERFGFSKKIGQVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  670

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  671  KAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   443 bits (1140),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/229 (94%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  496  KEISKDEISDALERIIAGPEKKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISII  555

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  556  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFM  615

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE
Sbjct  616  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVE  675

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QI++ +IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  676  KAYSRALQIMSDNIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA  724



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   441 bits (1133),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++K++LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  453  KEISKDEISDALERIIAGPEKKNAVVSEQKRRLVAYHEAGHALVGALMPEYDPVAKISII  512

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  513  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFM  572

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  573  QVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  632

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            ++YSRATQII THIDILHKLAQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  633  KSYSRATQIINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELFVA  681



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   440 bits (1131),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 214/226 (95%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  469  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  528

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEE IFG D VTTGASNDFM
Sbjct  529  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEAIFGVDKVTTGASNDFM  588

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+
Sbjct  589  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSTQKDYSMATADIVDAEVRELVD  648

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            RAY+RA QIITT+IDILH+LAQLLIEKETVDGEEFMSLFIDGKA++
Sbjct  649  RAYARAKQIITTNIDILHRLAQLLIEKETVDGEEFMSLFIDGKAQM  694



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   438 bits (1127),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/229 (95%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  482  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  541

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  542  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  601

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+
Sbjct  602  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVD  661

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  662  KAYARATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  710



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   438 bits (1127),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  483  KEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  542

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+ NVTTGASNDFM
Sbjct  543  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQANVTTGASNDFM  602

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+G  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  603  QVSRVARQMVERFGFSKKIGQVAVGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  662

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RAT+IITTHIDILHKLA LLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  663  KAYKRATEIITTHIDILHKLANLLIEKESVDGEEFMSLFIDGKAELYVS  711



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   437 bits (1123),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 224/230 (97%), Gaps = 1/230 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  436  KEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISII  495

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFM
Sbjct  496  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFM  555

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGP-GGNPFLGQQMSTQKDYSMATADVVDAEVRELV  233
            QVSRVARQMVERFGFSKKIGQ+AIG   GGNPFLGQQMS+QKDYSMATAD+VDAEVRELV
Sbjct  556  QVSRVARQMVERFGFSKKIGQVAIGSSGGGNPFLGQQMSSQKDYSMATADIVDAEVRELV  615

Query  232  ERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            E AYSRATQII THIDILH+LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  616  ETAYSRATQIINTHIDILHRLANLLIEKETVDGEEFMSLFIDGQAELFVA  665



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   438 bits (1126),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/229 (95%), Positives = 227/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  487  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  546

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  547  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  606

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+
Sbjct  607  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVD  666

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  667  KAYARATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  715



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   436 bits (1122),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 219/229 (96%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  479  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  538

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG RVAEEVIFG+DNVTTGASNDFM
Sbjct  539  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGERVAEEVIFGQDNVTTGASNDFM  598

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE
Sbjct  599  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  658

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  659  RAYERATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 213/229 (93%), Positives = 223/229 (97%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  490  KEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISII  549

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFM
Sbjct  550  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFM  609

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  610  QVSRVARQMVERFGFSKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  669

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA  I+TTHIDILH LAQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  670  TAYSRAKDIVTTHIDILHTLAQLLMEKETVDGEEFMSLFIDGKAELYVA  718



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   436 bits (1120),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/222 (94%), Positives = 221/222 (99%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  488  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  547

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  548  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  607

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  608  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  667

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG  104
            +AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG
Sbjct  668  KAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDG  709



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   435 bits (1118),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 217/229 (95%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  471  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  530

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFM
Sbjct  531  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFM  590

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE
Sbjct  591  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVE  650

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  651  TAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   434 bits (1117),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 217/229 (95%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  471  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  530

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFM
Sbjct  531  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFM  590

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE
Sbjct  591  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVE  650

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  651  TAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  493  KEISKDEIADALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISII  552

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGG TFFAPSEERLESGLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFM
Sbjct  553  PRGQAGGFTFFAPSEERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFM  612

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQIA+G  GGNPFLGQQMS+QKDYSMATAD+VD EVRELVE
Sbjct  613  QVSRVARQMVERFGFSKKIGQIAVGASGGNPFLGQQMSSQKDYSMATADIVDGEVRELVE  672

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
             AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  673  TAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  478  KEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  537

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  538  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV+
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVD  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RATQII THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  658  KAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   431 bits (1109),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  493  KEISKDEIADALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISII  552

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGG TFFAPSEERLESGLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFM
Sbjct  553  PRGQAGGFTFFAPSEERLESGLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFM  612

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQIA+G  GGNPFLGQ MS+QKDYSMATAD+VD EVRELVE
Sbjct  613  QVSRVARQMVERFGFSKKIGQIAVGASGGNPFLGQMMSSQKDYSMATADIVDGEVRELVE  672

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
             AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  673  TAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYD VAKISII
Sbjct  477  KEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDAVAKISII  536

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFG+DNVTTGAS+DFM
Sbjct  537  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGQDNVTTGASSDFM  596

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GG+PFLGQQMS+QKDYSMATADVVDAEVRELV+
Sbjct  597  QVSRVARQMVERFGFSKKIGQVAIGGGGGDPFLGQQMSSQKDYSMATADVVDAEVRELVD  656

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AYSRA QIITTH+DILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  657  TAYSRAKQIITTHVDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  705



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 224/229 (98%), Gaps = 1/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  479  KEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  538

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEV FG+DNVTTGASNDFM
Sbjct  539  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEV-FGQDNVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV+
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVD  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RATQII THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  658  KAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   419 bits (1076),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  477  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  536

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  537  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  596

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  597  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQQMSSQKDYSMATADIVDAEVRELVE  656

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RATQIITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  657  KAYARATQIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  705



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+E+KKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  400  KEISKDEISDALERIIAGPEKKNAVVSEERKKLVAYHEAGHALVGALMPEYDPVAKISII  459

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFG +NVTTGASNDF 
Sbjct  460  PRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGPENVTTGASNDFQ  519

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFS KIGQ+A+GG GGNPFLGQQ+S Q DYSMATADVVDAEVRELVE
Sbjct  520  QVSRVARQMVERFGFSNKIGQVALGGSGGNPFLGQQLSQQSDYSMATADVVDAEVRELVE  579

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
             AY+RA  +ITTH++ILHKLA LLIEKETVDGEEF+SLF+DG AEL++
Sbjct  580  SAYARAKHLITTHVEILHKLANLLIEKETVDGEEFLSLFVDGNAELYL  627



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   412 bits (1058),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  282  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  341

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  342  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  401

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  402  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  461

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RA +IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  462  KAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  510



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   416 bits (1070),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  481  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  540

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  541  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  600

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  601  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  660

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RAT+IITT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  661  KAYARATEIITTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  709



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/229 (92%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  480  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  539

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  540  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  599

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  600  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  659

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  660  KAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  708



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/229 (92%), Positives = 225/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  479  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  538

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  539  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  598

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  599  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  658

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  659  KAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  707



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   414 bits (1065),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 223/229 (97%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  477  KEISKDEIADALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  536

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  537  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  596

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQIAIGG GGNPFLGQQM++ KDYSMATADVVD EVRELVE
Sbjct  597  QVSRVARQMVERFGFSKKIGQIAIGGGGGNPFLGQQMASSKDYSMATADVVDGEVRELVE  656

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY RAT+I+ THIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  657  TAYKRATEIVNTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVS  705



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   414 bits (1064),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  476  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  535

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  536  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  595

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  596  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  655

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RA +IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  656  KAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  704



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   414 bits (1064),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 209/229 (91%), Positives = 226/229 (99%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISI+
Sbjct  478  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIL  537

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  538  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  597

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  598  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  657

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RA +I+TT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  658  KAYARAKEIVTTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  706



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   414 bits (1063),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 212/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  473  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  532

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  533  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  592

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE
Sbjct  593  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVE  652

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY RA +IITT IDILHKLAQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  653  KAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYVS  701



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  470  KEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISII  529

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  530  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFM  589

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQ MS+QKDYSMATAD+VDAEVRELVE
Sbjct  590  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQSMSSQKDYSMATADIVDAEVRELVE  649

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            RAY RAT IITT IDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  650  RAYERATTIITTQIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYIS  698



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   407 bits (1046),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/207 (97%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  456  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  515

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM
Sbjct  516  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  575

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQMSTQKDYSMATADVVD+EVRELVE
Sbjct  576  QVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQMSTQKDYSMATADVVDSEVRELVE  635

Query  229  RAYSRATQIITTHIDILHKLAQLLIEK  149
            +AY RA QIITTHIDILHKLAQLLIEK
Sbjct  636  KAYERAKQIITTHIDILHKLAQLLIEK  662



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/229 (91%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS++KK+LVAYHEAGHALVGALMPEYD VAKISII
Sbjct  482  KEISKDEISDALERIIAGPEKKNAVVSEDKKRLVAYHEAGHALVGALMPEYDAVAKISII  541

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFM
Sbjct  542  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFM  601

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR+LVE
Sbjct  602  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRKLVE  661

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  662  KAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMSLFIDGQAELYVS  710



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   401 bits (1030),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHAL G   PEY+PVAKISII
Sbjct  420  KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALGGCSYPEYNPVAKISII  479

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMA +LGGRVAEEVIFG++NVTTGASNDFM
Sbjct  480  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMACSLGGRVAEEVIFGDENVTTGASNDFM  539

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE
Sbjct  540  QVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVE  599

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEE  128
            +AY RAT+IITTHIDILHKLAQLLIEKETV GE+
Sbjct  600  KAYKRATEIITTHIDILHKLAQLLIEKETVAGED  633



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISI+
Sbjct  406  KEISKDEIADALERIIAGPEKKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISIV  465

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFM
Sbjct  466  PRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEELIYGAENVTTGASNDFM  525

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE
Sbjct  526  QVSRVARQMVERFGFSKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVE  585

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
             AY+RA  I+ THIDILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  586  TAYTRAKTIMETHIDILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  633



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 190/191 (99%), Gaps = 0/191 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  46   KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  105

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFM
Sbjct  106  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFM  165

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  166  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  225

Query  229  RAYSRATQIIT  197
            +AY+RA QI+T
Sbjct  226  KAYTRAKQIVT  236



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEI+DALERIIAGPEKKNAVVS+EK+ LVAYHEAGHALVGALMPEYDPVAKISI+
Sbjct  419  KEISKDEIADALERIIAGPEKKNAVVSEEKRTLVAYHEAGHALVGALMPEYDPVAKISIV  478

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFM
Sbjct  479  PRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEELIYGTENVTTGASNDFM  538

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE
Sbjct  539  QVSRVARQMVERFGFSKKIGQLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVE  598

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
             AY+RA  I+ THIDILHKLA LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  599  TAYTRAKTIMETHIDILHKLAALLLEKETVDGEEFLNLFIDGQAELYV  646



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   387 bits (995),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 200/229 (87%), Positives = 209/229 (91%), Gaps = 17/229 (7%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH                 AKISII
Sbjct  471  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH-----------------AKISII  513

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFM
Sbjct  514  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFM  573

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE
Sbjct  574  QVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVE  633

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  634  TAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMSLFIDGKAELYVS  682



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/229 (85%), Positives = 201/229 (88%), Gaps = 27/229 (12%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH                       
Sbjct  491  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH-----------------------  527

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
                AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFM
Sbjct  528  ----AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFM  583

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE
Sbjct  584  QVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVE  643

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            +AYSRA QIITTHIDILHKLAQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  644  KAYSRAKQIITTHIDILHKLAQLLVEKETVDGEEFMSLFIDGKAELYVS  692



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  658  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  479
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  308  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  367

Query  478  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  299
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  368  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  427

Query  298  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  119
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  428  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  487

Query  118  LFIDGKAELFVA  83
            LFIDGKAEL+V+
Sbjct  488  LFIDGKAELYVS  499



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISII
Sbjct  40   KEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISII  99

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFM
Sbjct  100  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFM  159

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVR  242
            QVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR
Sbjct  160  QVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVR  215



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   340 bits (873),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISK+EISDALERI+AGPEKK AV+++ KK+LVAYHEAGHALVGALMPEYDPVAKISI+
Sbjct  492  KEISKEEISDALERIVAGPEKKGAVMTEAKKRLVAYHEAGHALVGALMPEYDPVAKISIV  551

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALGGR+AEE+IFGEDNVTTGASNDFM
Sbjct  552  PRGSAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRIAEEIIFGEDNVTTGASNDFM  611

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QV+R A+ MV + GFSKK+GQ+A  G GG  FLGQ M    D S  T+D +DAEV++LV+
Sbjct  612  QVARTAKMMVTQMGFSKKLGQVAWSGGGGPSFLGQSMGQPADCSGQTSDEIDAEVKQLVD  671

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            RAY RA  ++ ++I +LHK A++L+E+E +DG+EF+ L ++ +AE ++
Sbjct  672  RAYRRAKDLMQSNITVLHKTAEVLLEREQIDGDEFLRLILESQAENYL  719



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            +EISKDEI+DALERIIAGPEKK AV+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+
Sbjct  307  QEISKDEIADALERIIAGPEKKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIV  366

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF 
Sbjct  367  PRGAAGGLTFFAPSEERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQ  426

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QV+R AR MV + GFSK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVE
Sbjct  427  QVTRTARLMVTQLGFSKVLGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKALVE  486

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            RAY RA  +I ++IDILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  487  RAYRRAKDLIQSNIDILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  534



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   334 bits (856),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            +EISKDEI+DALERIIAGPEKK AV+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+
Sbjct  493  QEISKDEIADALERIIAGPEKKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIV  552

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF 
Sbjct  553  PRGAAGGLTFFAPSEERLESGLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQ  612

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QV+R AR MV + GFSK +GQ+A    GGN FLGQ M+   D+S  TAD +D EV+ LVE
Sbjct  613  QVTRTARLMVTQLGFSKALGQVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKSLVE  672

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            RAY RA  +I ++IDILHK A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  673  RAYRRAKDLIQSNIDILHKTAAVLLEKENIDGDEFQQIVLESQAQQYL  720



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 177/200 (89%), Gaps = 11/200 (6%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVA-----------YHEAGHALVGALMP  623
            KEISKD I+DALERIIAGPEKKN VVS  ++  +            + EAGHALVGAL+P
Sbjct  490  KEISKDGITDALERIIAGPEKKNVVVSVRRRNWLPIMVFDFLYALKFTEAGHALVGALIP  549

Query  622  EYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGED  443
            EYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVAL GR+AEEVIFGE+
Sbjct  550  EYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALSGRIAEEVIFGEE  609

Query  442  NVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATAD  263
            NVTTGASNDFMQVSRVAR MVERFGFSKKIG++AIGGPGGNPFLGQQMS+QKDYSMATAD
Sbjct  610  NVTTGASNDFMQVSRVARHMVERFGFSKKIGRVAIGGPGGNPFLGQQMSSQKDYSMATAD  669

Query  262  VVDAEVRELVERAYSRATQI  203
            VVDAEVR+LVE AYSRA QI
Sbjct  670  VVDAEVRDLVETAYSRAKQI  689



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   330 bits (846),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISK+EI+DALERIIAGPEKK AV+SD+K++LVAYHEAGHALVGALMPEYDPV KISI+
Sbjct  486  KEISKEEIADALERIIAGPEKKGAVMSDKKRRLVAYHEAGHALVGALMPEYDPVTKISIV  545

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF 
Sbjct  546  PRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQ  605

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QV+R+AR MV + G SKK+GQ+A    GG  FLG   +   D+S +TAD +D+EV+ELVE
Sbjct  606  QVTRIARLMVTQLGLSKKLGQVAWSNQGGASFLGASAAQPADFSQSTADEIDSEVKELVE  665

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            RAY RA  ++  +IDILHK+A +LIEKE +DG+EF  + +  +A+ + 
Sbjct  666  RAYRRAKDLVEQNIDILHKVAAVLIEKENIDGDEFQQIVLASQAQQYT  713



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   330 bits (845),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = -2

Query  769  KEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISII  590
            KEISK+EI+DALERIIAGPEKK AV+S++K++LVAYHEAGHALVGALMPEYDPV KISI+
Sbjct  481  KEISKEEIADALERIIAGPEKKGAVMSEKKRRLVAYHEAGHALVGALMPEYDPVTKISIV  540

Query  589  PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFM  410
            PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF 
Sbjct  541  PRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQ  600

Query  409  QVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVE  230
            QV+R+AR MV + G SKK+GQ+A    GG  FLG   +   D+S ATAD +D EV+ELVE
Sbjct  601  QVTRIARLMVTQLGLSKKLGQVAWSSSGGAQFLGASAAQPADFSQATADEIDNEVKELVE  660

Query  229  RAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            RAY RA  ++ ++IDILHK+A +LIEKE +DG+EF  + +  +A+ ++
Sbjct  661  RAYRRAKDLVVSNIDILHKVAAVLIEKENIDGDEFQQIVLASQAQQYL  708



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   328 bits (842),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPVAKISI+P
Sbjct  480  EISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVAKISIVP  539

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFFAPSEERLESGLYSRSYLENQMAVA+GGRVAEE+IFG ++VTTGAS DF Q
Sbjct  540  RGAAGGLTFFAPSEERLESGLYSRSYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQ  599

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            VS+ ARQM+E  GFSKKIGQIA+   GG  FLG +M    DY  ATAD+VD+EV+ELV +
Sbjct  600  VSQTARQMIETMGFSKKIGQIALKTGGGQSFLGGEMGRSADYGPATADLVDSEVKELVTK  659

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            AY RA  +++ +ID+LHK+A +L+EKE +DG+EF  +  + K+EL++
Sbjct  660  AYRRAKDLVSINIDVLHKVADVLMEKENIDGDEFEKIMFNAKSELYL  706



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   310 bits (794),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  14   KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  73

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  74   RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  133

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  134  VANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  193

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  194  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  239



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   309 bits (792),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  109  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  168

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  169  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  228

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  229  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  288

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  289  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  119  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  178

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  179  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  238

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  239  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDV  298

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  299  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  344



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLT+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  Q
Sbjct  446  RGQAGGLTWFTPSEERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ 
Sbjct  506  VARVARQMVTRFGMSEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRSLVDV  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AYSRA Q++  +  +L +LA +L++KETVD +E   L ID    +
Sbjct  566  AYSRAKQVLVENRKVLDQLADMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLT+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  Q
Sbjct  446  RGQAGGLTWFTPSEERLESGLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S+K+G +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ 
Sbjct  506  VARVARQMITRFGMSEKLGPVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRGLVDV  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AYSRA Q++  +  +L +LA++L++KETVD +E   L ID    +
Sbjct  566  AYSRAKQVLVENRKVLDQLAEMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  168  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  227

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  228  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  287

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  288  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  347

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  348  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  393



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  217  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  276

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  277  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  336

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  337  VANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  396

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  397  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  442



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EISKDEI+DALER++AGPEKK AVVS+ K++LVAYHE GHALVGALMPEYD V+KISI+P
Sbjct  482  EISKDEIADALERLVAGPEKKGAVVSESKRRLVAYHEGGHALVGALMPEYDAVSKISIVP  541

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFFAPSEERLE+GLYSRSYLENQM+VALGGRVAEE+I G DNVTTGAS DF Q
Sbjct  542  RGNAGGLTFFAPSEERLENGLYSRSYLENQMSVALGGRVAEELILGPDNVTTGASGDFQQ  601

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVAR MVE+ GFS  +GQ+A    GG  FLG QM+   + S  T D++D EV+ LV+R
Sbjct  602  VTRVARMMVEQMGFSDSLGQVAWSQSGGGSFLGAQMAQPANCSGETQDIIDKEVKSLVDR  661

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            AY RA  +I  +I +LH+ A++L+EKE +DGEE  +L ++ ++E ++
Sbjct  662  AYRRAKDLIQNNISVLHRTAEILLEKEQMDGEELQALLLEAQSEQYL  708



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  177  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  236

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  237  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  296

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ 
Sbjct  297  VARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDS  356

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA +++T +  +L +LA++L+EKETVD EE   L 
Sbjct  357  AYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQDLL  394



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  243  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  302

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  303  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  362

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  363  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  422

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  423  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  468



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+P
Sbjct  478  EISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVP  537

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFFAPSEERLESGLYSR+YLENQMAVA+GGRVAEE+IFG +NVTTGAS DF Q
Sbjct  538  RGAAGGLTFFAPSEERLESGLYSRTYLENQMAVAMGGRVAEELIFGAENVTTGASGDFQQ  597

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            VSR AR M+E+ GFS+KIGQIA+   GG  FLG       DYS ATAD+VD+EV+ LVE 
Sbjct  598  VSRTARMMIEQMGFSEKIGQIALKTGGGQTFLGNDAGRGADYSQATADIVDSEVQALVEV  657

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            AY RA  ++  +I  LH +A++L++KE +DG+EF  + +  KA+L++
Sbjct  658  AYRRAKDLVQENIQCLHDVAEVLLDKENIDGDEFEQIMLKAKAKLYL  704



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+P
Sbjct  489  EISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVP  548

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFFAPSEERLESGLYSR+YLENQMAVA+GGR+AEE+IFG +NVTTGAS DF Q
Sbjct  549  RGNAGGLTFFAPSEERLESGLYSRTYLENQMAVAMGGRIAEELIFGAENVTTGASGDFQQ  608

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            VS  AR MVE+ GFS+KIGQIA+   GG  FLG       DYS  TA++VD EV+ LVE 
Sbjct  609  VSNTARMMVEQMGFSEKIGQIALKTGGGQSFLGNDAGRAADYSQTTANIVDDEVKILVET  668

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  86
            AY RA  ++  +ID LH +A++L+EKE +DG+EF  + +  +A+L++
Sbjct  669  AYRRAKDLVQENIDCLHAVAEVLLEKENIDGDEFEEIMLKARAKLYL  715



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE+SDA+ER++AGPEKK+ V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  374  EVSNDEVSDAIERVMAGPEKKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  433

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  434  RGQAGGLTFFTPSEERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQ  493

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ 
Sbjct  494  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDM  553

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RAT+++T +  +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  554  AYKRATKVLTNNRQVLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  598



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE+SDA+ER++AGPEKK+ V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EVSNDEVSDAIERVMAGPEKKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGQAGGLTFFTPSEERMESGLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ 
Sbjct  507  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDM  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RAT+++T +  +L +LA++L+EKETV+ E+   L I  + E+
Sbjct  567  AYKRATKVLTNNRQVLDQLAEMLVEKETVNSEDLQDLLIQSQVEV  611



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  352  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  411

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  412  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  471

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  472  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  531

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T + ++L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  532  AYKRATKVLTDNRNVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  577



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  310  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  369

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  370  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  429

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  430  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  489

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  490  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  535



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+G+D VTTGASND  Q
Sbjct  446  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGDDEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LVE 
Sbjct  506  VARVARQMVTRFGMSEKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSQLVEE  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++T +  +L +LA LL+EKETVD EE   L I
Sbjct  566  AYRRATEVLTNNRAVLDQLADLLVEKETVDAEELQELLI  604



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIP
Sbjct  169  EVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIP  228

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  229  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  288

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ 
Sbjct  289  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDV  348

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA LL+EKETVD ++   L I
Sbjct  349  AYKRATKVLIENRSVLDELADLLVEKETVDAQDLQELLI  387



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIP
Sbjct  174  EVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIP  233

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  234  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  293

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ 
Sbjct  294  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDV  353

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA LL+EKETVD ++   L I
Sbjct  354  AYKRATKVLIENRSVLDELADLLVEKETVDAQDLQELLI  392



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T + ++L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRNVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+RLESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   GN FLG+ ++ ++D+S  TA  +DAEVR LV++
Sbjct  505  VARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDAEVRGLVDQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA Q++T +  +L +LA++L++KETVD EE   L 
Sbjct  565  AYARAKQVLTNNRHVLDQLAKMLVDKETVDSEELQHLL  602



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   308 bits (789),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEINDAIDRVLAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV++
Sbjct  508  VTRVARQMVTRFGMSDRLGPVALGRQSGNVFLGRDIASDRDFSDETAAAIDEEVRNLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL KLA +L+EKETVD EEF  L  +   ++
Sbjct  568  AYRRAKEVLVGNRHILDKLADMLVEKETVDSEEFQDLLANNDVKM  612



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   308 bits (789),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 187/227 (82%), Gaps = 2/227 (1%)
 Frame = -2

Query  763  ISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPR  584
            +S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPR
Sbjct  390  VSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPR  449

Query  583  GQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQV  404
            GQAGGLTFF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV
Sbjct  450  GQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQV  509

Query  403  SRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERA  224
            + VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ A
Sbjct  510  ANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVA  569

Query  223  YSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            Y RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  570  YKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  352  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  411

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  412  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  471

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  472  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  531

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  532  AYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  577



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   308 bits (788),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA V+D EVR+LV  
Sbjct  508  VARVARQMVSRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAVIDEEVRQLVNN  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++  +  IL KLA++L+EKETVD EE  S+ 
Sbjct  568  AYIRAKDVLVNNRHILDKLAEMLVEKETVDAEELQSIL  605



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 180/219 (82%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ERI+ GPEKK+AV+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EVSNDEISDAIERIMVGPEKKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  Q
Sbjct  447  RGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQM+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ 
Sbjct  507  VAQVARQMITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RATQ++  +  +L +LA LL+EKETVD EE   L I
Sbjct  567  AYKRATQVLVDNRSVLDELADLLVEKETVDAEELQELLI  605



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKQLVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 185/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ 
Sbjct  506  VARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDS  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA Q++T +  +L +LAQ+L+EKETVD EE   L 
Sbjct  566  AYARAKQVLTDNRHVLDQLAQMLVEKETVDAEELQELL  603



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVKVA  614



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 185/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+RLESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRLESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   GN FLG+ ++ ++D+S  TA  +D+EVR LV++
Sbjct  505  VARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDSEVRGLVDQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA Q++T +  +L +LA +L++KETVD EE   L 
Sbjct  565  AYTRAKQVLTNNRHVLDQLANMLVDKETVDSEELQQLL  602



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGLFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  372  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  431

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  432  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  491

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  492  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  551

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  552  AYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  597



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQDLL--NRSEVVVA  614



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV++
Sbjct  508  VARVARQMVSRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRQLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  IL KLAQ+L+EKETVD +E   +    + ++
Sbjct  568  AYKRAKDVLVNNRHILDKLAQMLVEKETVDADELQEILTSNEVKM  612



>gb|KGF88464.1| cell division protein FtsH2 [Prochlorococcus marinus str. GP2]
Length=580

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  352  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  411

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  412  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  471

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ 
Sbjct  472  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDV  531

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  532  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL  569



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQM+VALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMSVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQELL--NRSEVTVA  614



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  375  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  434

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  435  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  494

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  495  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  554

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  555  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  600



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSQLVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ 
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDNEVRQLVDT  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AYSRA  ++ ++  IL +LA +L+EKETVD +E   + 
Sbjct  569  AYSRAKDVLESNRHILDRLADMLVEKETVDSDELQEIL  606



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032523992.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++
Sbjct  508  VARVARQMVTRFGMSDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  IL +LA++L+EKETVD EE  +L  +  A+L
Sbjct  568  AYQRAKQVLVENRGILDQLAEILVEKETVDSEELQTLLANNNAKL  612



>ref|WP_025971407.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=598

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  370  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  429

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  430  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  489

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  490  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  549

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  550  AYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  595



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  569  AYRRAKEVLVNNRTILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV R+G S+K+G +A+G   GN FLG+ +  ++D+S  TA  +D EVR+LV+ 
Sbjct  506  VARVARQMVTRYGMSEKLGPVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRKLVDA  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA Q++T +  IL +LAQLL+EKETVD EE   L 
Sbjct  566  AYKRAKQVLTENRHILDQLAQLLMEKETVDAEELQELL  603



>ref|WP_025937318.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519O21]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_025965256.1| cell division protein FtsH [Prochlorococcus sp. scB243_496M6]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDI  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSELVDM  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  IL ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTILDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925013.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  569  AYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_025981174.1| cell division protein FtsH [Prochlorococcus sp. scB245a_521B10]
Length=617

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_038542994.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
 gb|AII42342.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
Length=615

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 181/220 (82%), Gaps = 0/220 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ERI+ GPEKK+AV+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EVSNDEISDAIERIMVGPEKKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  Q
Sbjct  447  RGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQM+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ 
Sbjct  507  VAQVARQMITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFID  107
            AY RAT+++  +  +L +LA LL+EKETVD EE   L I+
Sbjct  567  AYKRATKVLVDNRLVLDELADLLVEKETVDAEELQELLIN  606



>ref|WP_011375794.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABB49290.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG00943.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9311]
Length=617

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDI  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+S++KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISEKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ 
Sbjct  506  VARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDS  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA +++T +  +L +LA++L+EKETVD EE   L 
Sbjct  566  AYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ 
Sbjct  506  VARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDS  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA +++T +  +L +LA++L+EKETVD EE   L 
Sbjct  566  AYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++  +   ++
Sbjct  569  AYRRAKEVLVNNRVILDQLAQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   305 bits (781),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ 
Sbjct  506  VARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDS  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA +++T +  +L +LA++L+EKETVD EE   L 
Sbjct  566  AYARAKKVLTDNRHVLDQLAEMLVEKETVDAEELQDLL  603



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQ  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LAQ+L+EKETVD EE  ++ 
Sbjct  569  AYRRAKEVLVNNRVILDQLAQMLVEKETVDAEELQNIL  606



>ref|WP_032514590.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF89182.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF89938.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95373.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9123]
Length=617

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ M++ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMTSSRDFSEDTAATIDEEVSELVDI  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RAT++++ +  +L ++AQ+LIE+ET+D E+   L 
Sbjct  569  AYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQDLL  606



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EV +LV+ 
Sbjct  506  VARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVHQLVDS  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA Q++T +  IL +LA++L+EKETVD EE   L 
Sbjct  566  AYARAKQVLTDNRHILDQLAEMLVEKETVDAEELQELL  603



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  449  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ 
Sbjct  509  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSNETASTIDEEVRQLVDT  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++ ++  IL +LA +L+EKETVD +E   + 
Sbjct  569  AYKRAKDVLESNRHILDRLADMLVEKETVDSDELQEIL  606



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S ++K+LVAYHEAGHALVGALMP+YDP+ KISIIP
Sbjct  387  EISMDEVNDAIDRVLAGPEKKNRVMSQKRKELVAYHEAGHALVGALMPDYDPIQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE++FGE+ VTTGASND  Q
Sbjct  447  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIVFGEEEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S+++G +A+G   GN FLG+ +++ +D+S +TA ++D EV++LV+ 
Sbjct  507  VARVARQMITRFGMSERLGPVALGRQNGNVFLGRDIASDRDFSDSTAAMIDEEVKKLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  + ++L  LAQ+L+EKETVD EE   L  +   +L
Sbjct  567  AYQRAKDVLQNNREVLDTLAQMLVEKETVDSEELQELLNNNDVKL  611



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 190/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE+ DA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EVSNDEVGDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLTQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S+K+G +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ 
Sbjct  507  VAQVARQMVTRFGMSEKLGPVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDF  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++  +  +L +LA++L+EKETVD E+  +L I  K+E+ +A
Sbjct  567  AYKRATKVLIDNRKVLDELAEMLVEKETVDSEQLQNLLI--KSEVKIA  612



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+E+GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPSEDRMETGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVRELVE 
Sbjct  504  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAAIDDEVRELVEV  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++ ++  IL +LAQ+LI+KETVD EE   L 
Sbjct  564  AYRRAKEVLVSNRHILDQLAQMLIDKETVDAEELQELL  601



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S ++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EISMDEINDAIDRVLAGPEKKNRVMSQKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  447  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN F+G+ +++ +D+S +TA  +D EV++LV++
Sbjct  507  VARVARQMITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDSTASAIDDEVKKLVDQ  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA Q++  +  +L KLA +L+EKETVD +E   + 
Sbjct  567  AYQRAKQVLVENRAVLDKLANMLVEKETVDADELQDIL  604



>ref|WP_025961749.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521C8]
Length=213

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 175/212 (83%), Gaps = 2/212 (1%)
 Frame = -2

Query  718  GPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEER  539
            GPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER
Sbjct  1    GPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEER  60

Query  538  LESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSK  359
            +ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+
Sbjct  61   MESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSE  120

Query  358  KIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDIL  179
            KIG +A+G   G  FLG+ MST +D+S  TA  +D EV ELV+ AY RAT+++T +  +L
Sbjct  121  KIGPVALGQSQGGMFLGRDMSTTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVL  180

Query  178  HKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
             ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  181  DEMAQMLIERETIDTEDIQDLL--NRSEVKVA  210



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+ +G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ 
Sbjct  506  VARVARQMVTRFGMSETLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDA  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA Q++T +  +L +LA++L+EKETVD EE   L 
Sbjct  566  AYKRAKQVLTDNRHVLDQLAEMLVEKETVDAEELQELL  603



>ref|WP_007100703.1| cell division protein FtsH [Synechococcus sp. RS9917]
 gb|EAQ68631.1| cell division protein [Synechococcus sp. RS9917]
Length=616

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 182/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  448  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  
Sbjct  508  VAQVARQMVTRFGMSDKLGPVALGRAQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVSV  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RATQ++T +  +L +LA++L+++ETVD E+   L +
Sbjct  568  AYKRATQVLTQNRSVLDELAEMLVDQETVDAEDLQELLM  606



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D E+R LV++
Sbjct  508  VTRVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETASAIDEEIRNLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LA++L++KETVD +E   L 
Sbjct  568  AYRRAKEVLVENRSILDRLAEMLVDKETVDSDELQDLL  605



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 187/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+S +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISAKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTDNRIVLDEMAQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YDPV KISIIP
Sbjct  386  EVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYHESGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  446  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  
Sbjct  506  VARVARQMVTRFGMSDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSQLVAD  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA+LL+EKETVD EE   L I
Sbjct  566  AYRRATEVLLANRAVLDELAELLVEKETVDAEELQELLI  604



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN ++S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRMMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++
Sbjct  508  VARVARQMVTRFGMSDRLGPVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LA++L+EKETVD EE  +L     A+L
Sbjct  568  AYQRAKRVLVENRGILDQLAEMLVEKETVDSEELQTLLASNNAKL  612



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIP
Sbjct  387  EVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ 
Sbjct  507  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA LL+EKETVD ++   L I
Sbjct  567  AYKRATKVLIENRSVLDELADLLVEKETVDAQDLQDLLI  605



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 179/219 (82%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  446  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV  
Sbjct  506  VARVARQMVTRFGMSDRLGPVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSALVAE  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT ++  +  +L +LA+LL+EKETVD EE   L I
Sbjct  566  AYRRATDVLVANRSVLDELAELLVEKETVDAEELQELLI  604



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIP
Sbjct  384  EISMDEINDAIDRVLAGPEKKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F P+E++++SGLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPNEDQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+
Sbjct  504  VARVARQMVTRFGMSDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQ  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  +L ++AQ+LIEKET+D EE  S+ 
Sbjct  564  AYRRAKEVLVNNRHVLDQIAQVLIEKETIDAEELQSIL  601



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIP
Sbjct  384  EISMDEINDAIDRVLAGPEKKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F P+E++++SGLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPNEDQMDSGLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+
Sbjct  504  VARVARQMVTRFGMSDRLGPVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQ  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  +L ++AQ+LIEKET+D EE  S+ 
Sbjct  564  AYRRAKEVLVNNRHVLDQIAQVLIEKETIDAEELQSIL  601



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR+LV++
Sbjct  508  VARVARQMVTRFGMSDRLGPVALGRQQGNVFLGREIASDRDFSDETAAAIDEEVRKLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AYSRA  +++++  IL  LA +L+EKETVD EE  ++ 
Sbjct  568  AYSRAKDVLSSNRHILDALADMLVEKETVDAEELQNIL  605



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIP
Sbjct  387  EVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ 
Sbjct  507  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA LL+EKETVD ++   L I
Sbjct  567  AYKRATKVLIENRSVLDELADLLVEKETVDAQDLQELLI  605



>ref|WP_019478058.1| cell division protein FtsH [Prochlorococcus sp. W8]
Length=618

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  390  KVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  450  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ 
Sbjct  510  VANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDS  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  570  AYKRATKVLTDNRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_011932280.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK22781.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=617

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  389  EVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  449  RGNAGGLTFFTPSEERMESGLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV ELV+ 
Sbjct  509  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA++L+E+ETVD E+   L I
Sbjct  569  AYKRATKVLVGNRSVLDELAEMLVEQETVDAEQLQELLI  607



>ref|WP_032527521.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF96190.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9302]
Length=617

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 188/228 (82%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ 
Sbjct  509  VANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSDLVDI  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT++++ +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLSDNRTVLDEMAEMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_019477234.1| cell division protein FtsH [Prochlorococcus sp. W7]
Length=618

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  390  KVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  450  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ 
Sbjct  510  VANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDS  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  570  AYKRATKVLTENRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_006042287.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR19163.1| cell division protein FtsH2 [Synechococcus sp. WH 7805]
Length=616

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 182/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  448  RGNAGGLTFFTPSEERMESGLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ 
Sbjct  508  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVDV  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++ ++  +L ++A++L+E+ETVD EE   L I
Sbjct  568  AYKRATKVLVSNRSVLDEIAEMLVEQETVDAEELQELLI  606



>ref|WP_011936606.1| cell division protein FtsH [Synechococcus sp. RCC307]
 emb|CAK29096.1| Cell division protein FtsH [Synechococcus sp. RCC307]
Length=618

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEI+DA+ER++AGPEKK+ V+S+++K+LVAYHE+GHALVGALMP+YDPV KISIIP
Sbjct  390  EVSMDEINDAIERVMAGPEKKDRVMSEKRKRLVAYHESGHALVGALMPDYDPVQKISIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  450  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEELVYGEDEVTTGASNDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV+ 
Sbjct  510  VARVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTAATIDKEVSSLVDA  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY+RA Q+++ +  +L +LA++L+E ETVD E+   L I   A++
Sbjct  570  AYTRAVQVLSDNRALLDELAEMLVEMETVDAEQLQELLISRDAKV  614



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EI+ DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EIAMDEVNDAIDRVLAGPEKKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEERLESGLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEERLESGLYSRSYLQNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+  ARQMV RFG S  +G +A+G   GNPFLG+ +++++D+S  TA  +DAEVR LV++
Sbjct  505  VANTARQMVTRFGMSDILGPVALGRQQGNPFLGRDIASERDFSEKTAASIDAEVRALVDQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY+R  Q++  +  IL +LA +L++KETVD EE  +L  +  A++
Sbjct  565  AYARCKQVLVENRHILDQLADMLVDKETVDSEELQTLLANSNAKM  609



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEINDAIDRVLAGPEKKDRVMSERRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S K+G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ 
Sbjct  505  VARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDA  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA  ++T +  +L +LA +L+EKETVD EE   L 
Sbjct  565  AYARAKTVLTDNRHVLDQLADMLVEKETVDAEELQELL  602



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV K+SIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKRLVAYHEAGHALVGALMPDYDPVQKVSIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ 
Sbjct  504  VARVARQMITRFGMSDRLGPVALGRQNGNMFLGRDIASDRDFSNTTAATIDEEVRKLVDE  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY+RA  ++  +  IL KL+ +LIEKETVD EE   L  +   ++
Sbjct  564  AYNRAKDVLVGNKHILDKLSAMLIEKETVDAEELQELLAENDVKM  608



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  396  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  455

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  Q
Sbjct  456  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEELVFGEEEVTTGASNDLQQ  515

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LV++
Sbjct  516  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVDQ  575

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++T +  +L KLAQ+L+EKETVD EE   L 
Sbjct  576  AYRRAKAVLTQNRAVLDKLAQMLVEKETVDAEELQDLL  613



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++
Sbjct  508  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL KLA +LIEKETVD EE   + 
Sbjct  568  AYRRAKEVLVNNRHILDKLADMLIEKETVDAEELQDVL  605



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  390  KVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  450  RGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S KIG +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ 
Sbjct  510  VANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDS  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++A++LIE+ET+D E+   L    ++E+ VA
Sbjct  570  AYKRATKVLTENRGMLDEMAEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+++GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPSEDRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ 
Sbjct  504  VARVARQMITRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDT  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++T +  IL +LAQ+L+EKETVD +E   L 
Sbjct  564  AYKRAKSVLTNNRAILDRLAQMLVEKETVDADELQELL  601



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEVNDAIDRVLAGPEKKDRVMSERRKELVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEERLESGLYSR+YL+NQMAVALGGR+AEE+++G + VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEERLESGLYSRAYLQNQMAVALGGRIAEEIVYGNEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA ++DAEVR LV++
Sbjct  505  VARVARQMITRFGMSGELGPVALGRQQGNMFLGRDITAERDFSEETAAIIDAEVRSLVDQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA Q++  +  IL KLA +L+EKETVD EE   L 
Sbjct  565  AYDRAKQVLVENRAILDKLAGMLVEKETVDSEELQELL  602



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE 
Sbjct  508  VANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEE  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  +L KLA +L+EKETVD EE  +L ++   ++
Sbjct  568  AYKRAKDVLVGNRSVLDKLAAMLVEKETVDAEELQTLLMESDVQM  612



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ 
Sbjct  504  VTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDA  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  564  AYKRAKQVLVENRHVLNQLANILIDKETVDADELQELLANNEVKM  608



>ref|WP_043694696.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
 gb|AII46861.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
Length=615

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 178/219 (81%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ERI+ GPEKK+AV+S+ KK LVAYHEAGHA+VGALMP+YDPV KISIIP
Sbjct  387  EVSNDEISDAIERIMVGPEKKDAVISERKKWLVAYHEAGHAIVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+  ARQM+ RFG S K+G +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ 
Sbjct  507  VASTARQMITRFGMSDKLGPVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVSDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA+LL+E+ETVD EE   L I
Sbjct  567  AYKRATKVLVDNRPVLDELAELLVEQETVDAEELQELLI  605



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+++GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPSEDRMDTGLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ 
Sbjct  504  VARVARQMITRFGMSDRLGPVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDT  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++T +  IL +LAQ+L+EKETVD +E   L 
Sbjct  564  AYKRAKSVLTDNRAILDRLAQMLVEKETVDADELQELL  601



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+++GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDTGLYSRAYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE 
Sbjct  506  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVET  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL KLA++L+EKETVD EE   + 
Sbjct  566  AYRRAKEVLENNRHILDKLAEMLVEKETVDAEELQDVL  603



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ 
Sbjct  504  VTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDA  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  564  AYKRAKQVLVENRHVLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  387  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  Q
Sbjct  447  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRIAEEIIFGQEEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EV +LVER
Sbjct  507  VARVARQMITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDTTAATIDEEVSQLVER  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++  +  IL KLA++L+EKETV+ +E   + 
Sbjct  567  AYQRAKDVLVQNRPILDKLAEMLVEKETVEADELQEIL  604



>ref|WP_019474071.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSEKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDV  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTENRGMLDEMAQMLIERETIDTEDIQDLI--NRSEVKVA  614



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVMAGPEKKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALGGR+AEE+I+GE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGGRLAEEIIYGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EVR  V++
Sbjct  508  VTRVARQMVTRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSNETAAAIDEEVRNYVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AYSRA +++  + +IL +LA++LIEKETV+ +E   +  +   ++
Sbjct  568  AYSRAKKVLLDNRNILDRLAEMLIEKETVEADELQDILANNDVKM  612



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ 
Sbjct  504  VTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDA  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  564  AYKRAKQVLVENRHVLNQLADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ 
Sbjct  504  VTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDA  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  564  AYKRAKQVLVENRHVLNQLADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_019476442.1| cell division protein FtsH [Prochlorococcus sp. W4]
Length=617

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 189/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            ++S DE+ DA+ER++AGPEKK+ V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIP
Sbjct  389  KVSNDEVGDAIERVMAGPEKKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIP  448

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  Q
Sbjct  449  RGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQ  508

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ +FG S+KIG +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ 
Sbjct  509  VANVARQMITKFGMSEKIGPVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDI  568

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  569  AYKRATKVLTENRGMLDEMAQMLIERETIDTEDIQDLI--NRSEVKVA  614



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+ +K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  237  EISMDEINDAIDRVLAGPEKKDRVMSERRKLLVAYHEAGHALVGALMPDYDPVQKISIIP  296

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F P+E+R++SGLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  Q
Sbjct  297  RGRAGGLTWFTPNEDRMDSGLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQ  356

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ 
Sbjct  357  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAATIDEEVRQLVDA  416

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA Q++  +  IL++LA +L+EKETVD EE   + 
Sbjct  417  AYIRAKQVLEENRHILNQLADILVEKETVDAEELQDIL  454



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG AGGLT+F PSEER++SGLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  446  RGAAGGLTWFTPSEERMDSGLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+++G +A+G   GN FLG+ ++ ++D+S  TA  +D EV +LV+ 
Sbjct  506  VARVARQMVTRFGMSERLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDEEVSKLVDE  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY+RA Q+++ +  +L +L+++L+EKETVD EE   L  +   ++
Sbjct  566  AYTRAKQVLSENRSVLDRLSEMLVEKETVDAEELQDLLANSDVKM  610



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 182/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            E+S DEISDA+ER++ GPEKK+ V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIP
Sbjct  387  EVSNDEISDAIERVMVGPEKKDRVMSERRKRLVAYHESGHALVGALMPDYDSVQKISIIP  446

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  Q
Sbjct  447  RGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQ  506

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V++VARQMV RFG S K+G +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ 
Sbjct  507  VAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDV  566

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  110
            AY RAT+++  +  +L +LA LL+EKET+D ++   L I
Sbjct  567  AYKRATKVLIENRSVLDELADLLVEKETLDAQDLQELLI  605



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMDSGLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE 
Sbjct  508  VANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEE  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  +L KLA +L+EKETVD EE  ++ ++   ++
Sbjct  568  AYKRAKDVLVNNRAVLDKLAAMLVEKETVDAEELQTVLMENDVKM  612



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEVNDAIDRVLAGPEKKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+ESGL+SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMESGLFSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++
Sbjct  508  VARVARQMVTRFGMSDRLGPVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQ  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++  +  IL +LA +LIEKETVD EE   +  +   ++
Sbjct  568  AYRRAKEVLMNNRPILDQLASMLIEKETVDAEELQDILANNDVKM  612



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score =   300 bits (767),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER+ESGLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEERMESGLYSRTYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR+LV+ 
Sbjct  505  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIAAERDFSEETAATIDDEVRQLVDV  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA +++  +  IL +LA++L+EKETVD EE   L 
Sbjct  565  AYDRAKKVLIENRSILDQLAKMLVEKETVDAEELQDLL  602



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score =   300 bits (767),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVA+QMV RFG S ++G +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LVE+
Sbjct  505  VARVAKQMVTRFGMSDRLGPVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVEQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY RA  ++  +  +L KLA++L++KETVD EE   L 
Sbjct  565  AYRRAKAVLVQNRPVLDKLAEMLVDKETVDAEELQELL  602



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  390  EISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER+E+GLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGA+ND  Q
Sbjct  450  RGRAGGLTWFTPSEERMEAGLYSRAYLQNQMAVALGGRIAEEIVFGEEEVTTGAANDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ RFG S ++G +A+G   G  FLG+ +++ +D+S  TA  +D EVR LVE+
Sbjct  510  VARVARQMITRFGMSDRLGPVALGRQNGGVFLGRDIASDRDFSDETAATIDEEVRLLVEQ  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  +L +LAQ+L+EKETVD EE  +L  +   ++
Sbjct  570  AYRRAKDVLVNNRHVLDQLAQILVEKETVDAEELQALLANNDVKM  614



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S+++G +A+G   GN FLG+ +  ++D+S  TA V+D EV  LVE+
Sbjct  505  VARVARQMVMRFGMSERLGPVALGRQQGNMFLGRDIMAERDFSEETASVIDEEVSTLVEQ  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA +++ ++  +L  LA +L+EKETVD EE   L  +   ++
Sbjct  565  AYRRAKEVLVSNRHVLDTLADMLVEKETVDSEELQDLLANSDVKM  609



>ref|WP_011819579.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM71467.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9515]
Length=619

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 184/227 (81%), Gaps = 2/227 (1%)
 Frame = -2

Query  763  ISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPR  584
            +S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGA MP+YD VAK+SIIPR
Sbjct  392  VSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGACMPDYDAVAKVSIIPR  451

Query  583  GQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQV  404
            GQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV
Sbjct  452  GQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQV  511

Query  403  SRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERA  224
            + VARQM+ +FG S KIG +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ A
Sbjct  512  ANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVA  571

Query  223  YSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA  83
            Y RAT+++T +  +L ++A +LIE+ET+D E+   L    ++E+ VA
Sbjct  572  YKRATKVLTDNRSVLDEMAMMLIERETIDTEDIQDLL--NRSEVKVA  616



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVG+LMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGSLMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQM+ R+G S ++G +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ 
Sbjct  504  VTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDA  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA Q++  +  +L++LA +LI+KETVD +E   L  + + ++
Sbjct  564  AYKRAKQVLVENRHVLNQLANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_035155002.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB84628.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=613

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  385  EISMDEINDAIDRVLAGPEKKDRVISEKRKLLVAYHEAGHALVGALMPDYDPVQKISIIP  444

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  445  RGRAGGLTWFTPSEDRMDSGLYSRAYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQ  504

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVA+QMV RFG S ++G +A+G   GN FLG+ +  ++D+S  TA  +D EVR LV+ 
Sbjct  505  VARVAKQMVTRFGMSDRLGPVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRHLVDA  564

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY+RA  ++T +  IL KLA +L+EKETVD EE   L 
Sbjct  565  AYNRAKHVLTENRHILDKLAGMLVEKETVDAEELQDLL  602



>ref|WP_015133797.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
 gb|AFY38027.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
Length=620

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKKN V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  388  EISMDEINDAIDRVMAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  447

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALGGR+AEE+IFG + VTTGASND  Q
Sbjct  448  RGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALGGRIAEEIIFGAEEVTTGASNDLQQ  507

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+ VARQM+ RFG S ++G +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE 
Sbjct  508  VANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDIASDRDFSDETASVIDEEVRGLVEE  567

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  +L +LA +L+EKETVD EE  +L ++   ++
Sbjct  568  AYVRAKDVLVGNRSVLDRLADMLVEKETVDSEELQTLLMESDVKM  612



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  390  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIP  449

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSEER++SGLYSR+YL+NQMAVALGGRVAEE+IFGE+ VTTGASND  Q
Sbjct  450  RGRAGGLTWFTPSEERMDSGLYSRAYLQNQMAVALGGRVAEELIFGEEEVTTGASNDLQQ  509

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN F+G+ +++ +D+S  TA  +D EVR+LV++
Sbjct  510  VARVARQMVTRFGMSDRLGPVALGRQNGNMFMGRDIASDRDFSDETASAIDEEVRKLVDQ  569

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY R  +++  +  IL KLA++L+E ETVD EE  +L  +   ++
Sbjct  570  AYERTVEVLKGNRQILDKLAEMLVEAETVDSEELQNLLAESDVKM  614



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DEI+DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  386  EISMDEINDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  445

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+++GLYSR+YLENQMAVALGGR++EE+IFGE+ VTTGASND  Q
Sbjct  446  RGRAGGLTWFTPSEDRMDTGLYSRAYLENQMAVALGGRISEELIFGEEEVTTGASNDLQQ  505

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE 
Sbjct  506  VARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVEA  565

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLF  113
            AY R+ +++  +  IL KLA++L+EKETVD EE   L 
Sbjct  566  AYRRSKEVLENNRHILDKLAEMLVEKETVDAEELQELL  603



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -2

Query  766  EISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIP  587
            EIS DE++DA++R++AGPEKK+ V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIP
Sbjct  384  EISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIP  443

Query  586  RGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQ  407
            RG+AGGLT+F PSE+R+++GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  Q
Sbjct  444  RGRAGGLTWFTPSEDRMDTGLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQ  503

Query  406  VSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVER  227
            V+RVARQMV RFG S ++G +A+G   GN FLG+++++ +D+S  TA  +D EVR LV+ 
Sbjct  504  VTRVARQMVTRFGMSDRLGPVALGRQNGNMFLGREIASDRDFSDTTAATIDEEVRRLVDE  563

Query  226  AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAEL  92
            AY RA  ++  +  IL KLA +LIEKETVD +E   L  +   ++
Sbjct  564  AYERAKNVLLGNKHILDKLAGMLIEKETVDSDELQELLANNDVKI  608



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100