BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033C20

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  180   8e-53   Citrus sinensis [apfelsine]
gb|KJB30572.1|  hypothetical protein B456_005G149900                    186   1e-52   Gossypium raimondii
gb|KJB30571.1|  hypothetical protein B456_005G149900                    187   5e-52   Gossypium raimondii
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             176   5e-51   
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              184   7e-51   Gossypium arboreum [tree cotton]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    184   9e-51   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               184   1e-50   
ref|XP_007045633.1|  MATE efflux family protein isoform 1               183   1e-50   
emb|CDP11780.1|  unnamed protein product                                182   2e-50   Coffea canephora [robusta coffee]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   6e-50   Solanum lycopersicum
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   7e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             181   8e-50   Citrus clementina [clementine]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            180   1e-49   Glycine max [soybeans]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN73203.1|  hypothetical protein VITISV_008169                     174   2e-49   Vitis vinifera
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            179   4e-49   Solanum lycopersicum
gb|KJB69293.1|  hypothetical protein B456_011G014800                    179   5e-49   Gossypium raimondii
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   5e-49   Populus euphratica
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   6e-49   Camelina sativa [gold-of-pleasure]
emb|CBI28938.3|  unnamed protein product                                177   6e-49   Vitis vinifera
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   7e-49   Cicer arietinum [garbanzo]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    178   9e-49   Vitis vinifera
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   9e-49   Eucalyptus grandis [rose gum]
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   9e-49   Solanum tuberosum [potatoes]
ref|XP_003596992.1|  Transparent testa 12 protein                       178   1e-48   Medicago truncatula
emb|CDM86696.1|  unnamed protein product                                178   1e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-48   Vitis vinifera
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-48   Vitis vinifera
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   2e-48   Sesamum indicum [beniseed]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             177   2e-48   Phaseolus vulgaris [French bean]
emb|CDM86687.1|  unnamed protein product                                177   3e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             174   3e-48   
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   3e-48   Oryza brachyantha
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                177   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_002883313.1|  mate efflux family protein                         177   3e-48   
emb|CDP11781.1|  unnamed protein product                                175   4e-48   Coffea canephora [robusta coffee]
emb|CBI28937.3|  unnamed protein product                                177   4e-48   Vitis vinifera
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            174   5e-48   
ref|NP_188806.1|  MATE efflux family protein                            176   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                     176   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            176   8e-48   
dbj|BAJ34540.1|  unnamed protein product                                175   1e-47   Eutrema halophilum
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-47   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            175   1e-47   Glycine soja [wild soybean]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   1e-47   Nelumbo nucifera [Indian lotus]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            174   1e-47   Triticum urartu
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-47   Nicotiana sylvestris
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-47   Camelina sativa [gold-of-pleasure]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            175   2e-47   Glycine soja [wild soybean]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   Cicer arietinum [garbanzo]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   2e-47   Cicer arietinum [garbanzo]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          173   3e-47   
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   3e-47   Nicotiana tomentosiformis
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   3e-47   
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     172   3e-47   Eucalyptus grandis [rose gum]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   4e-47   
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    165   5e-47   Nicotiana alata [flowering tobacco]
emb|CDM86680.1|  unnamed protein product                                171   5e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            173   5e-47   Nelumbo nucifera [Indian lotus]
gb|AHI48506.1|  multidrug and toxic extrusion transporter               174   6e-47   Vaccinium corymbosum [American blueberry]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   7e-47   Camelina sativa [gold-of-pleasure]
emb|CBI23253.3|  unnamed protein product                                166   7e-47   Vitis vinifera
ref|XP_007026056.1|  MATE efflux family protein                         173   9e-47   
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            172   1e-46   Tarenaya hassleriana [spider flower]
emb|CDM86692.1|  unnamed protein product                                172   1e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             172   1e-46   Capsella rubella
gb|KEH36840.1|  MATE efflux family protein                              172   1e-46   Medicago truncatula
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            171   1e-46   Triticum urartu
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            171   1e-46   
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Populus euphratica
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   2e-46   Populus euphratica
emb|CDM86677.1|  unnamed protein product                                172   2e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            172   2e-46   Phoenix dactylifera
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-46   Cucumis melo [Oriental melon]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-46   Populus euphratica
emb|CBI23254.3|  unnamed protein product                                170   2e-46   Vitis vinifera
gb|AAR00628.1|  putative MATE family protein                            169   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   4e-46   Solanum lycopersicum
emb|CAN82750.1|  hypothetical protein VITISV_014577                     169   4e-46   Vitis vinifera
gb|ACL53378.1|  unknown                                                 170   4e-46   Zea mays [maize]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   5e-46   Elaeis guineensis
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             171   6e-46   Phaseolus vulgaris [French bean]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    171   6e-46   
emb|CDP04390.1|  unnamed protein product                                169   6e-46   Coffea canephora [robusta coffee]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            170   9e-46   Vitis vinifera
gb|KJB57728.1|  hypothetical protein B456_009G178100                    170   9e-46   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                    170   1e-45   Gossypium raimondii
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             170   1e-45   Eutrema salsugineum [saltwater cress]
gb|EEC75604.1|  hypothetical protein OsI_12313                          169   1e-45   Oryza sativa Indica Group [Indian rice]
ref|NP_001050520.1|  Os03g0570800                                       169   1e-45   
emb|CDP17486.1|  unnamed protein product                                170   1e-45   Coffea canephora [robusta coffee]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   1e-45   Setaria italica
ref|XP_002518492.1|  multidrug resistance pump, putative                169   2e-45   Ricinus communis
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Elaeis guineensis
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Nicotiana sylvestris
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              169   3e-45   Gossypium arboreum [tree cotton]
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   3e-45   Populus euphratica
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   4e-45   
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   4e-45   Solanum lycopersicum
ref|XP_003605914.1|  Transparent testa 12 protein                       168   5e-45   Medicago truncatula
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   5e-45   Cucumis melo [Oriental melon]
ref|XP_006389638.1|  MATE efflux family protein                         168   5e-45   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             168   5e-45   
dbj|BAH20308.1|  AT1G61890                                              163   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   9e-45   Vitis vinifera
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-44   Solanum tuberosum [potatoes]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           167   1e-44   Nicotiana tabacum [American tobacco]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   Populus euphratica
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             167   1e-44   Populus trichocarpa [western balsam poplar]
gb|ACZ55931.1|  MATE transporter 2                                      167   2e-44   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                      167   2e-44   Zea mays [maize]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   2e-44   Cucumis melo [Oriental melon]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    166   2e-44   Nicotiana sylvestris
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            166   2e-44   
ref|XP_002518495.1|  multidrug resistance pump, putative                166   2e-44   Ricinus communis
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         166   2e-44   Jatropha curcas
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          166   3e-44   Sorghum bicolor [broomcorn]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    166   3e-44   Populus euphratica
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             166   4e-44   
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Cicer arietinum [garbanzo]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    166   4e-44   Arabis alpina [alpine rockcress]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   4e-44   
gb|EEC75610.1|  hypothetical protein OsI_12322                          165   5e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                       165   5e-44   
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-44   Elaeis guineensis
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   7e-44   Brassica rapa
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   8e-44   Nicotiana sylvestris
ref|NP_564787.1|  MATE efflux family protein                            165   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   9e-44   Elaeis guineensis
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   9e-44   Solanum tuberosum [potatoes]
ref|NP_001142368.1|  uncharacterized protein LOC100274540               164   1e-43   Zea mays [maize]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   1e-43   Prunus mume [ume]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             164   1e-43   Populus trichocarpa [western balsam poplar]
emb|CBI23251.3|  unnamed protein product                                163   1e-43   Vitis vinifera
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            164   1e-43   Triticum urartu
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            164   1e-43   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   1e-43   Solanum tuberosum [potatoes]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Setaria italica
emb|CDY47166.1|  BnaA01g22920D                                          164   1e-43   Brassica napus [oilseed rape]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Zea mays [maize]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Prunus mume [ume]
gb|EEC75606.1|  hypothetical protein OsI_12318                          164   1e-43   Oryza sativa Indica Group [Indian rice]
gb|ABF97209.1|  MATE efflux family protein, expressed                   164   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Brassica rapa
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Nicotiana tomentosiformis
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Cucumis sativus [cucumbers]
gb|AAK82541.1|  At1g61890/F8K4_9                                        164   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            164   2e-43   Glycine soja [wild soybean]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Glycine max [soybeans]
ref|NP_001147791.1|  transparent testa 12 protein                       164   2e-43   Zea mays [maize]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    164   2e-43   Arabis alpina [alpine rockcress]
emb|CDY25329.1|  BnaC01g29980D                                          164   2e-43   Brassica napus [oilseed rape]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-43   Zea mays [maize]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             163   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            163   3e-43   Vitis vinifera
ref|NP_001148084.1|  transparent testa 12 protein                       163   3e-43   Zea mays [maize]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-43   Sesamum indicum [beniseed]
gb|AFW68307.1|  putative MATE efflux family protein                     161   4e-43   
gb|ACF85024.1|  unknown                                                 155   4e-43   Zea mays [maize]
ref|XP_002886501.1|  mate efflux family protein                         163   4e-43   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   5e-43   Malus domestica [apple tree]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   5e-43   Populus euphratica
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             162   6e-43   Citrus clementina [clementine]
emb|CDY07257.1|  BnaC04g19140D                                          159   6e-43   
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   6e-43   Citrus sinensis [apfelsine]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   162   6e-43   Citrus sinensis [apfelsine]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    162   6e-43   Arabis alpina [alpine rockcress]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   7e-43   Prunus mume [ume]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       162   8e-43   Cucumis sativus [cucumbers]
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   8e-43   Fragaria vesca subsp. vesca
dbj|BAD95082.1|  hypothetical protein                                   155   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            162   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-42   Prunus mume [ume]
gb|ACF85423.1|  unknown                                                 162   1e-42   Zea mays [maize]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Brassica rapa
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   1e-42   Elaeis guineensis
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             161   1e-42   Capsella rubella
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   2e-42   Pyrus x bretschneideri [bai li]
emb|CDY34833.1|  BnaA09g47590D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   Fragaria vesca subsp. vesca
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             161   2e-42   Prunus persica
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   2e-42   Brassica rapa
emb|CDY19507.1|  BnaC09g13960D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-42   Brassica rapa
emb|CDY12916.1|  BnaA09g13580D                                          160   3e-42   Brassica napus [oilseed rape]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    160   3e-42   Nicotiana tomentosiformis
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             160   3e-42   Populus trichocarpa [western balsam poplar]
emb|CDX76391.1|  BnaA08g10090D                                          160   3e-42   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-42   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Brassica rapa
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          160   4e-42   Sorghum bicolor [broomcorn]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            160   4e-42   Brassica rapa
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   5e-42   Prunus mume [ume]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   5e-42   Brassica rapa
emb|CDY71092.1|  BnaAnng36070D                                          150   5e-42   Brassica napus [oilseed rape]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             160   5e-42   Eutrema salsugineum [saltwater cress]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   6e-42   Populus euphratica
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   9e-42   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   9e-42   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   9e-42   
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   9e-42   Fragaria vesca subsp. vesca
emb|CDY34637.1|  BnaC08g41960D                                          158   1e-41   Brassica napus [oilseed rape]
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   1e-41   
emb|CDX98711.1|  BnaA03g44960D                                          159   1e-41   
ref|XP_002867813.1|  mate efflux family protein                         159   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Brassica rapa
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   1e-41   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             157   2e-41   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             159   2e-41   
gb|KGN43522.1|  Mate efflux family protein                              158   2e-41   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   
emb|CDX94061.1|  BnaC07g36950D                                          158   2e-41   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   3e-41   Brassica rapa
ref|XP_007026057.1|  MATE efflux family protein                         158   3e-41   
gb|AAM62936.1|  unknown                                                 158   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567640.1|  MATE efflux family protein                            158   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   3e-41   Populus euphratica
dbj|BAH19969.1|  AT4G21910                                              157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   4e-41   Camelina sativa [gold-of-pleasure]
gb|AGT17221.1|  transparent testa 12 protein                            157   4e-41   Saccharum hybrid cultivar R570
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             157   5e-41   Citrus clementina [clementine]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             157   5e-41   Populus trichocarpa [western balsam poplar]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               157   5e-41   
ref|NP_001149176.1|  transparent testa 12 protein                       157   5e-41   Zea mays [maize]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   6e-41   Nicotiana tomentosiformis
emb|CDX94063.1|  BnaC07g36970D                                          157   6e-41   
emb|CDY27431.1|  BnaC03g64710D                                          157   6e-41   Brassica napus [oilseed rape]
emb|CAN69304.1|  hypothetical protein VITISV_021604                     160   6e-41   Vitis vinifera
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   7e-41   Citrus sinensis [apfelsine]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   7e-41   Brassica rapa
emb|CDY27434.1|  BnaC03g64740D                                          157   8e-41   Brassica napus [oilseed rape]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   155   8e-41   Citrus sinensis [apfelsine]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             156   9e-41   Capsella rubella
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   9e-41   Nicotiana tomentosiformis
emb|CDY33129.1|  BnaCnng07000D                                          156   1e-40   Brassica napus [oilseed rape]
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    156   1e-40   Arabis alpina [alpine rockcress]
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             156   1e-40   
emb|CDX98713.1|  BnaA03g44980D                                          155   2e-40   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          155   2e-40   Sorghum bicolor [broomcorn]
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   2e-40   
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   2e-40   Pyrus x bretschneideri [bai li]
emb|CDY39494.1|  BnaA01g24940D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             155   2e-40   
emb|CDX98712.1|  BnaA03g44970D                                          155   3e-40   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Eucalyptus grandis [rose gum]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   155   3e-40   Citrus sinensis [apfelsine]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Brassica rapa
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   3e-40   Sesamum indicum [beniseed]
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            153   3e-40   
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       155   3e-40   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            154   3e-40   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   4e-40   Brassica rapa
emb|CDX79109.1|  BnaA01g11760D                                          154   4e-40   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   4e-40   Camelina sativa [gold-of-pleasure]
emb|CDY19294.1|  BnaC01g31860D                                          154   4e-40   Brassica napus [oilseed rape]
emb|CDY64933.1|  BnaCnng45550D                                          154   5e-40   Brassica napus [oilseed rape]
emb|CDY24252.1|  BnaC03g42250D                                          147   5e-40   Brassica napus [oilseed rape]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   6e-40   Populus euphratica
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                154   7e-40   Erythranthe guttata [common monkey flower]
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             154   8e-40   Capsella rubella
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             154   9e-40   Capsella rubella
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   
ref|NP_172632.1|  MATE efflux family protein                            153   1e-39   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   2e-39   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             152   3e-39   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   3e-39   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   3e-39   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   3e-39   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-39   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             152   4e-39   
ref|XP_002892653.1|  mate efflux family protein                         152   4e-39   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-39   
gb|AGT17223.1|  MATE efflux family protein                              152   5e-39   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   7e-39   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   7e-39   
emb|CDY33131.1|  BnaCnng07020D                                          144   8e-39   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-38   
gb|AAM98160.1|  unknown protein                                         150   1e-38   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-38   
dbj|BAJ90668.1|  predicted protein                                      150   1e-38   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-38   
emb|CDY38631.1|  BnaA05g19560D                                          150   2e-38   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    150   2e-38   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   3e-38   
ref|NP_001119025.1|  mate efflux domain-containing protein              149   3e-38   
ref|XP_002518493.1|  multidrug resistance pump, putative                149   3e-38   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            149   3e-38   
gb|EEE67272.1|  hypothetical protein OsJ_24453                          148   4e-38   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    149   5e-38   
emb|CDY39493.1|  BnaA01g24950D                                          149   6e-38   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     148   6e-38   
ref|NP_001059785.1|  Os07g0516600                                       148   6e-38   
gb|EEC82143.1|  hypothetical protein OsI_26198                          148   6e-38   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   6e-38   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   8e-38   
emb|CDM85992.1|  unnamed protein product                                148   8e-38   
emb|CDX92916.1|  BnaA03g36380D                                          148   1e-37   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-37   
ref|XP_002867814.1|  mate efflux family protein                         147   1e-37   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-37   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      147   3e-37   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       147   3e-37   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    150   4e-37   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   4e-37   
emb|CDY65669.1|  BnaCnng48120D                                          146   5e-37   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       145   1e-36   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   1e-36   
gb|AAS01962.1|  putative MATE efflux family protein                     144   2e-36   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   2e-36   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    144   2e-36   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                144   3e-36   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             143   7e-36   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             142   7e-36   
emb|CDP04391.1|  unnamed protein product                                143   7e-36   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   7e-36   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         145   8e-36   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   9e-36   
gb|ABF97208.1|  MATE efflux family protein, expressed                   140   1e-35   
gb|ADE77677.1|  unknown                                                 142   2e-35   
ref|NP_001050521.1|  Os03g0571700                                       140   2e-35   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          140   2e-35   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   3e-35   
emb|CDP20703.1|  unnamed protein product                                139   5e-35   
emb|CDX94064.1|  BnaC07g36980D                                          139   5e-35   
gb|ABF97220.1|  MATE efflux family protein, expressed                   140   5e-35   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                140   6e-35   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                140   7e-35   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   1e-34   
gb|EPS59093.1|  hypothetical protein M569_15717                         133   1e-34   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   2e-34   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       138   2e-34   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   3e-34   
gb|EPS67796.1|  hypothetical protein M569_06975                         137   4e-34   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          137   5e-34   
gb|ABK24492.1|  unknown                                                 137   6e-34   
ref|NP_001190793.1|  MATE efflux family protein                         137   7e-34   
gb|AGT17222.1|  MATE efflux family protein                              135   5e-33   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            135   1e-32   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            134   3e-32   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    127   3e-32   
emb|CDY19296.1|  BnaC01g31840D                                          127   3e-32   
ref|NP_001190792.1|  mate efflux domain-containing protein              132   5e-32   
emb|CBI28940.3|  unnamed protein product                                124   5e-32   
ref|NP_001065641.2|  Os11g0129000                                       124   3e-31   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   3e-31   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   4e-31   
gb|EEC68782.1|  hypothetical protein OsI_37323                          124   5e-31   
emb|CAA17157.1|  putative protein                                       130   2e-30   
gb|EEC68785.1|  hypothetical protein OsI_37326                          124   2e-29   
ref|NP_001066047.1|  Os12g0126000                                       124   2e-29   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            124   2e-29   
ref|NP_001176768.1|  Os12g0125800                                       121   3e-29   
gb|EEC68781.1|  hypothetical protein OsI_37322                          123   4e-29   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          121   9e-29   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   9e-29   
ref|NP_001176328.1|  Os11g0128900                                       121   1e-28   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               121   2e-28   
ref|NP_001065623.1|  Os11g0126100                                       121   2e-28   
ref|NP_001141051.1|  putative MATE efflux family protein                121   3e-28   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   3e-28   
gb|ABA91295.1|  MATE efflux family protein, expressed                   120   4e-28   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   6e-28   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   1e-27   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          118   3e-27   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     115   3e-27   
gb|EEC73528.1|  hypothetical protein OsI_07920                          118   3e-27   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   5e-27   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          118   5e-27   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            117   6e-27   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   6e-27   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          117   7e-27   
emb|CBI31189.3|  unnamed protein product                                117   8e-27   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   1e-26   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg             112   1e-26   
dbj|BAJ90744.1|  predicted protein                                      116   2e-26   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            116   2e-26   
emb|CAN63841.1|  hypothetical protein VITISV_021179                     115   2e-26   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            117   2e-26   
emb|CAN73356.1|  hypothetical protein VITISV_040100                     115   2e-26   
gb|ABR16195.1|  unknown                                                 116   2e-26   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   2e-26   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg             112   3e-26   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     115   3e-26   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   3e-26   
gb|ACG27773.1|  transparent testa 12 protein                            115   3e-26   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   4e-26   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   4e-26   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            115   5e-26   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   6e-26   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    114   6e-26   
gb|ACF87410.1|  unknown                                                 114   7e-26   
gb|AFW55870.1|  putative MATE efflux family protein                     114   7e-26   
gb|KCW66477.1|  hypothetical protein EUGRSUZ_F00278                     114   7e-26   
emb|CDY01227.1|  BnaC05g25050D                                          109   8e-26   
ref|XP_002530955.1|  multidrug resistance pump, putative                114   9e-26   
emb|CBI31190.3|  unnamed protein product                                113   1e-25   
ref|NP_001130797.1|  putative MATE efflux family protein                114   1e-25   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          112   2e-25   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   4e-25   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                          112   4e-25   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    111   5e-25   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   6e-25   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340          111   7e-25   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   8e-25   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    111   8e-25   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     110   1e-24   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    111   1e-24   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             111   1e-24   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              111   1e-24   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     110   1e-24   
ref|XP_006349556.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|NP_174584.2|  MATE efflux family protein                            110   2e-24   
ref|XP_011026194.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
dbj|BAJ95959.1|  predicted protein                                      110   2e-24   
ref|XP_007161849.1|  hypothetical protein PHAVU_001G103200g             110   2e-24   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    110   3e-24   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             110   3e-24   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            109   3e-24   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            109   3e-24   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
ref|XP_009353041.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    110   4e-24   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                            109   5e-24   
gb|AAN64140.1|  Putative ripening regulated protein                     108   5e-24   
ref|XP_006375947.1|  hypothetical protein POPTR_0013s06650g             108   5e-24   
ref|XP_003520899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_009123743.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   6e-24   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          109   6e-24   
ref|XP_008391733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   7e-24   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                            110   7e-24   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-24   
ref|XP_006827534.1|  hypothetical protein AMTR_s00009p00209720          105   8e-24   
ref|XP_010317921.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    108   8e-24   
ref|XP_002319744.1|  MATE efflux family protein                         108   8e-24   
ref|XP_010542192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-24   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-24   
ref|XP_007029906.1|  MATE efflux family protein                         108   8e-24   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   9e-24   
ref|XP_006604281.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   1e-23   
emb|CDY68535.1|  BnaCnng59430D                                          104   1e-23   
gb|EEC74654.1|  hypothetical protein OsI_10313                          108   1e-23   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               108   1e-23   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130          108   1e-23   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   107   1e-23   
ref|XP_007161850.1|  hypothetical protein PHAVU_001G103300g             108   1e-23   
ref|XP_003624779.1|  Transparent testa 12 protein                       107   1e-23   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          108   1e-23   
gb|AFK47801.1|  unknown                                                 103   1e-23   
ref|XP_002300856.1|  hypothetical protein POPTR_0002s05600g             108   1e-23   
ref|XP_007051759.1|  MATE efflux family protein                         108   1e-23   
gb|KDP39623.1|  hypothetical protein JCGZ_02643                         108   1e-23   
ref|XP_009594771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_002891027.1|  mate efflux family protein                         108   2e-23   
ref|XP_006307307.1|  hypothetical protein CARUB_v10008925mg             108   2e-23   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g             107   2e-23   
gb|KHN42169.1|  Protein TRANSPARENT TESTA 12                            107   2e-23   
ref|XP_010528775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   2e-23   
emb|CDY01224.1|  BnaC05g25080D                                          106   2e-23   
ref|XP_009123739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   2e-23   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290          107   2e-23   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   2e-23   
ref|XP_009123740.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    106   2e-23   
gb|KHN34612.1|  Protein TRANSPARENT TESTA 12                            107   2e-23   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450          103   2e-23   
emb|CDY08799.1|  BnaA06g24250D                                          103   2e-23   
gb|KHN42163.1|  Protein TRANSPARENT TESTA 12                            107   2e-23   



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V L+SF+ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG+QP
Sbjct  17   FSVVMVTLVSFVISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQP  76

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL
Sbjct  77   VLSGVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLIL  136

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  137  IWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQP
Sbjct  245  FSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L
Sbjct  305  VLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  365  IWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  395



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQP
Sbjct  354  FSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L
Sbjct  414  VLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  474  IWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  504



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +S IISV+AA+ V+ALR VISY FT GE VA AVSDLCPLLALTLVLNGVQP
Sbjct  43   FSVVVVTTMSLIISVMAALAVMALRDVISYAFTGGETVAKAVSDLCPLLALTLVLNGVQP  102

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT+IL
Sbjct  103  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVIL  162

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEV+ A KRL  W+ K EPL+
Sbjct  163  LWVTIRTDWNKEVQEALKRLETWEGKEEPLV  193



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCPLLALTL+LNGVQP
Sbjct  354  FSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPLLALTLILNGVQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L
Sbjct  414  VLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  264
            +WVT RTDW KEVE A+KR++ W  K+ EPLL
Sbjct  474  IWVTFRTDWKKEVEEARKRMDAWQVKKEEPLL  505



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV L+SFIISV+ A+VVLALRHVISY FTDGE VADAVSDLCP LA+TL+LNG+QP
Sbjct  364  FTVAVVTLVSFIISVVEAVVVLALRHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQP  423

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+L
Sbjct  424  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVL  483

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  484  LWVTFRTDWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV L+SFIISV+ A+VVLALRHVISY FTDGE VADAVSDLCP LA+TL+LNG+QP
Sbjct  363  FTVAVVTLVSFIISVVEAVVVLALRHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+L
Sbjct  423  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  483  LWVTFRTDWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V + S IISV AAI+VLALRHV+SY FT GEVVA+AVSDLCPLLALTL+LNG+QP
Sbjct  353  FSVVIVTVFSAIISVAAAIIVLALRHVLSYAFTGGEVVAEAVSDLCPLLALTLILNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL
Sbjct  413  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  473  VWVTFRTDWKKEVEEARKRLVTWEDKKEPLL  503



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVVN+ISFI+SVIAAI+VLALR V+SY FT+GEVVADAVSDL PLLALTLVLNG+QP
Sbjct  348  FSVVVVNVISFIVSVIAAIIVLALRRVMSYAFTEGEVVADAVSDLAPLLALTLVLNGIQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G++LGFYF LGAKG+W GM+GGT MQTIIL
Sbjct  408  VLSGVAVGCGWQAFVAYVNVGCYYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIIL  467

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVTIRTDW KEVEVA KRL++W D K+E LL
Sbjct  468  LWVTIRTDWNKEVEVALKRLDKWEDQKKEALL  499



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV   SFI+SVIAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QP
Sbjct  360  FSVVVVTSWSFILSVIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVN+GCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL
Sbjct  420  VLSGVAVGCGWQTFVAYVNIGCYYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  480  IWITARTDWNKEVEAAQSRLKKWDDKKESILEE  512



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V   SFII+VIAAI VL LRHVISY FT GE VA+AVSDLCPLL++TL+LNGVQP
Sbjct  360  FSVVIVTSSSFIIAVIAAITVLELRHVISYAFTSGEAVANAVSDLCPLLSITLILNGVQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+IL
Sbjct  420  VLSGVAVGCGWQAFVAYVNVGCYYILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RT+W KEVE A KRLN+W+ K EPLL
Sbjct  480  LWVTYRTNWNKEVEEATKRLNKWEDKPEPLL  510



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V L+SF+ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG+QP
Sbjct  369  FSVVMVTLVSFVISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL
Sbjct  429  VLSGVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  489  IWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  519



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +ISFIISVIAA+VVLALR VISY FT GE VA AVSDLCPLLAL+LVLNG+QP
Sbjct  353  FSVVVVTVISFIISVIAALVVLALRDVISYAFTGGEEVAAAVSDLCPLLALSLVLNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIIL
Sbjct  413  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE A KRL +W+ K+EPLL
Sbjct  473  LWVTFRTDWTKEVEEAAKRLTKWEDKKEPLL  503



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV ++SFI+SVIAAI++L LR  ISY FTDGEVVA AVSDLCPLLA TL+LNG+QP
Sbjct  335  FSVVVVTVMSFIVSVIAAIIILCLRDYISYAFTDGEVVARAVSDLCPLLATTLILNGIQP  394

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVP G++LGF F LGAKGIW GMIGGT MQT+IL
Sbjct  395  VLSGVAVGCGWQAFVAYVNVGCYYIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLIL  454

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  455  LWVTFRTDWNKEVEEAKKRLNKWEDKKEPLL  485



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  113  FSVVVVTLVSFLISVVAAAVVXVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  172

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL
Sbjct  173  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFIL  232

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE AK+R  +WD K++PLL
Sbjct  233  IWVTARTNWNKEVEKAKERXEKWDDKKQPLL  263



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV   SFI SVIAAI+VL  R V+SY FT GEVVA+AVSDLCPLLALTL LNG+QP
Sbjct  351  FSVRVVTTCSFITSVIAAILVLTFRDVLSYAFTGGEVVAEAVSDLCPLLALTLALNGIQP  410

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL
Sbjct  411  VLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVIL  470

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W+TIRTDW KEVE A+ RLN+W  K+EP L +
Sbjct  471  IWITIRTDWNKEVEAAQGRLNKWGDKKEPELKE  503



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  394  RHVISYVFTEGETVAEAVSELCPFLAVTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  453

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+
Sbjct  454  VVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWE  513

Query  284  AKREPLL  264
             KRE LL
Sbjct  514  DKRETLL  520



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S IISV+AA+ V+ALR VISY FTDGE VA AVSDLCPLLALTLVLNGVQP
Sbjct  250  FSVAVVTTMSLIISVMAALTVMALRDVISYAFTDGETVAQAVSDLCPLLALTLVLNGVQP  309

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T+IL
Sbjct  310  VLSGVAVGCGWQGFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVIL  369

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  370  LWVTCRTDWNKEVQEALKRLETWEGKKEPLV  400



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  36   FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  95

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL
Sbjct  96   VLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFIL  155

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KR+++W  K++ L+ +
Sbjct  156  AWVTFRTDWTKEVEEASKRMDKWSDKKQELVRE  188



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA VVL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  282  FSVVVVTLVSFLISVVAAAVVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  341

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL
Sbjct  342  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFIL  401

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  402  IWVTARTNWNKEVEKAKERMEKWDDKKQPLL  432



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV LISFIIS IAA++VLALR VISYVFT+GE VA AVSDLCPLL+L+++LNG+QP
Sbjct  355  FSVKVVTLISFIISAIAALIVLALRDVISYVFTEGETVAAAVSDLCPLLSLSILLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE + KRLN+WD K+EPLL
Sbjct  475  IWVTFRTDWNKEVEESAKRLNKWDDKKEPLL  505



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  355  FSVVVVTLVSFLISVVAAAVVFVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE AK+RL +WD K++PLL
Sbjct  475  IWVTARTNWNKEVEKAKERLEKWDDKKQPLL  505



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+V+ A++V+ALRHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQP
Sbjct  360  FSVVIVNLVSFIIAVLEAVIVMALRHVISYVFTEGETVANAVSELCPYLAVTLILNGVQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL
Sbjct  420  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE AK RL++W+ K++PLL
Sbjct  480  IWVTYRTDWNKEVEKAKGRLDKWEDKKKPLL  510



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV   SFI+S+IAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QP
Sbjct  360  FSVVVVTSWSFILSMIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL
Sbjct  420  VLSGVAVGCGWQAFVAYVNIGCYYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W+T RTDW KEVE A+ RL  WD K+E +L +
Sbjct  480  IWITARTDWNKEVESAQSRLKMWDDKKESILEE  512



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV +ISFIISVIAA++VLALR VISYVFT+GEVVA AVSDLCPLL+L+LVLNG+QP
Sbjct  355  FSVKVVTVISFIISVIAALIVLALRDVISYVFTEGEVVAAAVSDLCPLLSLSLVLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            +WVT RTDW KEV+ A KRLN+W + K+EPLL
Sbjct  475  MWVTFRTDWNKEVKEAAKRLNKWEEKKKEPLL  506



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S  IS I AIV+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QP
Sbjct  341  FSVWVVTGLSTTISTILAIVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQP  400

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  401  VLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAIL  460

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  461  LWVTMRTDWTKEVEEAQKRLNKWDEKKEPLL  491



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  355  FSVVVVTLVSFLISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  475  IWVTTRTNWNKEVEKARERLEKWDDKKQPLL  505



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA VVL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  355  FSVVVVTLVSFLISVVAAAVVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  475  IWVTARTNWNKEVEKAKERMEKWDDKKQPLL  505



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VNL+SF+++   A +VL+ RH+ISY+FT GE VA AV+DLCPLLA+TL+LNGVQP
Sbjct  357  FSVMMVNLVSFMVAAAEAGIVLSQRHIISYIFTGGETVAKAVADLCPLLAVTLLLNGVQP  416

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ+FVA +NVGCYY+VG+P+G +LGF FNLG KGIW GMIGGT+MQT+IL
Sbjct  417  VLSGVAVGCGWQSFVACINVGCYYMVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLIL  476

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT RTDW KEVE A+KRL++W+   EPLL +
Sbjct  477  LWVTFRTDWNKEVEKARKRLDKWEEITEPLLKE  509



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SF+ISVIAA+ VL  R VISY FT+GEVVA AVSDLCPLLAL++VLNG+QP
Sbjct  356  FSVVVVTAVSFMISVIAAVAVLVFRDVISYAFTEGEVVATAVSDLCPLLALSIVLNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  476  IWVTFRTDWNKEVEEAAKRLSIWEDKKEPVL  506



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QP
Sbjct  343  FSVWVVTGLSATISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQP  402

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  403  VLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAIL  462

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  463  LWVTIRTDWSKEVEEAQKRLNKWDEKKQPLL  493



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QP
Sbjct  245  FSVIIVNIYSLITSVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL
Sbjct  305  VLSGVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR  276
             WVT RTDWVKEVE A KRL+ W  K+
Sbjct  365  AWVTFRTDWVKEVEEASKRLDIWSNKK  391



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV ++SFIISVIAA++VL LR  ISY FT+GE VA AVSDLCPLLA+TL+LNG+QP
Sbjct  369  FSVIVVTMMSFIISVIAAVIVLCLRDYISYAFTEGETVARAVSDLCPLLAITLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL
Sbjct  429  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  264
            +WVT RTDW KEVE AKKRLN+WD K+ EPLL
Sbjct  489  MWVTFRTDWNKEVEEAKKRLNKWDGKKEEPLL  520



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SF+I+V  A+V L  R  ISY+FTDGE V+ AVSDLCP LA TL+LNG+QP
Sbjct  342  FSVVVVTALSFVITVAMAVVFLIFRDYISYIFTDGETVSRAVSDLCPFLAATLILNGIQP  401

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAY+NVGCYY VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL
Sbjct  402  VLSGVAVGCGWQKTVAYINVGCYYFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLIL  461

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  255
             W+T RTDW KEVE AKKRLNQWD K++PLL  T
Sbjct  462  FWITFRTDWNKEVEQAKKRLNQWDDKKQPLLAST  495



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVVNL+SF ++V+ AIVVL+ RHVISY+FT GE VA+AVSDLCP LA+TL+LNG+QP
Sbjct  364  FSVVVVNLVSFTVAVVEAIVVLSQRHVISYIFTGGETVANAVSDLCPFLAVTLLLNGLQP  423

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ +VAYVN+GCYYVVG+P+G +LGF FNLG KGIW GMIGGT MQT+IL
Sbjct  424  VLSGVAVGCGWQAYVAYVNIGCYYVVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLIL  483

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT*KRSIHETK  228
            LWVT RTDW KEVE A KRL  WD  +EPLL     + + E K
Sbjct  484  LWVTFRTDWNKEVEKAGKRLAMWDDIKEPLLKY--HKEVEEIK  524



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I SVI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITSVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  474  AWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VVN+ SFI SVIAA+++LALR V+SY FT+GEVVADAVSDL PLLA+T+VLNG+QP
Sbjct  280  FSVAVVNVASFITSVIAAVIILALRRVMSYAFTEGEVVADAVSDLSPLLAVTVVLNGIQP  339

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIIL
Sbjct  340  VLSGVAVGCGWQAFVAYVNVGCYYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIIL  399

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
            LWVTIRTDW+KEVE A +RL++W+  ++
Sbjct  400  LWVTIRTDWIKEVEAALRRLDKWEVLKD  427



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  391  FSVVVVTLVSFLISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  450

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL
Sbjct  451  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLIL  510

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  511  IWVTTRTNWNKEVEKARERLEKWDDKKQPLL  541



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  IS  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QP
Sbjct  245  FSVWVVTGISTTISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  305  VLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  365  LWVTIRTDWTKEVEEAQKRLNKWSEKKEPLL  395



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  474  AWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  474  AWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S  IS I A+V+L LR+ ISY+FTDG+ V+DAV+DLCPLLA+TLVL G+QP
Sbjct  412  FSVWVVTGLSATISTILAVVILCLRNHISYLFTDGKAVSDAVADLCPLLAITLVLGGIQP  471

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  472  VLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAIL  531

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  532  LWVTIRTDWTKEVEEAQKRLNKWDEKKEPLL  562



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QP
Sbjct  353  FSVIIVNIYSLITSVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL
Sbjct  413  VLSGVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR  276
             WVT RTDWVKEVE A KRL+ W  K+
Sbjct  473  AWVTFRTDWVKEVEEASKRLDIWSNKK  499



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV LISFIISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QP
Sbjct  366  FSVMVVTLISFIISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQP  425

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL
Sbjct  426  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIIL  485

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  486  VWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV LISFIISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QP
Sbjct  366  FSVMVVTLISFIISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQP  425

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL
Sbjct  426  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIIL  485

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  486  VWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++V  +SFIISV+AAI+VL LRHVISY FTDGE VA+AVSDLCPLLA+TL+LNGVQP
Sbjct  361  FSVLIVTSLSFIISVVAAIIVLLLRHVISYAFTDGERVANAVSDLCPLLAITLILNGVQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL
Sbjct  421  VLSGVAVGCGWQAFVAYVNVGCYYVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A KRL  WD K+EPLL
Sbjct  481  IWVTYRTNWNKEVEEAMKRLETWDEKKEPLL  511



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QP
Sbjct  280  FSVWVVTGLSATISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQP  339

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  340  VLTGVAVGCGWQKFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTIL  399

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  400  LWVTIRTNWTEEVEEAQKRLNKWDEKKEPLL  430



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV   SFI+SVIAA++VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QP
Sbjct  361  FSVVVVTSWSFILSVIAAVIVLALRNLISYAFTGGEVVAQAVSDLCPLLAISLILNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL
Sbjct  421  VLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  481  IWITARTDWNKEVESAQYRLKKWDDKKESILEE  513



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  474  AWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV LISFIISVI A+VVLA+R VISY FTDGE VA AVSDLCPLLAL+++LNG+QP
Sbjct  365  FSVVVVTLISFIISVIVALVVLAIRDVISYAFTDGEEVAAAVSDLCPLLALSIILNGIQP  424

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL
Sbjct  425  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIIL  484

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT  TDW KEVE A KRLN+W+ K EPL+
Sbjct  485  VWVTFGTDWNKEVEEAAKRLNKWEDKTEPLV  515



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +ISFIISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQP
Sbjct  360  FSVVVVTVISFIISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIIL
Sbjct  420  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  480  LWVTFRTDWNKEVEESNKRLNKWEDRTETLIKE  512



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +ISFIISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQP
Sbjct  358  FSVVVVTVISFIISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQP  417

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIIL
Sbjct  418  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIIL  477

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  478  LWVTFRTDWNKEVEESNKRLNKWEDRTETLIKE  510



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV     I+S I A V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QP
Sbjct  342  FSVWVVTGSCTIVSAILAAVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQP  401

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY++GVP+G +LGF FNLG KGIW GM+GGT MQT IL
Sbjct  402  VLSGVAVGCGWQQFVAYVNIGCYYIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAIL  461

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  462  VWVTLRTDWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  ++FIISV+AAIVVLA+R+VISY FT GEVV++ VSDLCPLLALTL+LNG+QP
Sbjct  308  FSVVVVTTLAFIISVVAAIVVLAIRNVISYAFTGGEVVSNRVSDLCPLLALTLILNGIQP  367

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL
Sbjct  368  VLSGVAVGCGWQAFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIIL  427

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
             WVT+RTDW KEVE A++RLN+W  K+  L
Sbjct  428  TWVTLRTDWSKEVETAQQRLNKWGDKQPAL  457



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SFI+SVIAA +VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QP
Sbjct  361  FSVIVVTSWSFILSVIAAAIVLALRNLISYAFTGGEVVAAAVSDLCPLLAISLILNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL
Sbjct  421  VLSGVAVGCGWQTFVAYVNVGCYYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  481  IWITARTDWNKEVESAQYRLKKWDDKKEAILEE  513



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  286  FSVIIVNIYSLITCVILAIVILASRDVLSYLFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  345

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL
Sbjct  346  VLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFIL  405

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KR+++W  +++ ++P+
Sbjct  406  AWVTFRTDWNKEVEEASKRMDKWSNQKQEVVPE  438



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AI+V+ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQP
Sbjct  245  FSVVIVNLVSFIIAVIEAIIVMALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL
Sbjct  305  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  365  IWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  395



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AI+V+ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQP
Sbjct  270  FSVVIVNLVSFIIAVIEAIIVMALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQP  329

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL
Sbjct  330  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLIL  389

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  390  IWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  420



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GEVVA  VS+LCP LA+TL+LNG+QP
Sbjct  19   FSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEVVAKEVSELCPYLAVTLILNGIQP  78

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIIL
Sbjct  79   VLSGVAVGCGWQTFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIIL  138

Query  356  LWVTIRTDWVKEVEVAKKRLNQWD  285
            LWVT RTDW KEVE AKKRL++W+
Sbjct  139  LWVTFRTDWNKEVESAKKRLDKWE  162



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QP
Sbjct  245  FSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT IL
Sbjct  305  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  365  LWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVV     FIISVI AI++LALRHVISY FT+GE VADAVSDLCPLLA+T+VLNG+QP
Sbjct  352  FSVVVATSSCFIISVIIAIILLALRHVISYAFTEGEYVADAVSDLCPLLAITVVLNGIQP  411

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIIL
Sbjct  412  VLSGVAVGCGWQVFVAYVNVGCYYFVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIIL  471

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
            LWV  RTDW +EVE A KRLN+W+ K +
Sbjct  472  LWVACRTDWKREVEEAAKRLNKWEDKHK  499



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VN +S I+++I A+V+L+LR VISY FT GE VA+AVSDLCP LA+TL+LNGVQP
Sbjct  371  FSVVMVNSVSLIVAIIEAMVILSLRDVISYAFTSGETVANAVSDLCPFLAVTLILNGVQP  430

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL
Sbjct  431  VLSGVAVGCGWQAFVAYVNVGCYYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAIL  490

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  255
            +W T +TDW+KEVE AKKRL++WD   +PLL  +
Sbjct  491  IWTTYQTDWIKEVEKAKKRLDKWDDINQPLLKAS  524



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R ++SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITCVILAIVILACRDILSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  474  AWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LNGVQP
Sbjct  68   FSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQP  127

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  128  VLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLIL  187

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            +WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  188  VWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  219



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R VISY FT+GE VA AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+
Sbjct  451  VVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWE  510

Query  284  AKREPLL  264
             K+EPLL
Sbjct  511  DKKEPLL  517



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VVN+ S IISVI A+V+LALR V+SY+FT+G+ VA AVSDLCPLLALTLVLNG+QP
Sbjct  352  FSVIVVNVYSLIISVILAVVILALRDVVSYLFTEGKDVAAAVSDLCPLLALTLVLNGIQP  411

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSG+AVGCGWQTFVA VNVGCYY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL
Sbjct  412  VLSGMAVGCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIIL  471

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
             WVT  TDW KEV++A KRL+QW  ++EPL
Sbjct  472  AWVTFSTDWNKEVDLATKRLDQWSDRKEPL  501



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S  IS I A+V+L LR+ ISY+FT+GE V+DAV+DL PLLA+TLVL G+QP
Sbjct  341  FSVWVVTGLSATISTILAVVILCLRNHISYLFTNGEAVSDAVADLSPLLAITLVLGGIQP  400

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT IL
Sbjct  401  VLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTIL  460

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  461  LWVTIRTDWTKEVEEAQKRLNKWDEKKQPLL  491



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ VADAVSDLCPLLA+TLVLNG+QP
Sbjct  355  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVADAVSDLCPLLAVTLVLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL
Sbjct  415  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
             WVT RTDW KEVE A KRL++W  K++
Sbjct  475  AWVTFRTDWTKEVEEASKRLDKWSNKKQ  502



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VN++SFII+VI AIVVLALRHVISYVFT+GE VA+AVSDLCP LA+TL+LNG+QP
Sbjct  351  FSVVIVNMVSFIIAVIEAIVVLALRHVISYVFTEGETVANAVSDLCPYLAVTLILNGIQP  410

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAY+NVGCYY VGVPVG VLGF FNLG KGIW GMIGGTV+QT+IL
Sbjct  411  VLSGVAVGCGWQAIVAYINVGCYYGVGVPVGCVLGFKFNLGVKGIWSGMIGGTVLQTLIL  470

Query  356  LWVTIRTDWVKEVEVAKKRLNQWD  285
            LW+T RTDW+KEV  AKKRL++W+
Sbjct  471  LWITFRTDWIKEVNTAKKRLDKWE  494



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QP
Sbjct  245  FSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT IL
Sbjct  305  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  365  LWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QP
Sbjct  245  FSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT IL
Sbjct  305  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  365  LWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QP
Sbjct  365  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQP  424

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VN+GCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL
Sbjct  425  VLSGVAVGCGWQTFVAKVNIGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFIL  484

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KE E A KR+++W  K++ ++P+
Sbjct  485  AWVTFRTDWTKEEEEASKRMDKWSNKKQEVVPE  517



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA TL+LNGVQP
Sbjct  347  FSVVVVTSCSFIISVIAAIIVMIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNGVQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT+RTDW KEVE AK RLN WD KR+P LP+
Sbjct  467  LWVTLRTDWDKEVENAKNRLNTWDDKRQPPLPE  499



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +  IISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QP
Sbjct  245  FSVWVVTALCAIISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+IL
Sbjct  305  VLTGVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  365  LWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  395



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V L+SFIIS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQP
Sbjct  363  FSVVMVTLVSFIISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+IL
Sbjct  423  VLSGVAVGCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLIL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE AK RL++W+ KR+P L
Sbjct  483  LWVTFRTDWRKEVEKAKSRLHKWEDKRKPSL  513



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV ++S II+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QP
Sbjct  337  FSVWVVTVLSAIIAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQP  396

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT IL
Sbjct  397  VLSGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAIL  456

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  457  LWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  488



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  392  RDYLSYIFTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  451

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W+
Sbjct  452  IVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWE  511

Query  284  AKREPLL  264
             K++PLL
Sbjct  512  GKKQPLL  518



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R VISY FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  382  RSVISYTFTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  441

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+WD
Sbjct  442  VVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWD  501

Query  284  AKRE  273
             K+E
Sbjct  502  DKQE  505



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA TL+LNG+QP
Sbjct  347  FSVVVVTSCSFIISVIAAIIVMIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT+RTDW KEVE AK RL+ WD KR+PLL
Sbjct  467  VWVTLRTDWDKEVESAKNRLSSWDEKRQPLL  497



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQP
Sbjct  282  FSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQP  341

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  342  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLIL  401

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  264
            +W+T RTDW KEVE AK+RL++W+ K  +PLL
Sbjct  402  VWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  433



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  269  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  328

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  329  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  388

Query  284  AKREPLLPKT  255
             K++PLL  T
Sbjct  389  DKKQPLLAGT  398



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV LISF+I+V+ AIVVL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQP
Sbjct  347  FSVFVVTLISFLIAVVEAIVVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +W T RTDW KEVE AK+RL++W+  +EPL  K
Sbjct  467  IWFTFRTDWNKEVEKAKERLDKWENVKEPLSKK  499



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQP
Sbjct  245  FSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAITLILNGVQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  305  VLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            +WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  365  VWVTYRTDWSKEVGKAKQRLDKWEDXEDEPLL  396



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  +SF +S + A+ VL LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQP
Sbjct  310  FSVLVVTSLSFAVSAVCAVAVLCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQP  369

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTII  360
            VLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+I
Sbjct  370  VLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLI  429

Query  359  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  430  LLWVTFRTDWTKEVENARARLDKWDDKKQPLL  461



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +  IISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QP
Sbjct  337  FSVWVVTALCAIISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQP  396

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+IL
Sbjct  397  VLTGVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVIL  456

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  457  LWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  487



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+T+VLNG+QP
Sbjct  354  FSVIIVNIYSLITCVILAIVILACRDVLSYLFTEGKEVSDAVSDLCPLLAVTIVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQT+VA VN+GCYYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL
Sbjct  414  VLSGVAVGCGWQTYVAKVNIGCYYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KE E A KR+++W  +++ ++P+
Sbjct  474  AWVTFRTDWSKEAEEASKRMDKWSNQKQEVVPE  506



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SF I+VI A+V+L +R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QP
Sbjct  369  FSVVVVTSLSFTIAVIIAVVILCIRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL
Sbjct  429  VLSGVAVGCGWQAFVAYVNVACYYIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  489  IWVTFRTDWNKEVNEAIKRLNKWEDKKKPLL  519



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +ISFIISVI A+V+L LR VISY FT+GE VA AVSDLCPLLAL++VLNG+QP
Sbjct  365  FSVVVVTVISFIISVIVAVVILLLRDVISYAFTEGEEVAAAVSDLCPLLALSIVLNGIQP  424

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL
Sbjct  425  VLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLIL  484

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV  A++RLNQW+  +EPLL
Sbjct  485  MWVTFRTDWNKEVVEAERRLNQWEDVKEPLL  515



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  +SF +S + A+ VL LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQP
Sbjct  360  FSVLVVTSLSFAVSAVCAVAVLCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTII  360
            VLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+I
Sbjct  420  VLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLI  479

Query  359  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  480  LLWVTFRTDWTKEVENARARLDKWDDKKQPLL  511



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V +VN +SF+++V+ AI+VL+LRHVISY FT G  VA+AVSDLCP LA+TL+LNGVQP
Sbjct  282  FAVFMVNFVSFVVAVVEAIIVLSLRHVISYAFTSGGTVANAVSDLCPFLAVTLILNGVQP  341

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ +VAYVNVGCYYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL
Sbjct  342  VLSGVAVGCGWQAYVAYVNVGCYYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLIL  401

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +W T RTDW KEVE A++RL  WD K+EPLL
Sbjct  402  VWSTFRTDWNKEVEKARERLRTWDDKKEPLL  432



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQP
Sbjct  356  FSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  264
            +W+T RTDW KEVE AK+RL++W+ K  +PLL
Sbjct  476  VWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  507



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QP
Sbjct  366  FTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQP  425

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+IL
Sbjct  426  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLIL  485

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  486  LWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  516



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QP
Sbjct  347  FTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  467  LWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  497



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QP
Sbjct  363  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGEKVSAAVSDLCPLLALTLVLNGIQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL
Sbjct  423  VLSGVAVGCGWQTFVAKVNVGCYYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVIL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDWVKEVE A KRL++W  K+  ++P+
Sbjct  483  AWVTFRTDWVKEVEEASKRLDKWSNKKLEVVPE  515



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  284  AKREPLLPKT  255
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  284  AKREPLLPKT  255
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VVN +S I ++IAAI+VLALRHVISY+FT+GE VADAVS+L P LA +LVLNG+QP
Sbjct  360  FSVLVVNCLSTICAIIAAIIVLALRHVISYIFTEGETVADAVSELTPYLAASLVLNGIQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+IL
Sbjct  420  VLSGVAVGCGWQTFVAYVNVGCYYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLIL  479

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LW T RTDW KEVE+A+KRL  WD +++PLL
Sbjct  480  LWTTFRTDWNKEVEIAQKRLATWDDQKQPLL  510



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S +I++I +IV+L LR+ +SY+FT+GEVV++AV+DLCPLLA+T++LNG+QP
Sbjct  341  FSVWVVTAVSTLITIILSIVILCLRNYVSYLFTEGEVVSNAVADLCPLLAITIILNGIQP  400

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYYVVGVP+GA+LGF F LG KGIW GMIGGTVMQT IL
Sbjct  401  VLSGVAVGCGWQQFVAYVNIGCYYVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAIL  460

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVT+RTDW KEVE A+KRLN+W D K EPLL
Sbjct  461  LWVTLRTDWSKEVEEAQKRLNKWEDKKTEPLL  492



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L SFII+VIAAIVV+ LR V+SY FTDGEVV+ AVS+L P LA+TL+LNGVQP
Sbjct  345  FSVIVVTLCSFIIAVIAAIVVMGLRDVLSYAFTDGEVVSKAVSELSPFLAVTLILNGVQP  404

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL
Sbjct  405  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLIL  464

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEVE A++RLN W+ K+EPLL
Sbjct  465  IWVTYRTDWNKEVEKARQRLNSWEDKKEPLL  495



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SFIISV+ A+++L LR  +SY FT+GE VA AVS+L PLLA+TL+LNG+QP
Sbjct  368  FSVVVVTTLSFIISVVTAVIILCLRDYLSYTFTEGETVAHAVSELTPLLAITLILNGIQP  427

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL
Sbjct  428  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLIL  487

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  488  IWVTFRTDWNKEVDEAIKRLNKWEDKKQPLL  518



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QP
Sbjct  348  FSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  408  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVIL  467

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LWVT RTDW KEVE AKKRL++W+  + PL
Sbjct  468  LWVTFRTDWNKEVECAKKRLDKWENLKGPL  497



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QP
Sbjct  366  FTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQP  425

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+IL
Sbjct  426  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLIL  485

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT  TDW KEVE+A++RL++W+ K++PLL
Sbjct  486  LWVTFTTDWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SFIISVIAAI+VL  R  ISY+FT GEVVA A SDL P LA+T++LNGVQP
Sbjct  253  FSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQP  312

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+IL
Sbjct  313  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLIL  372

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  373  LWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  403



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SF +SV+AA++VL+LR  ISY+FT+GE VA AVSDLCPLLA ++VLNG+QP
Sbjct  373  FSVVVVTAVSFAVSVMAAMIVLSLRDYISYIFTEGETVARAVSDLCPLLAASIVLNGIQP  432

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP G +LGF F LG KGIWCG+I GTV QT+IL
Sbjct  433  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLIL  492

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            L VT RTDW KEVE AKKRL++W+ K EPLL
Sbjct  493  LVVTFRTDWNKEVEEAKKRLDKWEEKEEPLL  523



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SFIISVI A+V+L LR  +SY+FT+GE VA AVS+L PLLA+T++LNG+QP
Sbjct  338  FSVVVVTALSFIISVIIAVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITIILNGIQP  397

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL
Sbjct  398  VLSGVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVIL  457

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  458  IWVTFRTDWNKEVDEAIKRLNKWEDEKQPLL  488



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV + SF+ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLAL+L+LNG+QP
Sbjct  351  FSVVVVTISSFVISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLALSLILNGIQP  410

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGFYFNL AKGIW GM+GGT MQTIIL
Sbjct  411  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIIL  470

Query  356  LWVTIRTDWVKEVEVAKKRLNQW--DAKRE  273
            LWVT RTDW KEVE AK RLN W  ++K++
Sbjct  471  LWVTFRTDWEKEVEQAKSRLNMWQNNSKKQ  500



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +ISFII  I A+VVLALR VISYVFT+GE VA AVSDL PLLAL +VLNGVQP
Sbjct  367  FSVVVVTVISFIICAIIALVVLALRDVISYVFTEGEEVAAAVSDLSPLLALAIVLNGVQP  426

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL
Sbjct  427  VLSGVAVGCGWQTFVAYVNVGCYYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIIL  486

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW  EV  + KRLN+W+ K E LL
Sbjct  487  MWVTFRTDWNNEVVESNKRLNKWEGKTESLL  517



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  +S IIS+I A++V+  R VISY+FTDGE VA AVSDLCPLLALTLVLNGVQP
Sbjct  362  FSVLVVVALSTIISIICALLVIIFRDVISYIFTDGEAVAAAVSDLCPLLALTLVLNGVQP  421

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL
Sbjct  422  VLTGVAVGCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVIL  481

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRL++WD   +P++
Sbjct  482  VWVTWRTDWNKEVDEAIKRLSKWDDTAKPVV  512



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V L+SFII++I A  +L+LRHVISYVFT GE VA+AVS+LCPLLA+TL+LNGVQP
Sbjct  358  FSVAMVTLVSFIIALIEAGAILSLRHVISYVFTGGETVANAVSELCPLLAVTLILNGVQP  417

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+IL
Sbjct  418  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCLIGFKFDLGVKGIWSGMIGGTLLQTLIL  477

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR  276
            LWVT RTDW KEVE AK RL++W+ KR
Sbjct  478  LWVTFRTDWKKEVEKAKSRLHKWEDKR  504



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L SFIISVIAAI+V+  R  +SY+FT+GEVVA A SDL P LA TL+LNG+QP
Sbjct  347  FSVVVVTLCSFIISVIAAIIVMIFRDSMSYIFTEGEVVAKAASDLSPFLAATLILNGIQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT+RTDW KEVE AK RLN WD KR+P L +
Sbjct  467  LWVTLRTDWNKEVENAKNRLNTWDDKRQPPLQE  499



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  166  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  225

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  226  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  285

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  286  ESREPLLKQ  294



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LNGVQP
Sbjct  355  FSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  415  VLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  264
            +WVT RTDW KEV  AK+RL++W+ K  EPLL
Sbjct  475  VWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  506



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F VVVV + SF+ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLA++L+LNGVQP
Sbjct  347  FCVVVVTMSSFVISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLAISLILNGVQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGFYFNL AKGIW GM+GGT MQTIIL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVT RTDW KEVE AK RLN W +  ++PL 
Sbjct  467  LWVTFRTDWEKEVEQAKSRLNMWQNNSKKPLF  498



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QP
Sbjct  348  FSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+IL
Sbjct  408  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVIL  467

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LWVT RTDW K+VE AKKRL++W+  + PL
Sbjct  468  LWVTFRTDWNKKVECAKKRLDKWENLKGPL  497



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SFIISVIAAI+VL  R  ISY+FT GEVVA A SDL P LA+T++LNGVQP
Sbjct  348  FSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+IL
Sbjct  408  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLIL  467

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  468  LWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  498



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SFIISVIAAI+VL  R  ISY+FT+GEVVA A SDL P LA TL+LNG+QP
Sbjct  347  FSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT+RTDW KEVE AK RL+ WD K +PLL
Sbjct  467  VWVTLRTDWDKEVESAKNRLSSWDEKGQPLL  497



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QP
Sbjct  357  FSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQP  416

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  417  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  476

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  477  IWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QP
Sbjct  359  FSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  479  IWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VI Y FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVIGYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWD  487

Query  284  AKREPLL  264
             K+E  L
Sbjct  488  VKQESTL  494



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  ISF+I+V+ AI+VL LR+VISY FT+GE VA+AVSDLCP LA+TL+L+GVQP
Sbjct  352  FSVFVVTFISFLIAVVEAIIVLCLRNVISYAFTEGETVANAVSDLCPFLAVTLILSGVQP  411

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            + SGVAVGCGWQ FVAYVNVGC Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIIL
Sbjct  412  IFSGVAVGCGWQAFVAYVNVGCNYAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIIL  471

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LW T RTDW KEVE A+ RL++W   +EPL
Sbjct  472  LWFTYRTDWNKEVEKARTRLDKWGNVKEPL  501



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV ++S II+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QP
Sbjct  337  FSVWVVTVLSAIIAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQP  396

Query  536  VLS---GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  366
            VLS   GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT
Sbjct  397  VLSEISGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQT  456

Query  365  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
             ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  457  AILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNLISF+ISVI A++V+ALR+VISY FT+GE VA AVS+LCPLLA++LVLNG+QP
Sbjct  354  FSVVIVNLISFVISVIEAVIVIALRNVISYAFTEGETVAKAVSELCPLLAVSLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGA+GIW GM+GGT MQTIIL
Sbjct  414  VLSGVAVGCGWQKFVAYVNVGCYYVVGIPIGCLLGFKFHLGAQGIWSGMLGGTTMQTIIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LWVT   DW  EVE A+ RL++W+  +EPL
Sbjct  474  LWVTFHADWNAEVEKARMRLDKWEDSKEPL  503



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SFII+VI A+VVL LR+VISY FT+GE VA AVS+L PLLA+ L+LNG+QP
Sbjct  354  FSVVVVTLVSFIIAVIEAVVVLCLRNVISYAFTEGETVAKAVSELSPLLAVALLLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIIL
Sbjct  414  VLSGVAVGCGWQAFVAYVNVGCYYLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LWVT RTDW+KEVE AK RL++WD  ++ L
Sbjct  474  LWVTFRTDWIKEVEKAKMRLDKWDDDKQTL  503



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 134/153 (88%), Gaps = 2/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S +ISV+ +IV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QP
Sbjct  344  FSVWVVTAVSTLISVMLSIVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQP  403

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT IL
Sbjct  404  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAIL  463

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  264
            LWVT+RTDW KEVE A+KRL++W+ K+  EPLL
Sbjct  464  LWVTLRTDWNKEVEEAQKRLHKWEDKKTTEPLL  496



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 5/156 (3%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V L+SFIIS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQP
Sbjct  363  FSVVMVTLVSFIISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+IL
Sbjct  423  VLSGVAVGCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLIL  482

Query  356  LWVTIRTDWVKE-----VEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KE     VE AK RL++W+ KR+P L
Sbjct  483  LWVTFRTDWRKEMFQFQVEKAKSRLHKWEDKRKPSL  518



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA+T++LNGVQP
Sbjct  349  FSVLVVTSCSFIISVIAAIIVMMFRDSISYIFTEGEVVAKAASDLSPFLAVTIILNGVQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LG KGIW GM+GGTV+QT+IL
Sbjct  409  VLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  469  LWVTWRTDWNTEVEVAKNRLSSWDDKRQPLL  499



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV L+SFIIS IAA+VVL LR VISYVFT+GE VA AVSDLCPLL+L+L+LNG+QP
Sbjct  351  FSVKVVTLMSFIISAIAALVVLVLRDVISYVFTEGEAVAAAVSDLCPLLSLSLLLNGIQP  410

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL
Sbjct  411  VLSGVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVIL  470

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  471  MWVTFRTDWNKEVQEADKRLNKWEDKKEPLL  501



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FTDGE V+ AVSDLCPLLA+TLVLNG+QP
Sbjct  356  FSVIIVNIYSLITCVILAIVILACRDVLSYAFTDGETVSAAVSDLCPLLAITLVLNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  416  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL+ W  K+  ++P+
Sbjct  476  AWVTFRTDWTKEVEEASKRLDIWSNKKLEVVPE  508



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  +S   +V+ A+VVL+LR VISY FT GE VA AVS L P LA+TL+LNG+QP
Sbjct  356  FSVIVVTSVSLAFAVLEAVVVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+IL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE AK R+ +WD K++PLL
Sbjct  476  LWVTFRTDWDKEVENAKSRVEKWDDKKQPLL  506



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  271  RDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYY  330

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD
Sbjct  331  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWD  390

Query  284  AKREPLL  264
               +P++
Sbjct  391  DTAKPIV  397



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV +   IIS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QP
Sbjct  342  FSVWVVTISCAIISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQP  401

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL
Sbjct  402  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAIL  461

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            +WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  462  VWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV +   IIS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QP
Sbjct  342  FSVWVVTISCAIISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQP  401

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL
Sbjct  402  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAIL  461

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            +WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  462  VWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV +++FIISVI A+ VL LR  +SY+FT+GE VA AVS+L PLL+LT++LNG+QP
Sbjct  369  FSVMVVTILAFIISVIIAVAVLCLRDYLSYIFTEGETVAHAVSELAPLLSLTIILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNV CYY+VGVP+G +LGF FN GAKGIW GMIGGT+MQT+IL
Sbjct  429  VLSGVAVGCGWQTFVAYVNVTCYYLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEV+ A KRL++W+ K++ LL
Sbjct  489  LWVTFRTDWNKEVDQALKRLDKWEDKKQHLL  519



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QP
Sbjct  359  FSVIIVNIYSLITCVILAIVILAFRDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  419  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             W+T RTDW KEVE + KRL++W  K+  ++P+
Sbjct  479  AWITFRTDWTKEVEESAKRLDKWSNKKPEVVPE  511



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L SFIISVI AI+VL LRHV+SY FT GE +A+A SDL PLLAL+L+LNG+QP
Sbjct  356  FSVVVVTLSSFIISVIFAILVLLLRHVMSYAFTSGETIAEAASDLAPLLALSLILNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F L AKGIW GM+GGT MQTIIL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGVILGFNFKLEAKGIWLGMLGGTAMQTIIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
            LWVT RT+W +EVE AK RLN W D  ++PLL
Sbjct  476  LWVTFRTNWEQEVEKAKSRLNMWQDQSKKPLL  507



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  +S IISVI A+V+L LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QP
Sbjct  368  FSVMVVTALSSIISVIIAVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQP  427

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL
Sbjct  428  VLSGVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLIL  487

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  488  IWVTFRTDWNKEVYEATKRLNKWEDKKQPLL  518



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV LISF+I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQP
Sbjct  347  FSVFVVTLISFLIAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            +W T R DW KEVE AKK L++W+  +E L
Sbjct  467  IWFTFRADWNKEVEKAKKHLDKWENVKETL  496



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  +S +IS++  ++VL LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QP
Sbjct  289  FSVWVVTALSTLISIMLGVLVLCLRNYISYLFTEGEVVSNAVADLCPLLAVTLVLNGIQP  348

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GAVLGF F LG KGIW GMIGGT MQT IL
Sbjct  349  VLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAIL  408

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  264
            +WVT+RTDW KEVE A+ RL++W+A +  EPLL
Sbjct  409  VWVTLRTDWNKEVEEAQNRLHKWEANKTTEPLL  441



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWG  511

Query  284  AKREPL  267
              +EPL
Sbjct  512  KVKEPL  517



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   SF++SVIAAI+VL  R  ISY+FT+GEVVA A SDL P LA+TL+LNGVQP
Sbjct  349  FSVLVVTSCSFVVSVIAAIIVLIFRDSISYIFTEGEVVAKAASDLSPFLAVTLILNGVQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+IL
Sbjct  409  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            L VT RTDW KEVE AK RL+ WD K EPLL K
Sbjct  469  LGVTWRTDWNKEVEGAKNRLSTWDDKSEPLLQK  501



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV   SFII+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QP
Sbjct  280  FAVFVVTSTSFIIAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQP  339

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+IL
Sbjct  340  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLIL  399

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE AK RL  WD      L
Sbjct  400  LWVTYRTDWNKEVEKAKSRLETWDTNNSASL  430



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV ++S II+++ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QP
Sbjct  337  FSVWVVTVLSAIIAIVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQP  396

Query  536  VLS---GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  366
            VLS   GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT +QT
Sbjct  397  VLSEISGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQT  456

Query  365  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  264
             ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  457  AILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L SF+ISV+AA+ VL LR+VISY FT GE VA AVS LCPLLA++L+LNG+QP
Sbjct  363  FSVLVVTLTSFLISVVAAVAVLVLRNVISYAFTGGEAVAQAVSGLCPLLAISLMLNGIQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF  GAKGIW G++GGT+MQTIIL
Sbjct  423  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQTIIL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            + V +RTDW KEVE A +RL+QW+ K+EPLL +
Sbjct  483  IVVMVRTDWNKEVEKALERLDQWEDKKEPLLKE  515



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV LISF+I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQP
Sbjct  347  FSVFVVTLISFLIAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQP  406

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGT+MQT IL
Sbjct  407  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTIMQTFIL  466

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            +W T R DW KEVE AKK L++W+  +E L
Sbjct  467  IWFTFRADWNKEVEKAKKHLDKWENVKETL  496



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV ++SFI+SVI ++V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QP
Sbjct  361  FSVLVVTVLSFILSVIISVVILLCRDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  421  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+WVKEVE A+KRLN+W+ ++ PLL
Sbjct  481  IWVTFRTNWVKEVEEAQKRLNKWE-EKSPLL  510



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  358  RNYISYIFTEGEVVSNAVADLCPLLAITLVLNGIQPVLSGVAVGCGWQEFVAYVNVGCYY  417

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  288
            +VGVP+GA+LGF F LG KGIW GMIGGT MQT IL+W T+RTDW KEVE A+KRLN+W 
Sbjct  418  IVGVPLGAILGFVFKLGVKGIWSGMIGGTFMQTAILVWATLRTDWNKEVEEAQKRLNKWA  477

Query  287  DAK-REPLL  264
            D+K  EPLL
Sbjct  478  DSKTTEPLL  486



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R +ISY FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDIISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQAFVAYVNVGCYY  450

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+
Sbjct  451  LVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWE  510

Query  284  AKREPL  267
              +E L
Sbjct  511  EVKEQL  516



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV ++SFI+SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG+QP
Sbjct  369  FSVVVVTVLSFILSVVISLVILLCRDYISYIFTDGEDVAAAVSKLTPLLALTLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  429  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  489  MWVTFRTNWNREVEEAMKRLNKWEDKT-PLLSE  520



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV ++SF +SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG+QP
Sbjct  369  FSVVVVTVLSFFLSVVISLVILLCRDYISYIFTDGEDVATAVSKLTPLLALTLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  429  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  489  MWVTFRTNWNREVEEAMKRLNKWEDK-TPLLSE  520



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GEVVA  VS LCP LA+TL+LNG+QP
Sbjct  348  FSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEVVAKEVSSLCPYLAVTLILNGIQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIIL
Sbjct  408  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIIL  467

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LWVT  TDW KEVE A+KRL++W+  + PL
Sbjct  468  LWVTFSTDWNKEVESARKRLDKWENLKGPL  497



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  386  RDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYY  445

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD
Sbjct  446  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWD  505

Query  284  AKREPLL  264
               +P++
Sbjct  506  DTAKPIV  512



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VVN+ISFII+VI A+VVLALR V+SY FTDGE VA+AVSDLCP LA+TL+LNG+QP
Sbjct  352  FSVIVVNMISFIIAVIEAVVVLALRRVVSYAFTDGETVANAVSDLCPYLAVTLILNGIQP  411

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+IL
Sbjct  412  VLSGVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLIL  471

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            LW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  472  LWITLRTDWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VVN+ISFII+VI A+VVLALR V+SY FTDGE VA+AVSDLCP LA+TL+LNG+QP
Sbjct  353  FSVIVVNMISFIIAVIEAVVVLALRRVVSYAFTDGETVANAVSDLCPYLAVTLILNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT++QT+IL
Sbjct  413  VLSGVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGTMLQTLIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            LW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  473  LWITLRTDWNKEVNTAKKRLNKWGYKKEP  501



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV +V  +SFI + + A+VVL LR  +SY FT GE VA AVSDLCPLLA TLVLNG+QP
Sbjct  359  FSVFMVTSLSFIAATVCAVVVLCLRDQLSYFFTGGEAVARAVSDLCPLLAATLVLNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTII  360
            VLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+I
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLI  478

Query  359  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LLWVT+RTDW KEVE AK RL++WD K++PLL
Sbjct  479  LLWVTVRTDWNKEVENAKARLDKWDDKKQPLL  510



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AI++LA R V+SY FT+GE V+ AVSDLCPLLA+TLVLNG+QP
Sbjct  361  FSVIIVNIYSLITCVILAIIILACRDVLSYAFTEGENVSAAVSDLCPLLAVTLVLNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  421  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTIIQTVIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL+ W  K+  ++P+
Sbjct  481  AWVTFRTDWTKEVEEASKRLDVWSNKKTEVVPE  513



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 4/155 (3%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  IS IIS++ AIV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QP
Sbjct  336  FSVWVVTAISTIISIMLAIVILCLRNYISYIFTEGEVVSNAVADLCPLLAITLILNGIQP  395

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GA+LGF F  G KGIW GMIGGT MQT IL
Sbjct  396  VLSGVAVGCGWQEFVAYVNIGCYYIVGVPLGAILGFVFKFGVKGIWSGMIGGTFMQTAIL  455

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR----EPLL  264
            LW T+RTDW KEVE A+KRL++W+ ++    EPLL
Sbjct  456  LWATLRTDWNKEVEEAQKRLHKWEDQKTTTTEPLL  490



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAKAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V VV   SFII+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QP
Sbjct  353  FAVFVVTSTSFIIAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+IL
Sbjct  413  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE AK RL  WD      L
Sbjct  473  LWVTYRTDWNKEVEKAKSRLETWDTNNSASL  503



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SV+ + V+L     ISY+FT+GE V+ AVS L PLLA TL+LNG+QP
Sbjct  357  FSVVVVTLLSFVLSVLVSAVILLCGDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQP  416

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  417  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  476

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  477  IWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV   S II++I AI+++ LR  ISY+FT G VVA+AVSDL P+LA++LVLNG+QP
Sbjct  355  FSVLVVTASSTIIAIIFAIIIMLLRDKISYMFTGGTVVAEAVSDLAPILAISLVLNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVG YY +G+P+GAVLGF F LGAKGIW GM+GGT +QTIIL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGSYYFLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTIIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
            +WVT+RTDW KEVE+A+ RLN+W+ K+E
Sbjct  475  IWVTVRTDWNKEVEIARGRLNRWEDKKE  502



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ-  540
            FSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q 
Sbjct  245  FSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQL  304

Query  539  -PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  363
             PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+
Sbjct  305  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTL  364

Query  362  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  365  ILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  397



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SVI +IV+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QP
Sbjct  36   FSVVVVTLLSFVLSVIISIVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQP  95

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  96   VLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMIL  155

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            +WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  156  VWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  185



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A+VVL+LR VISY FT GE VA AVS L P LA+TLVLNG+QP
Sbjct  356  FSVIVVTLVSLAFAVVEAVVVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLVLNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+IL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEV+ AK R+ +WD K +PLL
Sbjct  476  LWVTFRTDWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVVNL S +ISVI A++VL LRHVISY FT G VV+DAVSDL P LA ++VL GVQP
Sbjct  364  FSVVVVNLCSLLISVILAVIVLLLRHVISYAFTSGTVVSDAVSDLSPFLAASIVLGGVQP  423

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT MQT++L
Sbjct  424  VLSGVAVGCGWQAFVAYVNLACYYIIGIPLGCVLGFACDMGAKGIWTGMLGGTAMQTLVL  483

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LW T RT+W KEVE A+ RL+ WDA  EPLL +
Sbjct  484  LWATFRTNWGKEVEKAQGRLDTWDATNEPLLKE  516



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RH ISY FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  365  RHYISYAFTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  424

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
             VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W+
Sbjct  425  FVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWE  484

Query  284  AKREPLLPK  258
              ++PLL  
Sbjct  485  DNKQPLLSN  493



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQP
Sbjct  349  FSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIIL
Sbjct  409  VLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  469  LWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  199  RNVISYAFTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  258

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+
Sbjct  259  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWE  318

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  319  ESREPLLKQ  327



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQP
Sbjct  349  FSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIIL
Sbjct  409  VLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  469  LWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQP
Sbjct  349  FSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIIL
Sbjct  409  VLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  469  LWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPYLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV ++S +I+V+ A+VVL+ R VISY FTDGE VA+AVS L P LA+TL+LNG+QP
Sbjct  359  FSVLVVTIVSLMIAVVEAVVVLSFRDVISYAFTDGETVANAVSHLTPYLAITLILNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTIIL
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            LWVT RTDW KEVE A  RL +W+ K+ P
Sbjct  479  LWVTFRTDWNKEVETAGNRLKKWEDKKLP  507



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVISYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP+G +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNKWD  487

Query  284  AKRE  273
             K+E
Sbjct  488  DKQE  491



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  ISFIISVIAAI VL  R VISY FT+GEVVA AVSDL PLLALTL+LNG+QP
Sbjct  36   FSVVVVTTISFIISVIAAIAVLIFRDVISYAFTEGEVVAAAVSDLTPLLALTLLLNGIQP  95

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIIL
Sbjct  96   VLSGVAVGCGWQAFVAYVNVGCYYLVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIIL  155

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LW+TIRTDW KEVE A +RLN WD K EPL
Sbjct  156  LWITIRTDWKKEVEEAARRLNNWDVK-EPL  184



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY+FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  92   RHVISYIFTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  151

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKEVE A +RL+QW+
Sbjct  152  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE  211

Query  284  AKREPLLPK  258
                PLL +
Sbjct  212  -DTSPLLKQ  219



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV V  +SF+++++ AI+VL  R+ +SY+FT G  V++AV+DL P LA++++LNG+QP
Sbjct  357  FSVVAVTTLSFLVALVFAILVLIFRYELSYIFTGGTEVSEAVADLSPFLAISILLNGIQP  416

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ+FVAYVNV CYYVVG+PVG +LGFYF LG KGIW GMIGGTV+QT+IL
Sbjct  417  VLSGVAVGCGWQSFVAYVNVACYYVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVIL  476

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEVE A  RL++W+A +EPLL
Sbjct  477  LWVTFRTDWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++V ++S +I+++ A+VVL+LRHVISY FT+GE VA+AVS L P LA+TL+LNG+QP
Sbjct  359  FSVLMVTIVSLLIAIVEAVVVLSLRHVISYAFTEGETVANAVSHLTPYLAVTLILNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIIL
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
            LWVT RTDW KEV  A  RL +WD ++E
Sbjct  479  LWVTFRTDWNKEVGTAINRLEKWDDRQE  506



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ-  540
            FSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q 
Sbjct  357  FSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQL  416

Query  539  -PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  363
             PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+
Sbjct  417  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTL  476

Query  362  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  477  ILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I SVI AI+V   R V+SY FT+GE V+ AVSDLCP LA+TLVLNG+QP
Sbjct  354  FSVIIVNIYSLITSVILAIIVWLCRDVLSYAFTEGEEVSAAVSDLCPFLAVTLVLNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+G + GFYF   AKGIW GMIGGT++QT+IL
Sbjct  414  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPIGTLFGFYFEYDAKGIWTGMIGGTLIQTVIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR  276
            +WV +RTDW KEVE A KRL++W  K+
Sbjct  474  VWVILRTDWTKEVEKASKRLDKWSNKK  500



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SFIISVI  +V+L LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QP
Sbjct  369  FSVVVVTALSFIISVIIGVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQP  428

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT +QT+IL
Sbjct  429  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQTLIL  488

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RTDW KEV+ A KRLN+W+  ++ LL
Sbjct  489  IWVTFRTDWNKEVDEAIKRLNKWEDNKKALL  519



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+QP
Sbjct  376  FSVLVVTLVSLTFAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQP  435

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  436  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLIL  495

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  496  LWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAVTIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+QP
Sbjct  376  FSVLVVTLVSLTFAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQP  435

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  436  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLIL  495

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  496  LWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  391  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  450

Query  284  AKREPLLPK  258
              + PLL +
Sbjct  451  GSQAPLLKQ  459



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V++V   SFIISV+ AIVVLALR+VISY FT+GE V++AVS L P LA++++LNG+QP
Sbjct  354  FAVIIVTSSSFIISVVCAIVVLALRNVISYAFTEGETVSNAVSALSPYLAVSIILNGIQP  413

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G VLGF F+ GA+GIW GMIGGT +QT+IL
Sbjct  414  VLSGVAVGCGWQAFVAYVNVGCYYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLIL  473

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LWVT RTDW KEVE  K RL++WD K+EPLL +
Sbjct  474  LWVTFRTDWKKEVENVKNRLDRWDDKKEPLLTE  506



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV ++S +I+++ A+VVL+LRHVISY FTDGE VA+AVS L P LA+TL++NG+QP
Sbjct  359  FSVLVVTIVSLLIAIVEAVVVLSLRHVISYAFTDGETVANAVSHLTPYLAVTLIINGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+ GA+GIW GMIGGT+MQTIIL
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDFGAEGIWTGMIGGTLMQTIIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKRE  273
            LWVT RTDW KEV  A  RL +WD ++E
Sbjct  479  LWVTFRTDWNKEVGTAINRLEKWDDRKE  506



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISYVFT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYVFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  284  AKREPL  267
             K+EPL
Sbjct  495  DKKEPL  500



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV VV  ISF+I+V+ AI+VL LR+VISY FT GE VA+A   +CP LA+TL+LNGVQP
Sbjct  351  FSVFVVTFISFLIAVVEAIIVLCLRNVISYAFTKGETVANAQYLICPFLAVTLILNGVQP  410

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIIL
Sbjct  411  VLSGVAVGCGWQAFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIIL  470

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPL  267
            LW T RTDW KEVE A+ RL++W+  +EPL
Sbjct  471  LWFTYRTDWNKEVEKARTRLDKWENVKEPL  500



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+VNL S +ISVI A+ VL LRHVISY FT G VVADAV++L P LA ++VLNGVQP
Sbjct  361  FSVVIVNLCSLLISVILAVAVLLLRHVISYAFTSGTVVADAVAELSPFLAASIVLNGVQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY++G+P+G VLGF  ++G KGIW GM+GGT++QTI+L
Sbjct  421  VLSGVAVGCGWQAFVAYVNVACYYIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTIVL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LW TIRT+W KEV  A+ RL++WD  +EPLL +
Sbjct  481  LWATIRTNWGKEVGKAQSRLDKWDDNKEPLLRE  513



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYIFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  284  AKREPL  267
             K+EPL
Sbjct  495  DKKEPL  500



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV ++SFI+SVI +IV+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QP
Sbjct  367  FSVLVVTVLSFILSVIISIVILICRDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQP  426

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT+IL
Sbjct  427  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQTLIL  486

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEVE A KRLN+W+ K  P+L
Sbjct  487  VWVTFRTNWNKEVEEALKRLNKWEDK-SPIL  516



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ SFI  VI AIV+LA R V+SY FT+GE V+ AVS+LCPLLALTL+LNG+QP
Sbjct  353  FSVIIVNIYSFITCVILAIVILACRDVLSYAFTEGEKVSAAVSELCPLLALTLILNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY+VG+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  413  VLSGVAVGCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL++W   +  ++P+
Sbjct  473  AWVTFRTDWTKEVEEASKRLDKWSNIKLEVVPE  505



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV  +SF+I++  A+V L  R  +SY+FT+GE VA AVSDLCPLLA TL+LNG+QP
Sbjct  348  FSVVVVTALSFVITLAMAVVFLVFRDYLSYIFTEGETVARAVSDLCPLLAATLILNGIQP  407

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVG  WQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL
Sbjct  408  VLSGVAVG--WQKLVAYINVGCYYFVGIPLGILLGFKFHLGAKGIWTGMLGGTCMQTLIL  465

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
             W+T RTDW KEVE A+KRLNQW+  ++PLL
Sbjct  466  FWITFRTDWDKEVEEARKRLNQWEDNKQPLL  496



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  376  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  435

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  495

Query  284  AKREPLLPK  258
              + PLL +
Sbjct  496  DSQAPLLKQ  504



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+VVVV   SFIISV+ AI+VL LRH ISYVFT+GE V++AVSDL P LA+++VLNG+QP
Sbjct  352  FAVVVVTSSSFIISVVCAIIVLVLRHDISYVFTEGETVSNAVSDLSPYLAISIVLNGIQP  411

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+ GA+GIW GMIGGT +QTIIL
Sbjct  412  VLSGVAVGCGWQAFVAYVNVGCYYIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTIIL  471

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            +WVT RTDW KEVE A+ RLN ++ K+EP
Sbjct  472  VWVTYRTDWNKEVEKAQSRLNTYEDKKEP  500



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I SVI AIV+LA R  +SY FT+G+ V+ AVSDLCPLLALTLVLNG+QP
Sbjct  359  FSVIIVNIYSLITSVILAIVILACRDFLSYAFTEGKKVSVAVSDLCPLLALTLVLNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVA VNVGCYY++G+P+G + GFYF   AKGIW GMI GT++QT+IL
Sbjct  419  VLSGVAVGCGWQAFVAKVNVGCYYIIGIPLGVIFGFYFKFDAKGIWTGMICGTLIQTVIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A KRL++W  K+  ++P+
Sbjct  479  AWVTFRTDWTKEVEEASKRLDKWSNKKLEVVPE  511



>emb|CDY71092.1| BnaAnng36070D [Brassica napus]
Length=130

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  4    RDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  63

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W 
Sbjct  64   IIGIPLGALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWS  123

Query  284  AKREPLL  264
             K+  ++
Sbjct  124  NKKAEVI  130



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            RHVISYVFTD  VVA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  379  RHVISYVFTDSPVVAEAVAELAPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  438

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL VT RTDW KEVE A +RL+QW+
Sbjct  439  IVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWE  498

Query  284  AKREPLLPK  258
              + PLL +
Sbjct  499  DTQAPLLKQ  507



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FS+V+VNL S +ISVI A+VVL LRHVISY FT G VVADAV++L P LA ++VLNGVQP
Sbjct  361  FSIVIVNLCSLLISVILAVVVLLLRHVISYAFTSGTVVADAVTELSPFLAASIVLNGVQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNV CYY++G+P+G VLGF  ++G KGIW GM+GGT++QT++L
Sbjct  421  VLSGVAVGCGWQAFVAYVNVACYYIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTMVL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LW TIRT+W KEVE A+ R+++WD  +EPLL +
Sbjct  481  LWATIRTNWGKEVEKAQSRVDRWDDNKEPLLRE  513



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QP
Sbjct  379  FSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQP  438

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  439  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLIL  498

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  499  LWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  529



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QP
Sbjct  376  FSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQP  435

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  436  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLIL  495

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  496  LWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QP
Sbjct  386  FSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQP  445

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  446  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLIL  505

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  506  LWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  536



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V L+S  I+++ A +VL LR VISY FT GE VA AVS L P LA+TL+LNG+QP
Sbjct  356  FSVVIVTLVSLAIAIVEAAIVLLLRDVISYAFTSGETVAKAVSKLTPYLAVTLILNGIQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGA+GIW GMIGGT MQTIIL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWD----AKREPLL  264
            LWVT RTDW+KEV  ++ RL +WD     +++PLL
Sbjct  476  LWVTFRTDWIKEVGTSRDRLEKWDDSNKQQQQPLL  510



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R VISYVFTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
             VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL++W+
Sbjct  391  FVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWE  450

Query  284  AKREPLLPK  258
              + PLL +
Sbjct  451  DTQAPLLKQ  459



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QP
Sbjct  383  FSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQP  442

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+IL
Sbjct  443  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLIL  502

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            LW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  503  LWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  533



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  284  AKREPLL  264
             K+EPLL
Sbjct  500  DKKEPLL  506



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWD  499

Query  284  AKREPL  267
             K+EPL
Sbjct  500  DKKEPL  505



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  284  AKREPLL  264
             K+EPLL
Sbjct  500  DKKEPLL  506



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  284  AKREPLLPK  258
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FTDGE VA AVS L PLL LTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  412  RDYISYIFTDGEDVAAAVSKLTPLLGLTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  471

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  472  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWE  531

Query  284  AKREPLLPK  258
             K  PLL +
Sbjct  532  DK-TPLLSE  539



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQP
Sbjct  245  FSVIVVTSISLALSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  305  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  365  VYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  397



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEV  A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVVEAAKRLNKWG  511

Query  284  AKREPL  267
              +E L
Sbjct  512  EVKETL  517



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +IS  IS+I A +VLALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QP
Sbjct  349  FSVVVVMVISTTISIIIACIVLALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ+FVA VNV CYY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL
Sbjct  409  VLSGVAVGCGWQSFVACVNVCCYYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWD  285
             WVT RTDW KEVE A KR+N+W+
Sbjct  469  SWVTFRTDWNKEVEEAVKRINKWN  492



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV +IS  IS+I A +VLALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QP
Sbjct  349  FSVVVVMVISTTISIIIACIVLALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQP  408

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ+FVA VNV CYY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL
Sbjct  409  VLSGVAVGCGWQSFVACVNVCCYYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCIL  468

Query  356  LWVTIRTDWVKEVEVAKKRLNQWD  285
             WVT RTDW KEVE A KR+N+W+
Sbjct  469  SWVTFRTDWNKEVEEAVKRINKWN  492



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDVEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  284  AKREPLL  264
             K+EPLL
Sbjct  500  DKKEPLL  506



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AI+++  R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG+QP
Sbjct  353  FSVIIVNIYSLITCVILAIIIMVCRDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  413  VLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKYDAKGIWTGMICGTLIQTVIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKR  276
             WVT RTDW KEVE A KRL+ W  K+
Sbjct  473  AWVTFRTDWTKEVEEASKRLDIWSNKK  499



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVV+V   SFII+ I AI+VL LR V+SY FT G  VADAVS+L P LA++++LNG+QP
Sbjct  361  FSVVIVTSSSFIIAAIFAILVLVLRRVMSYAFTSGSTVADAVSELSPYLAISVLLNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VL+GVAVGCGWQ FVAYVNVGC+Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT+IL
Sbjct  421  VLTGVAVGCGWQAFVAYVNVGCFYFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQTLIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            ++VT RTDW KEVE  + RL++W+ K+EPLL
Sbjct  481  MYVTFRTDWTKEVEKTRNRLDRWEDKKEPLL  511



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  499

Query  284  AKREPL  267
             K+EPL
Sbjct  500  DKKEPL  505



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  499

Query  284  AKREPL  267
             K+EPL
Sbjct  500  DKKEPL  505



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV ++SF+++ I ++V+L  R  ISY++TDG+ VA AVS L PLLALTL+LNG+QP
Sbjct  359  FSVVVVTMLSFVLTSIISVVILLCRDYISYIYTDGDDVAQAVSKLTPLLALTLILNGIQP  418

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  419  VLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLIL  478

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  264
            +WVT RT+W KEV  + KRL++W+ K  PLL
Sbjct  479  VWVTFRTNWNKEVAESMKRLHKWEGK-TPLL  508



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            F+V++VNL S IISVI AI VL LRHVISY FT G VVA AV++L P LA ++VL GVQP
Sbjct  361  FAVIIVNLSSLIISVILAIAVLLLRHVISYAFTSGTVVAGAVAELSPFLAASIVLGGVQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT+MQTI+L
Sbjct  421  VLSGVAVGCGWQAFVAYVNIACYYIIGIPLGCVLGFTCDMGAKGIWSGMLGGTIMQTIVL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LW T RT+W KEVE A  RL+ W+  +EPLL +
Sbjct  481  LWATFRTNWKKEVEKAHSRLDSWNDNKEPLLKE  513



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  382  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  441

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  442  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  501

Query  284  AKREPL  267
             K+EPL
Sbjct  502  DKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  382  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  441

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  442  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  501

Query  284  AKREPL  267
             K+EPL
Sbjct  502  DKKEPL  507



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  381  RDYVSYIFTSDIHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  440

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  441  IVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  500

Query  284  AKREP  270
             K+EP
Sbjct  501  EKKEP  505



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 131/161 (81%), Gaps = 10/161 (6%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SV+ +IV+L  R  ISY+FT+GE V+ AVS L PLLA+TL+LNG+QP
Sbjct  360  FSVVVVTLLSFVLSVLISIVILLCRDYISYIFTEGEDVSRAVSKLTPLLAVTLILNGIQP  419

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT MQT+IL
Sbjct  420  VLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTFMQTLIL  479

Query  356  LWVTIRTDWVKEVEV----------AKKRLNQWDAKREPLL  264
            +WVT RT+W KEV++          A+KRLN+W+  + PLL
Sbjct  480  VWVTYRTNWTKEVQIAITYSNLVEEAQKRLNKWNDSKAPLL  520



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQP
Sbjct  356  FSVIVVTSISLALSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQP  415

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  475

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  476  VYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  508



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VVNL S +ISVI A++VL+LRHVISY FT G VV+DAVS+L P LA ++VL GVQP
Sbjct  361  FSVIVVNLCSLLISVILAVIVLSLRHVISYAFTSGTVVSDAVSELSPFLAASIVLGGVQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVN+GCYY++GVP+G VLGF  ++GAKGIW GM+GGT +QT++L
Sbjct  421  VLSGVAVGCGWQAFVAYVNLGCYYIIGVPLGCVLGFACDMGAKGIWTGMLGGTAVQTLVL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            LW T RT+W KEVE A+ RL+ WD  +EPLL +
Sbjct  481  LWATFRTNWDKEVEKAQSRLDTWDDVKEPLLKE  513



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SVI +IV+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QP
Sbjct  363  FSVVVVTLLSFVLSVIISIVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  423  VLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMIL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            +WVT RT+W KEVE A+KRLN+W+  + P
Sbjct  483  VWVTFRTNWNKEVEEAQKRLNKWEDSKAP  511



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF++SVI ++V+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QP
Sbjct  363  FSVVVVTLLSFVLSVIISVVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQP  422

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL
Sbjct  423  VLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMIL  482

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREP  270
            +WVT RT+W KEVE A+KRLN+W+  + P
Sbjct  483  VWVTFRTNWNKEVEEAQKRLNKWEDSKAP  511



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV + + IISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QP
Sbjct  336  FSVIVVTVCACIISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQP  395

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL
Sbjct  396  VLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVIL  455

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  456  VWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  487



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            V+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  499

Query  284  AKREPL  267
             K+  L
Sbjct  500  DKKNSL  505



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  499

Query  284  AKRE  273
             K++
Sbjct  500  DKKD  503



>emb|CAN69304.1| hypothetical protein VITISV_021604 [Vitis vinifera]
Length=910

 Score =   160 bits (404),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 104/132 (79%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSVVVV L+SF+ISV+AA VVL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QP
Sbjct  46   FSVVVVTLVSFLISVVAAAVVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQP  105

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL
Sbjct  106  VLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFIL  165

Query  356  LWVTIRTDWVKE  321
            +WVT RT+W KE
Sbjct  166  IWVTARTNWNKE  177



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LAL+++LNG+QP
Sbjct  355  FSVIVVTSISLALSVILAILVLILRNVMSYAFTGGSTVADSVAELSPFLALSVILNGIQP  414

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  474

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  475  VYVTLRTDWNKEVEKARNRMDEWGDKTELLLKE  507



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  499

Query  284  AKRE  273
             K++
Sbjct  500  DKKD  503



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYIFTSDPEVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  284  AKREPL  267
             K+EPL
Sbjct  495  DKKEPL  500



>gb|KDO78209.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=397

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LAL+++LNG+QP
Sbjct  245  FSVIVVTSISLALSVILAILVLILRNVMSYAFTGGSTVADSVAELSPFLALSVILNGIQP  304

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLG KGIW GMIGGT++QTIIL
Sbjct  305  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGTKGIWSGMIGGTLIQTIIL  364

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  365  VYVTLRTDWNKEVEKARNRMDEWGDKTELLLKE  397



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  644  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  465
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  377  RDYVSYIFTSDVDVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  436

Query  464  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  285
            +VG+PVG +LGF FN  AKGIW GMIGG++MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  437  IVGIPVGCILGFTFNFQAKGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  496

Query  284  AKREP  270
             K+EP
Sbjct  497  EKKEP  501



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV+VV + + IISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QP
Sbjct  361  FSVIVVTVCACIISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQP  420

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL
Sbjct  421  VLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVIL  480

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
            +WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  481  VWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  512



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  716  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  537
            FSV++VN+ S I  VI AI+++  R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG+QP
Sbjct  353  FSVIIVNIYSLITCVILAIIIIVCRDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNGIQP  412

Query  536  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  357
            VLSGVAVGCGWQ FVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL
Sbjct  413  VLSGVAVGCGWQMFVAKVNVGCYYIIGIPLGALFGFYFKYDAKGIWTGMICGTLIQTVIL  472

Query  356  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  258
             WVT RTDW KEVE A +RL+ W  K+  ++ K
Sbjct  473  AWVTFRTDWTKEVEEASRRLDIWSNKKAEVISK  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410