BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033C07

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  193   7e-58   Citrus sinensis [apfelsine]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            194   1e-54   Solanum lycopersicum
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             194   1e-54   Citrus clementina [clementine]
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             185   1e-54   
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            194   2e-54   Glycine max [soybeans]
ref|XP_003596992.1|  Transparent testa 12 protein                       193   2e-54   Medicago truncatula
emb|CDP11780.1|  unnamed protein product                                193   3e-54   Coffea canephora [robusta coffee]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   6e-54   Cicer arietinum [garbanzo]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            191   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            191   2e-53   Solanum lycopersicum
emb|CDM86696.1|  unnamed protein product                                190   4e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   4e-53   Populus euphratica
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       190   5e-53   Solanum tuberosum [potatoes]
gb|KJB30572.1|  hypothetical protein B456_005G149900                    187   7e-53   Gossypium raimondii
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM86687.1|  unnamed protein product                                188   2e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       188   2e-52   Nicotiana sylvestris
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            186   2e-52   
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    188   3e-52   Nelumbo nucifera [Indian lotus]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    187   3e-52   Gossypium raimondii
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   4e-52   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            187   4e-52   Glycine soja [wild soybean]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            186   5e-52   Triticum urartu
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          186   5e-52   
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    177   6e-52   Nicotiana alata [flowering tobacco]
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            188   6e-52   
emb|CDP11781.1|  unnamed protein product                                185   9e-52   Coffea canephora [robusta coffee]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               186   1e-51   
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   1e-51   Nicotiana tomentosiformis
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             186   1e-51   Phaseolus vulgaris [French bean]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    185   2e-51   Cicer arietinum [garbanzo]
emb|CDM86680.1|  unnamed protein product                                183   2e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   3e-51   Eucalyptus grandis [rose gum]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            185   3e-51   Glycine soja [wild soybean]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   3e-51   Cucumis melo [Oriental melon]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    185   3e-51   Cicer arietinum [garbanzo]
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            182   4e-51   Triticum urartu
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    184   5e-51   
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            182   5e-51   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               184   5e-51   
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   5e-51   Brachypodium distachyon [annual false brome]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              184   6e-51   Gossypium arboreum [tree cotton]
emb|CDM86692.1|  unnamed protein product                                184   6e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   6e-51   
ref|XP_002883313.1|  mate efflux family protein                         184   6e-51   
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             182   7e-51   
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   2e-50   Solanum lycopersicum
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            183   2e-50   Phoenix dactylifera
emb|CBI23253.3|  unnamed protein product                                175   2e-50   Vitis vinifera
dbj|BAJ34540.1|  unnamed protein product                                182   3e-50   Eutrema halophilum
ref|NP_188806.1|  MATE efflux family protein                            182   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57730.1|  hypothetical protein B456_009G178100                    182   3e-50   Gossypium raimondii
gb|KJB57728.1|  hypothetical protein B456_009G178100                    182   3e-50   Gossypium raimondii
gb|KEH36840.1|  MATE efflux family protein                              182   3e-50   Medicago truncatula
gb|AAM20595.1|  integral membrane protein, putative                     182   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            182   5e-50   Tarenaya hassleriana [spider flower]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   5e-50   Nicotiana sylvestris
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   7e-50   Camelina sativa [gold-of-pleasure]
gb|AAR00628.1|  putative MATE family protein                            179   8e-50   Oryza sativa Japonica Group [Japonica rice]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              181   9e-50   Gossypium arboreum [tree cotton]
emb|CBI23254.3|  unnamed protein product                                179   9e-50   Vitis vinifera
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                181   1e-49   Erythranthe guttata [common monkey flower]
emb|CDM86677.1|  unnamed protein product                                180   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   1e-49   Oryza brachyantha
emb|CAN73203.1|  hypothetical protein VITISV_008169                     174   2e-49   Vitis vinifera
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   2e-49   Setaria italica
emb|CAN82750.1|  hypothetical protein VITISV_014577                     178   2e-49   Vitis vinifera
gb|KJB69293.1|  hypothetical protein B456_011G014800                    180   2e-49   Gossypium raimondii
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           180   2e-49   Nicotiana tabacum [American tobacco]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   3e-49   
gb|AHI48506.1|  multidrug and toxic extrusion transporter               180   3e-49   Vaccinium corymbosum [American blueberry]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            179   4e-49   Vitis vinifera
gb|EEC75604.1|  hypothetical protein OsI_12313                          179   4e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001050520.1|  Os03g0570800                                       179   5e-49   
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             179   5e-49   Capsella rubella
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   6e-49   
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   8e-49   Elaeis guineensis
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   8e-49   Cucumis melo [Oriental melon]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   1e-48   Cicer arietinum [garbanzo]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    178   1e-48   Vitis vinifera
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    178   1e-48   Populus euphratica
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   1e-48   Elaeis guineensis
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    178   1e-48   Nicotiana sylvestris
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH20308.1|  AT1G61890                                              172   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   2e-48   Sesamum indicum [beniseed]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          177   2e-48   Sorghum bicolor [broomcorn]
emb|CBI28938.3|  unnamed protein product                                176   3e-48   Vitis vinifera
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-48   Camelina sativa [gold-of-pleasure]
gb|EEC75610.1|  hypothetical protein OsI_12322                          177   3e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                       177   3e-48   
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   4e-48   Nicotiana tomentosiformis
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   4e-48   Cucumis melo [Oriental melon]
ref|XP_003605914.1|  Transparent testa 12 protein                       177   4e-48   Medicago truncatula
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   5e-48   Solanum tuberosum [potatoes]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   6e-48   Vitis vinifera
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   6e-48   Prunus mume [ume]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   6e-48   Zea mays [maize]
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         176   7e-48   Jatropha curcas
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   7e-48   Solanum tuberosum [potatoes]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            176   8e-48   Vitis vinifera
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             176   8e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             176   8e-48   Eutrema salsugineum [saltwater cress]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   8e-48   Fragaria vesca subsp. vesca
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            176   9e-48   Vitis vinifera
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-47   Zea mays [maize]
ref|XP_006389638.1|  MATE efflux family protein                         175   1e-47   
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-47   Prunus mume [ume]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   1e-47   Solanum tuberosum [potatoes]
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   1e-47   
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-47   Solanum lycopersicum
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       175   1e-47   Cucumis sativus [cucumbers]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            175   1e-47   
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-47   Elaeis guineensis
ref|XP_002518495.1|  multidrug resistance pump, putative                175   2e-47   Ricinus communis
emb|CBI28937.3|  unnamed protein product                                175   2e-47   Vitis vinifera
ref|NP_564787.1|  MATE efflux family protein                            174   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026056.1|  MATE efflux family protein                         174   3e-47   
ref|NP_001142368.1|  uncharacterized protein LOC100274540               173   4e-47   Zea mays [maize]
gb|AAK82541.1|  At1g61890/F8K4_9                                        174   4e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04390.1|  unnamed protein product                                172   4e-47   Coffea canephora [robusta coffee]
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     171   5e-47   Eucalyptus grandis [rose gum]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   6e-47   
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   6e-47   Cucumis sativus [cucumbers]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   7e-47   Nicotiana sylvestris
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             173   8e-47   Citrus clementina [clementine]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   173   8e-47   Citrus sinensis [apfelsine]
gb|ACL53378.1|  unknown                                                 172   8e-47   Zea mays [maize]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   8e-47   Citrus sinensis [apfelsine]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   9e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            172   1e-46   Triticum urartu
ref|XP_002886501.1|  mate efflux family protein                         172   1e-46   
emb|CBI23251.3|  unnamed protein product                                171   1e-46   Vitis vinifera
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    172   1e-46   
ref|NP_001147791.1|  transparent testa 12 protein                       172   1e-46   Zea mays [maize]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Prunus mume [ume]
emb|CDP17486.1|  unnamed protein product                                172   2e-46   Coffea canephora [robusta coffee]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    172   2e-46   Nicotiana tomentosiformis
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-46   Fragaria vesca subsp. vesca
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   2e-46   Populus euphratica
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   3e-46   Prunus mume [ume]
emb|CDY47166.1|  BnaA01g22920D                                          171   3e-46   Brassica napus [oilseed rape]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Prunus mume [ume]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   4e-46   Brassica rapa
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            171   4e-46   Vitis vinifera
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   4e-46   Brassica rapa
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   4e-46   Populus euphratica
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             171   4e-46   Eutrema salsugineum [saltwater cress]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    171   4e-46   Arabis alpina [alpine rockcress]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             171   4e-46   Phaseolus vulgaris [French bean]
emb|CDY25329.1|  BnaC01g29980D                                          171   5e-46   Brassica napus [oilseed rape]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             171   5e-46   Prunus persica
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   7e-46   Brassica rapa
ref|XP_002518492.1|  multidrug resistance pump, putative                170   7e-46   Ricinus communis
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   8e-46   Setaria italica
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   9e-46   Populus euphratica
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   9e-46   Nicotiana tomentosiformis
dbj|BAD95082.1|  hypothetical protein                                   163   1e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07257.1|  BnaC04g19140D                                          166   1e-45   
emb|CDX76391.1|  BnaA08g10090D                                          170   1e-45   
gb|ACZ55931.1|  MATE transporter 2                                      170   1e-45   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                      170   1e-45   Zea mays [maize]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   1e-45   Nicotiana tomentosiformis
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             170   2e-45   
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   2e-45   Populus euphratica
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             169   2e-45   Capsella rubella
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    169   2e-45   Arabis alpina [alpine rockcress]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Populus euphratica
gb|ACF85024.1|  unknown                                                 161   2e-45   Zea mays [maize]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    169   2e-45   Arabis alpina [alpine rockcress]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   4e-45   Pyrus x bretschneideri [bai li]
gb|ABF97209.1|  MATE efflux family protein, expressed                   169   4e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75606.1|  hypothetical protein OsI_12318                          168   5e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       168   5e-45   
emb|CDY19507.1|  BnaC09g13960D                                          168   6e-45   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   6e-45   Brassica rapa
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   8e-45   Populus euphratica
emb|CDY12916.1|  BnaA09g13580D                                          167   9e-45   Brassica napus [oilseed rape]
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    168   1e-44   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             167   1e-44   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             167   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             167   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   
emb|CDY34833.1|  BnaA09g47590D                                          166   1e-44   Brassica napus [oilseed rape]
emb|CDX94063.1|  BnaC07g36970D                                          167   1e-44   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            167   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   2e-44   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-44   Brassica rapa
emb|CDY34637.1|  BnaC08g41960D                                          166   2e-44   Brassica napus [oilseed rape]
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             164   2e-44   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   2e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001148084.1|  transparent testa 12 protein                       166   2e-44   Zea mays [maize]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   2e-44   Eucalyptus grandis [rose gum]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             166   2e-44   
gb|AFW68307.1|  putative MATE efflux family protein                     164   2e-44   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   3e-44   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            166   3e-44   Brassica rapa
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   3e-44   
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             166   3e-44   Populus trichocarpa [western balsam poplar]
emb|CDY27434.1|  BnaC03g64740D                                          166   3e-44   Brassica napus [oilseed rape]
ref|XP_002867813.1|  mate efflux family protein                         166   3e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Brassica rapa
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Elaeis guineensis
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             166   4e-44   
emb|CDX98711.1|  BnaA03g44960D                                          166   4e-44   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   5e-44   Brassica rapa
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   5e-44   Fragaria vesca subsp. vesca
gb|KGN43522.1|  Mate efflux family protein                              165   6e-44   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-44   
emb|CDY27431.1|  BnaC03g64710D                                          165   6e-44   Brassica napus [oilseed rape]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             165   6e-44   Citrus clementina [clementine]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   7e-44   Populus euphratica
emb|CDX98712.1|  BnaA03g44970D                                          165   8e-44   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             165   8e-44   
gb|ACF85423.1|  unknown                                                 165   8e-44   Zea mays [maize]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             165   8e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   9e-44   Brassica rapa
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   1e-43   Citrus sinensis [apfelsine]
ref|XP_007026057.1|  MATE efflux family protein                         165   1e-43   
gb|AAM62936.1|  unknown                                                 164   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Malus domestica [apple tree]
ref|NP_567640.1|  MATE efflux family protein                            164   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Brassica rapa
dbj|BAH19969.1|  AT4G21910                                              164   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            164   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   162   1e-43   Citrus sinensis [apfelsine]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             164   2e-43   Capsella rubella
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          164   2e-43   Sorghum bicolor [broomcorn]
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            162   2e-43   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   2e-43   Sesamum indicum [beniseed]
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   3e-43   Camelina sativa [gold-of-pleasure]
emb|CDX94061.1|  BnaC07g36950D                                          164   3e-43   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   3e-43   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-43   Brassica rapa
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   3e-43   
emb|CDX79109.1|  BnaA01g11760D                                          163   3e-43   
emb|CDX98713.1|  BnaA03g44980D                                          162   3e-43   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-43   Brassica rapa
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            163   4e-43   
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               163   4e-43   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    163   4e-43   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   163   4e-43   Citrus sinensis [apfelsine]
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-43   Camelina sativa [gold-of-pleasure]
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    163   4e-43   Arabis alpina [alpine rockcress]
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          163   4e-43   Sorghum bicolor [broomcorn]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   5e-43   Sesamum indicum [beniseed]
ref|NP_001149176.1|  transparent testa 12 protein                       162   7e-43   Zea mays [maize]
gb|AGT17221.1|  transparent testa 12 protein                            162   8e-43   Saccharum hybrid cultivar R570
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   8e-43   Elaeis guineensis
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             162   1e-42   Capsella rubella
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            162   1e-42   Glycine soja [wild soybean]
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             162   1e-42   Capsella rubella
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-42   Glycine max [soybeans]
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                162   1e-42   Erythranthe guttata [common monkey flower]
emb|CDY39494.1|  BnaA01g24940D                                          162   1e-42   Brassica napus [oilseed rape]
ref|NP_172632.1|  MATE efflux family protein                            161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Brassica rapa
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            160   2e-42   
ref|NP_001119025.1|  mate efflux domain-containing protein              161   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   
emb|CDY71092.1|  BnaAnng36070D                                          151   3e-42   Brassica napus [oilseed rape]
emb|CDY64933.1|  BnaCnng45550D                                          160   3e-42   
emb|CDY19294.1|  BnaC01g31860D                                          160   3e-42   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-42   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-42   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   4e-42   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   
ref|XP_002892653.1|  mate efflux family protein                         160   4e-42   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   5e-42   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    165   6e-42   
emb|CDY24252.1|  BnaC03g42250D                                          152   7e-42   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   7e-42   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   9e-42   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   
ref|XP_002867814.1|  mate efflux family protein                         159   1e-41   
gb|AAM98160.1|  unknown protein                                         159   1e-41   
emb|CDY33129.1|  BnaCnng07000D                                          159   1e-41   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   
emb|CDY33131.1|  BnaCnng07020D                                          150   3e-41   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   3e-41   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   4e-41   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             157   5e-41   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     157   5e-41   
emb|CDY38631.1|  BnaA05g19560D                                          157   7e-41   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             157   9e-41   
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   9e-41   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    156   1e-40   
ref|XP_002518493.1|  multidrug resistance pump, putative                156   1e-40   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       156   2e-40   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       155   3e-40   
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   4e-40   
emb|CDM85992.1|  unnamed protein product                                154   5e-40   
gb|AGT17223.1|  MATE efflux family protein                              154   6e-40   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      154   7e-40   
emb|CAN69304.1|  hypothetical protein VITISV_021604                     156   1e-39   
emb|CDX92916.1|  BnaA03g36380D                                          153   2e-39   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             152   2e-39   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-39   
emb|CDP20703.1|  unnamed protein product                                151   4e-39   
gb|ADE77677.1|  unknown                                                 152   5e-39   
gb|ABF97220.1|  MATE efflux family protein, expressed                   151   5e-39   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   6e-39   
gb|EEE67272.1|  hypothetical protein OsJ_24453                          150   6e-39   
emb|CDY39493.1|  BnaA01g24950D                                          151   6e-39   
dbj|BAJ90668.1|  predicted protein                                      151   7e-39   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   8e-39   
ref|NP_001059785.1|  Os07g0516600                                       151   9e-39   
gb|EEC82143.1|  hypothetical protein OsI_26198                          150   1e-38   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    150   2e-38   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   3e-38   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         152   3e-38   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   4e-38   
gb|AAS01962.1|  putative MATE efflux family protein                     149   6e-38   
emb|CDP04391.1|  unnamed protein product                                149   8e-38   
emb|CDX94064.1|  BnaC07g36980D                                          147   1e-37   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-37   
emb|CDY65669.1|  BnaCnng48120D                                          148   1e-37   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            148   1e-37   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   3e-37   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                146   4e-37   
gb|ABK24492.1|  unknown                                                 146   5e-37   
gb|EPS59093.1|  hypothetical protein M569_15717                         139   6e-37   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   6e-37   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                145   7e-37   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       145   9e-37   
gb|ABF97208.1|  MATE efflux family protein, expressed                   142   2e-36   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                144   2e-36   
ref|NP_001050521.1|  Os03g0571700                                       142   2e-36   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          143   2e-36   
gb|EPS67796.1|  hypothetical protein M569_06975                         144   3e-36   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          144   4e-36   
ref|NP_001190792.1|  mate efflux domain-containing protein              143   5e-36   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             142   1e-35   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   1e-35   
ref|NP_001190793.1|  MATE efflux family protein                         142   2e-35   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   2e-35   
gb|AGT17222.1|  MATE efflux family protein                              141   3e-35   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   6e-35   
emb|CDY19296.1|  BnaC01g31840D                                          134   7e-35   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            141   9e-35   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            140   2e-34   
emb|CAA17157.1|  putative protein                                       141   3e-34   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    128   1e-32   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    132   3e-32   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    132   3e-32   
emb|CBI28940.3|  unnamed protein product                                124   3e-32   
gb|EEC68782.1|  hypothetical protein OsI_37323                          125   1e-31   
ref|NP_001065641.2|  Os11g0129000                                       124   3e-31   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               128   1e-30   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   4e-30   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    126   4e-30   
ref|NP_001066047.1|  Os12g0126000                                       126   5e-30   
gb|EEC68785.1|  hypothetical protein OsI_37326                          126   5e-30   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            125   1e-29   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          124   2e-29   
ref|NP_001176768.1|  Os12g0125800                                       121   3e-29   
ref|NP_001176328.1|  Os11g0128900                                       123   3e-29   
gb|EEC68781.1|  hypothetical protein OsI_37322                          124   4e-29   
gb|ABA91295.1|  MATE efflux family protein, expressed                   122   1e-28   
ref|NP_001141051.1|  putative MATE efflux family protein                122   1e-28   
ref|NP_001065623.1|  Os11g0126100                                       121   2e-28   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-28   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg             117   3e-28   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   4e-28   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   5e-28   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg             116   7e-28   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   8e-28   
gb|KEH39009.1|  MATE efflux family protein                              119   1e-27   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   2e-27   
emb|CBI31189.3|  unnamed protein product                                119   2e-27   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     115   3e-27   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   3e-27   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          118   3e-27   
gb|EEC73528.1|  hypothetical protein OsI_07920                          118   3e-27   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            117   5e-27   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          118   5e-27   
emb|CDY01227.1|  BnaC05g25050D                                          112   6e-27   
ref|XP_007051759.1|  MATE efflux family protein                         117   7e-27   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   7e-27   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          117   7e-27   
emb|CAN63841.1|  hypothetical protein VITISV_021179                     116   9e-27   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   1e-26   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                          117   1e-26   
dbj|BAJ90744.1|  predicted protein                                      117   1e-26   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   1e-26   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            116   2e-26   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   2e-26   
gb|ABR16195.1|  unknown                                                 116   2e-26   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            117   2e-26   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    115   2e-26   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   3e-26   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
gb|KCW66477.1|  hypothetical protein EUGRSUZ_F00278                     115   3e-26   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   115   3e-26   
gb|ACG27773.1|  transparent testa 12 protein                            115   3e-26   
ref|XP_007161849.1|  hypothetical protein PHAVU_001G103200g             115   4e-26   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130          115   4e-26   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     115   4e-26   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   4e-26   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   5e-26   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            115   5e-26   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    114   6e-26   
ref|XP_002530955.1|  multidrug resistance pump, putative                114   7e-26   
gb|AFW55870.1|  putative MATE efflux family protein                     114   8e-26   
gb|ACF87410.1|  unknown                                                 114   8e-26   
ref|XP_006491465.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   8e-26   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   8e-26   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                            114   9e-26   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   9e-26   
ref|XP_009123743.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   1e-25   
emb|CBI31190.3|  unnamed protein product                                114   1e-25   
emb|CAN73356.1|  hypothetical protein VITISV_040100                     112   1e-25   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    114   1e-25   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   1e-25   
ref|XP_002891027.1|  mate efflux family protein                         114   1e-25   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              114   1e-25   
ref|NP_001130797.1|  putative MATE efflux family protein                114   1e-25   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          113   2e-25   
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    113   2e-25   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340          113   2e-25   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
dbj|BAJ95959.1|  predicted protein                                      113   2e-25   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                    113   3e-25   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
ref|XP_010528775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   4e-25   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   4e-25   
emb|CDY01224.1|  BnaC05g25080D                                          111   4e-25   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   4e-25   
ref|XP_009123740.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    111   5e-25   
ref|XP_009123739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    111   5e-25   
ref|XP_006445000.1|  hypothetical protein CICLE_v10018703mg             114   5e-25   
ref|XP_006827534.1|  hypothetical protein AMTR_s00009p00209720          108   6e-25   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein              112   7e-25   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               112   7e-25   
emb|CDX78379.1|  BnaA03g02910D                                          111   8e-25   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   8e-25   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   8e-25   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     110   8e-25   
ref|XP_009131157.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   8e-25   
emb|CAN78105.1|  hypothetical protein VITISV_014413                     107   9e-25   
ref|XP_009123741.1|  PREDICTED: protein TRANSPARENT TESTA 12            111   9e-25   
ref|XP_007029906.1|  MATE efflux family protein                         111   9e-25   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450          107   9e-25   
gb|AAN64140.1|  Putative ripening regulated protein                     110   9e-25   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                            112   9e-25   
ref|XP_006307307.1|  hypothetical protein CARUB_v10008925mg             111   1e-24   
ref|XP_009111491.1|  PREDICTED: protein TRANSPARENT TESTA 12            112   1e-24   
emb|CDY68535.1|  BnaCnng59430D                                          107   1e-24   
gb|AAZ66942.1|  117M18_23                                               111   1e-24   
ref|XP_006484862.1|  PREDICTED: uncharacterized protein LOC102631182    110   1e-24   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g             111   1e-24   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     111   1e-24   
emb|CDX81176.1|  BnaC03g04300D                                          111   1e-24   
ref|NP_174584.2|  MATE efflux family protein                            111   1e-24   
gb|AAO42212.1|  unknown protein                                         111   1e-24   
ref|NP_567173.3|  MATE efflux family protein                            111   1e-24   
ref|XP_006349556.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             110   2e-24   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
gb|KJB31143.1|  hypothetical protein B456_005G178900                    110   2e-24   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290          110   2e-24   
gb|EEC74654.1|  hypothetical protein OsI_10313                          110   2e-24   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          110   2e-24   
emb|CDY08799.1|  BnaA06g24250D                                          106   2e-24   
ref|XP_006415125.1|  hypothetical protein EUTSA_v10009778mg             110   2e-24   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    110   2e-24   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            110   2e-24   
emb|CBI22675.3|  unnamed protein product                                109   2e-24   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
gb|KJB31160.1|  hypothetical protein B456_005G179100                    111   2e-24   
gb|KEH25522.1|  MATE efflux family protein                              110   2e-24   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            109   2e-24   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
ref|XP_007153779.1|  hypothetical protein PHAVU_003G064300g             110   3e-24   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             110   3e-24   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
emb|CDP13215.1|  unnamed protein product                                110   3e-24   



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   193 bits (490),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  29   ISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQ  88

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KE
Sbjct  89   TFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKE  148

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL++W+ K++PLL
Sbjct  149  VQEALKRLDRWEDKKKPLL  167



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVIAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQ
Sbjct  372  LSVIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQ  431

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVN+GCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KE
Sbjct  432  TFVAYVNIGCYYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKE  491

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL +WD K+E +L +
Sbjct  492  VEAAQSRLKKWDDKKESILEE  512



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  381  ISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KE
Sbjct  441  TFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKE  500

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL++W+ K++PLL
Sbjct  501  VQEALKRLDRWEDKKKPLL  519



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA+ V+ALR VISY FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ
Sbjct  55   ISVMAALAVMALRDVISYAFTGGETVAKAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  114

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT+ILLWVTIRTDW KE
Sbjct  115  AFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVILLWVTIRTDWNKE  174

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL  W+ K EPL+
Sbjct  175  VQEALKRLETWEGKEEPLV  193



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAA+VVLALR VISY FT GE VA AVSDLCPLLAL+LVLNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVIAALVVLALRDVISYAFTGGEEVAAAVSDLCPLLALSLVLNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIILLWVT RTDW KE
Sbjct  425  AFVAYVNVGCYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIILLWVTFRTDWTKE  484

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRL +W+ K+EPLL
Sbjct  485  VEEAAKRLTKWEDKKEPLL  503



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAA++VLALR VISYVFT+GEVVA AVSDLCPLL+L+LVLNG+QPVLSGVAVGCGWQ
Sbjct  367  ISVIAALIVLALRDVISYVFTEGEVVAAAVSDLCPLLSLSLVLNGIQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL+WVT RTDW KE
Sbjct  427  AFVAYVNVGCYYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIILMWVTFRTDWNKE  486

Query  364  VEVAKKRLNQW-DAKREPLL  308
            V+ A KRLN+W + K+EPLL
Sbjct  487  VKEAAKRLNKWEEKKKEPLL  506



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVIAAI+VLALR V+SY FT+GEVVADAVSDL PLLALTLVLNG+QPVLSGVAVGCGWQ
Sbjct  360  VSVIAAIIVLALRRVMSYAFTEGEVVADAVSDLAPLLALTLVLNGIQPVLSGVAVGCGWQ  419

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G++LGFYF LGAKG+W GM+GGT MQTIILLWVTIRTDW KE
Sbjct  420  AFVAYVNVGCYYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIILLWVTIRTDWNKE  479

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VEVA KRL++W D K+E LL
Sbjct  480  VEVALKRLDKWEDQKKEALL  499



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS IAA++VLALR VISYVFT+GE VA AVSDLCPLL+L+++LNG+QPVLSGVAVGCGWQ
Sbjct  367  ISAIAALIVLALRDVISYVFTEGETVAAAVSDLCPLLSLSILLNGIQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL+WVT RTDW KE
Sbjct  427  AFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIILIWVTFRTDWNKE  486

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE + KRLN+WD K+EPLL
Sbjct  487  VEESAKRLNKWDDKKEPLL  505



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VIAAI VL LRHVISY FT GE VA+AVSDLCPLL++TL+LNGVQPVLSGVAVGCGWQ
Sbjct  372  IAVIAAITVLELRHVISYAFTSGEAVANAVSDLCPLLSITLILNGVQPVLSGVAVGCGWQ  431

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+ILLWVT RT+W KE
Sbjct  432  AFVAYVNVGCYYILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLILLWVTYRTNWNKE  491

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRLN+W+ K EPLL
Sbjct  492  VEEATKRLNKWEDKPEPLL  510



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVIAAI+VL  R V+SY FT GEVVA+AVSDLCPLLALTL LNG+QPVLSGVAVGCGWQT
Sbjct  364  SVIAAILVLTFRDVLSYAFTGGEVVAEAVSDLCPLLALTLALNGIQPVLSGVAVGCGWQT  423

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL+W+TIRTDW KEV
Sbjct  424  FVAYVNVGCYYIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVILIWITIRTDWNKEV  483

Query  361  EVAKKRLNQWDAKREPLLPK  302
            E A+ RLN+W  K+EP L +
Sbjct  484  EAAQGRLNKWGDKKEPELKE  503



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I AIV+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  353  ISTILAIVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQ  412

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVT+RTDW KE
Sbjct  413  QFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTMRTDWTKE  472

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K+EPLL
Sbjct  473  VEEAQKRLNKWDEKKEPLL  491



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA+ V+ALR VISY FTDGE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ
Sbjct  262  ISVMAALTVMALRDVISYAFTDGETVAQAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  321

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T+ILLWVT RTDW KE
Sbjct  322  GFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVILLWVTCRTDWNKE  381

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL  W+ K+EPL+
Sbjct  382  VQEALKRLETWEGKKEPLV  400



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S+IAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQ
Sbjct  372  LSMIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQ  431

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KE
Sbjct  432  AFVAYVNIGCYYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKE  491

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL  WD K+E +L +
Sbjct  492  VESAQSRLKMWDDKKESILEE  512



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            + LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVG
Sbjct  266  MVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVG  325

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++
Sbjct  326  CYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMD  385

Query  337  QWDAKREPLL  308
             W+ K EPLL
Sbjct  386  AWEVKEEPLL  395



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAA++VL LR  ISY FT+GE VA AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  381  ISVIAAVIVLCLRDYISYAFTEGETVARAVSDLCPLLAITLILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL+WVT RTDW KE
Sbjct  441  AFVAYVNVGCYYIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLILMWVTFRTDWNKE  500

Query  364  VEVAKKRLNQWDAKR-EPLL  308
            VE AKKRLN+WD K+ EPLL
Sbjct  501  VEEAKKRLNKWDGKKEEPLL  520



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  355  ISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQ  414

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KE
Sbjct  415  QFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWSKE  474

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K++PLL
Sbjct  475  VEEAQKRLNKWDEKKQPLL  493



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVIAA++VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQ
Sbjct  373  LSVIAAVIVLALRNLISYAFTGGEVVAQAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KE
Sbjct  433  TFVAYVNVGCYYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL +WD K+E +L +
Sbjct  493  VESAQYRLKKWDDKKESILEE  513



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  257  ISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KE
Sbjct  317  QFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKE  376

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+W  K+EPLL
Sbjct  377  VEEAQKRLNKWSEKKEPLL  395



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AAI+VL LRHVISY FTDGE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  373  ISVVAAIIVLLLRHVISYAFTDGERVANAVSDLCPLLAITLILNGVQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT+W KE
Sbjct  433  AFVAYVNVGCYYVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLILIWVTYRTNWNKE  492

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRL  WD K+EPLL
Sbjct  493  VEEAMKRLETWDEKKEPLL  511



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            + LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVG
Sbjct  375  MVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVG  434

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++
Sbjct  435  CYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMD  494

Query  337  QWDAKREPLL  308
             W+ K EPLL
Sbjct  495  AWEVKEEPLL  504



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ
Sbjct  378  ISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQ  437

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  E
Sbjct  438  TFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNE  497

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRLN+W+ K EPL+
Sbjct  498  VEEAAKRLNKWENKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ
Sbjct  378  ISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQ  437

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  E
Sbjct  438  TFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNE  497

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRLN+W+ K EPL+
Sbjct  498  VEEAAKRLNKWENKTEPLV  516



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  292  ISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQ  351

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT+W +E
Sbjct  352  KFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTNWTEE  411

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K+EPLL
Sbjct  412  VEEAQKRLNKWDEKKEPLL  430



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AAIVVLA+R+VISY FT GEVV++ VSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  320  ISVVAAIVVLAIRNVISYAFTGGEVVSNRVSDLCPLLALTLILNGIQPVLSGVAVGCGWQ  379

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL WVT+RTDW KE
Sbjct  380  AFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIILTWVTLRTDWSKE  439

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A++RLN+W  K+  L
Sbjct  440  VETAQQRLNKWGDKQPAL  457



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL+LR+VISY FT+GEVVA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  31   IAVVEAIIVLSLRNVISYAFTEGEVVAKEVSELCPYLAVTLILNGIQPVLSGVAVGCGWQ  90

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KE
Sbjct  91   TFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIILLWVTFRTDWNKE  150

Query  364  VEVAKKRLNQWD  329
            VE AKKRL++W+
Sbjct  151  VESAKKRLDKWE  162



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FTDG+ V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  424  ISTILAVVILCLRNHISYLFTDGKAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQ  483

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KE
Sbjct  484  QFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKE  543

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K+EPLL
Sbjct  544  VEEAQKRLNKWDEKKEPLL  562



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVIAA+++LALR V+SY FT+GEVVADAVSDL PLLA+T+VLNG+QPVLSGVAVGCGWQ 
Sbjct  293  SVIAAVIILALRRVMSYAFTEGEVVADAVSDLSPLLAVTVVLNGIQPVLSGVAVGCGWQA  352

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIILLWVTIRTDW+KEV
Sbjct  353  FVAYVNVGCYYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIILLWVTIRTDWIKEV  412

Query  361  EVAKKRLNQWDAKRE  317
            E A +RL++W+  ++
Sbjct  413  EAALRRLDKWEVLKD  427



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            LALRHV+SY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVG
Sbjct  374  LALRHVLSYAFTGGEVVAEAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVG  433

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE A+KRL 
Sbjct  434  CYYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLV  493

Query  337  QWDAKREPLL  308
             W+ K+EPLL
Sbjct  494  TWEDKKEPLL  503



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVIAA +VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQ
Sbjct  373  LSVIAAAIVLALRNLISYAFTGGEVVAAAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KE
Sbjct  433  TFVAYVNVGCYYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL +WD K+E +L +
Sbjct  493  VESAQYRLKKWDDKKEAILEE  513



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAA+ VL  R VISY FT+GEVVA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVIAAVAVLVFRDVISYAFTEGEVVATAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL+WVT RTDW KE
Sbjct  428  AFVAYVNVGCYYGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVILIWVTFRTDWNKE  487

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRL+ W+ K+EP+L
Sbjct  488  VEEAAKRLSIWEDKKEPVL  506



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQ
Sbjct  372  ISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQ  431

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KE
Sbjct  432  TFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKE  491

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE + KRLN+W+ + E L+ +
Sbjct  492  VEESNKRLNKWEDRTETLIKE  512



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  257  ISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KE
Sbjct  317  QFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKE  376

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A KRLN+W D K++PLL
Sbjct  377  VEEAHKRLNKWDDTKKQPLL  396



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  50   VILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  109

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  110  VAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVE  169

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  K++ L+ +
Sbjct  170  EASKRMDKWSDKKQELVRE  188



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A++V+ALRHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  372  IAVLEAVIVMALRHVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQ  431

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL+WVT RTDW KE
Sbjct  432  AFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLILIWVTYRTDWNKE  491

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK RL++W+ K++PLL
Sbjct  492  VEKAKGRLDKWEDKKKPLL  510



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+VVLA+R VISY FTDGE VA AVSDLCPLLAL+++LNG+QPVLSGVAVGCGWQ
Sbjct  377  ISVIVALVVLAIRDVISYAFTDGEEVAAAVSDLCPLLALSIILNGIQPVLSGVAVGCGWQ  436

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT  TDW KE
Sbjct  437  TFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFGTDWNKE  496

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRLN+W+ K EPL+
Sbjct  497  VEEAAKRLNKWEDKTEPLV  515



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS + A++VLALR VISY FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ
Sbjct  370  ISFLCAVIVLALRSVISYTFTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQ  429

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  430  AFVAYVNVGCYYVVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKE  489

Query  364  VEVAKKRLNQWDAKRE  317
            VE + KRLN+WD K+E
Sbjct  490  VEESMKRLNKWDDKQE  505



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQ
Sbjct  370  ISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQ  429

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KE
Sbjct  430  TFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKE  489

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE + KRLN+W+ + E L+ +
Sbjct  490  VEESNKRLNKWEDRTETLIKE  510



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  257  ISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KE
Sbjct  317  QFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKE  376

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A KRLN+W D K++PLL
Sbjct  377  VEEAHKRLNKWDDTKKQPLL  396



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  388  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  447

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  448  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  507

Query  328  AKREPLL  308
             K+EPLL
Sbjct  508  DKKEPLL  514



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  257  ISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KE
Sbjct  317  QFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKE  376

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A KRLN+W D K++PLL
Sbjct  377  VEEAHKRLNKWDDTKKQPLL  396



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  387  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  446

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  447  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  506

Query  328  AKREPLL  308
             K+EPLL
Sbjct  507  DKKEPLL  513



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ
Sbjct  257  ISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KE
Sbjct  317  QFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKE  376

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRL++W+  +EPLL
Sbjct  377  VEEAQKRLSKWEGSKEPLL  395



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            + LR VISY FT+GEVVA+AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVG
Sbjct  375  MVLRDVISYAFTEGEVVAEAVSDLCPLLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVG  434

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++
Sbjct  435  CYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMD  494

Query  337  QWDAKR-EPLL  308
             W  K+ EPLL
Sbjct  495  AWQVKKEEPLL  505



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FT+GE V+DAV+DL PLLA+TLVL G+QPVL+GVAVGCGWQ
Sbjct  353  ISTILAVVILCLRNHISYLFTNGEAVSDAVADLSPLLAITLVLGGIQPVLTGVAVGCGWQ  412

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KE
Sbjct  413  QFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTDWTKE  472

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K++PLL
Sbjct  473  VEEAQKRLNKWDEKKQPLL  491



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S I A V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  354  VSAILAAVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  413

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY++GVP+G +LGF FNLG KGIW GM+GGT MQT IL+WVT+RTDW KE
Sbjct  414  QFVAYVNIGCYYIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAILVWVTLRTDWKKE  473

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD K+EPLL
Sbjct  474  VEEAQKRLNKWDDKKEPLL  492



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQT
Sbjct  367  SVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQT  426

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEV
Sbjct  427  FVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEV  486

Query  361  EVAKKRLNQWDAKREPLLPK  302
            E A KRL++W  K++ ++P+
Sbjct  487  EEASKRLDKWSNKKQEVVPE  506



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQT
Sbjct  258  SVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQT  317

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEV
Sbjct  318  FVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEV  377

Query  361  EVAKKRLNQWDAKR  320
            E A KRL+ W  K+
Sbjct  378  EEASKRLDIWSNKK  391



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AIVVL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  359  IAVVEAIVVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  418

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T RTDW KE
Sbjct  419  AFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRTDWNKE  478

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE AK+RL++W+  +EPL  K
Sbjct  479  VEKAKERLDKWENVKEPLSKK  499



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ
Sbjct  349  ISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQ  408

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KE
Sbjct  409  QFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKE  468

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRL++W+  +EPLL
Sbjct  469  VEEAQKRLSKWEGSKEPLL  487



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++VI A+V+L LR  +SY+FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  380  LTVIIAVVILCLRDYLSYIFTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQ  439

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNV CYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KE
Sbjct  440  AFVAYVNVACYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKE  499

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRLN+W+ K++PLL
Sbjct  500  VEQAIKRLNKWEGKKQPLL  518



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ
Sbjct  80   IAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQ  139

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KE
Sbjct  140  AFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKE  199

Query  364  VEVAKKRLNQW-DAKREPLL  308
            V  AK+RL++W D + EPLL
Sbjct  200  VGKAKQRLDKWEDKEDEPLL  219



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQT
Sbjct  366  SVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQT  425

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEV
Sbjct  426  FVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEV  485

Query  361  EVAKKRLNQWDAKR  320
            E A KRL+ W  K+
Sbjct  486  EEASKRLDIWSNKK  499



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  368  VILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  427

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  428  VAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVE  487

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL++W  K++ ++P+
Sbjct  488  EASKRLDKWSNKKQEVVPE  506



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  359  IAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQ  418

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KE
Sbjct  419  AFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKE  478

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE+A++RL++W+ K++PL 
Sbjct  479  VEIARRRLDRWEDKKQPLF  497



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  378  IAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQ  437

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KE
Sbjct  438  AFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKE  497

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE+A++RL++W+ K++PL 
Sbjct  498  VEIARRRLDRWEDKKQPLF  516



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVLALRHVISYVFT+GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  363  IAVIEAIVVLALRHVISYVFTEGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+NVGCYY VGVPVG VLGF FNLG KGIW GMIGGTV+QT+ILLW+T RTDW+KE
Sbjct  423  AIVAYINVGCYYGVGVPVGCVLGFKFNLGVKGIWSGMIGGTVLQTLILLWITFRTDWIKE  482

Query  364  VEVAKKRLNQWD  329
            V  AKKRL++W+
Sbjct  483  VNTAKKRLDKWE  494



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  368  VILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  427

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  428  VAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVE  487

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL++W  K++ ++P+
Sbjct  488  EASKRLDKWSNKKQEVVPE  506



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+V+LALR V+SY+FT+G+ VA AVSDLCPLLALTLVLNG+QPVLSG+AVGCGWQ
Sbjct  364  ISVILAVVILALRDVVSYLFTEGKDVAAAVSDLCPLLALTLVLNGIQPVLSGMAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVA VNVGCYY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL WVT  TDW KE
Sbjct  424  TFVAKVNVGCYYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIILAWVTFSTDWNKE  483

Query  364  VEVAKKRLNQWDAKREPL  311
            V++A KRL+QW  ++EPL
Sbjct  484  VDLATKRLDQWSDRKEPL  501



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  360  IAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQ  419

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW KE
Sbjct  420  AFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKE  479

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AKKRL++W+  + PL
Sbjct  480  VECAKKRLDKWENLKGPL  497



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L LR  ISY FTDGEVVA AVSDLCPLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVG
Sbjct  356  LCLRDYISYAFTDGEVVARAVSDLCPLLATTLILNGIQPVLSGVAVGCGWQAFVAYVNVG  415

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVP G++LGF F LGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE AKKRLN
Sbjct  416  CYYIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLN  475

Query  337  QWDAKREPLL  308
            +W+ K+EPLL
Sbjct  476  KWEDKKEPLL  485



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  368  VILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  427

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  428  VAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVE  487

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  K++ ++P+
Sbjct  488  EASKRMDKWSNKKQEVVPE  506



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A+V L  R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  257  ITVVMAVVFLMFRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KE
Sbjct  317  KIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKE  376

Query  364  VEVAKKRLNQWDAKREPLLPKT  299
            VE AKKRLNQW+ K++PLL  T
Sbjct  377  VEEAKKRLNQWEDKKQPLLAGT  398



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  378  IAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQ  437

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+ILLWVT  TDW KE
Sbjct  438  AFVAYVNVGCYYVVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKE  497

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE+A++RL++W+ K++PLL  
Sbjct  498  VEIARRRLDRWEDKKQPLLKN  518



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  294  IAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  353

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KE
Sbjct  354  AFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKE  413

Query  364  VEVAKKRLNQWDAKR-EPLL  308
            VE AK+RL++W+ K  +PLL
Sbjct  414  VEKAKQRLDKWEDKEDQPLL  433



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V+ AIVVL+ RHVISY+FT GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  376  VAVVEAIVVLSQRHVISYIFTGGETVANAVSDLCPFLAVTLLLNGLQPVLSGVAVGCGWQ  435

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             +VAYVN+GCYYVVG+P+G +LGF FNLG KGIW GMIGGT MQT+ILLWVT RTDW KE
Sbjct  436  AYVAYVNIGCYYVVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLILLWVTFRTDWNKE  495

Query  364  VEVAKKRLNQWDAKREPLLPKT*KRSIHEAK  272
            VE A KRL  WD  +EPLL     + + E K
Sbjct  496  VEKAGKRLAMWDDIKEPLLKY--HKEVEEIK  524



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  349  IAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSGVAVGCGWQ  408

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KE
Sbjct  409  QFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKE  468

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A+KRLN+W D K+EPLL
Sbjct  469  VEEAQKRLNKWDDTKKEPLL  488



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V  A+V L  R  ISY+FTDGE V+ AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  354  ITVAMAVVFLIFRDYISYIFTDGETVSRAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQ  413

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+NVGCYY VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KE
Sbjct  414  KTVAYINVGCYYFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLILFWITFRTDWNKE  473

Query  364  VEVAKKRLNQWDAKREPLLPKT  299
            VE AKKRLNQWD K++PLL  T
Sbjct  474  VEQAKKRLNQWDDKKQPLLAST  495



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  125  ISVVAAAVVXVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQ  184

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KE
Sbjct  185  AFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKE  244

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK+R  +WD K++PLL
Sbjct  245  VEKAKERXEKWDDKKQPLL  263



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I++I +IV+L LR+ +SY+FT+GEVV++AV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  353  ITIILSIVILCLRNYVSYLFTEGEVVSNAVADLCPLLAITIILNGIQPVLSGVAVGCGWQ  412

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVGVP+GA+LGF F LG KGIW GMIGGTVMQT ILLWVT+RTDW KE
Sbjct  413  QFVAYVNIGCYYVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAILLWVTLRTDWSKE  472

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A+KRLN+W D K EPLL
Sbjct  473  VEEAQKRLNKWEDKKTEPLL  492



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  257  IAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAITLILNGVQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KE
Sbjct  317  AFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKE  376

Query  364  VEVAKKRLNQW-DAKREPLL  308
            V  AK+RL++W D + EPLL
Sbjct  377  VGKAKQRLDKWEDXEDEPLL  396



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            RHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  394  RHVISYVFTEGETVAEAVSELCPFLAVTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  453

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            VVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+
Sbjct  454  VVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWE  513

Query  328  AKREPLL  308
             KRE LL
Sbjct  514  DKRETLL  520



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  360  IAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQ  419

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW K+
Sbjct  420  AFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKK  479

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AKKRL++W+  + PL
Sbjct  480  VECAKKRLDKWENLKGPL  497



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R ++SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  368  VILAIVILACRDILSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  427

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL WVT RTDW KEVE
Sbjct  428  VAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFILAWVTFRTDWTKEVE  487

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  K++ ++P+
Sbjct  488  EASKRMDKWSNKKQEVVPE  506



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  300  VILAIVILASRDVLSYLFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  359

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  360  VAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWNKEVE  419

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  +++ ++P+
Sbjct  420  EASKRMDKWSNQKQEVVPE  438



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++I A+V+L+LR VISY FT GE VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  383  VAIIEAMVILSLRDVISYAFTSGETVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  442

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL+W T +TDW+KE
Sbjct  443  AFVAYVNVGCYYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAILIWTTYQTDWIKE  502

Query  364  VEVAKKRLNQWDAKREPLLPKT  299
            VE AKKRL++WD   +PLL  +
Sbjct  503  VEKAKKRLDKWDDINQPLLKAS  524



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  368  IAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KE
Sbjct  428  AFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKE  487

Query  364  VEVAKKRLNQWDAKR-EPLL  308
            VE AK+RL++W+ K  +PLL
Sbjct  488  VEKAKQRLDKWEDKEDQPLL  507



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A+V L  R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  356  ITVVMAVVFLMFRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQ  415

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KE
Sbjct  416  KIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKE  475

Query  364  VEVAKKRLNQWDAKREPLLPKT  299
            VE AKKRLNQW+ K++PLL  T
Sbjct  476  VEEAKKRLNQWEDKKQPLLAGT  497



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A+V L  R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  356  ITVVMAVVFLMFRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQ  415

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KE
Sbjct  416  KIVAYINVGCYYFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKE  475

Query  364  VEVAKKRLNQWDAKREPLLPKT  299
            VE AKKRLNQW+ K++PLL  T
Sbjct  476  VEEAKKRLNQWEDKKQPLLAGT  497



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ VADAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  369  VILAIVILACRDVLSYAFTEGKEVADAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  428

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE
Sbjct  429  VAKVNVGCYYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVE  488

Query  358  VAKKRLNQWDAKRE  317
             A KRL++W  K++
Sbjct  489  EASKRLDKWSNKKQ  502



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  379  VILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  438

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VN+GCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E
Sbjct  439  VAKVNIGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEEE  498

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  K++ ++P+
Sbjct  499  EASKRMDKWSNKKQEVVPE  517



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ A+++L LR  +SY FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  380  ISVVTAVIILCLRDYLSYTFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQ  439

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  440  AFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILIWVTFRTDWNKE  499

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRLN+W+ K++PLL
Sbjct  500  VDEAIKRLNKWEDKKQPLL  518



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  +++VLA R+VI Y FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ
Sbjct  356  ISVFCSVIVLAFRNVIGYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQ  415

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KE
Sbjct  416  AFVAYVNIGCYYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKE  475

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE + KRLN+WD K+E  L
Sbjct  476  VEESMKRLNKWDVKQESTL  494



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS IAA+VVL LR VISYVFT+GE VA AVSDLCPLL+L+L+LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISAIAALVVLVLRDVISYVFTEGEAVAAAVSDLCPLLSLSLLLNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL+WVT RTDW KE
Sbjct  423  AFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVILMWVTFRTDWNKE  482

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRLN+W+ K+EPLL
Sbjct  483  VQEADKRLNKWEDKKEPLL  501



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  367  ISVVAAAVVFVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KE
Sbjct  427  AFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKE  486

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK+RL +WD K++PLL
Sbjct  487  VEKAKERLEKWDDKKQPLL  505



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  375  ISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQ  434

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE
Sbjct  435  ASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKE  494

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK RL++W+ KR+P L
Sbjct  495  VEKAKSRLHKWEDKRKPSL  513



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI A+V+L +R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  381  IAVIIAVVILCIRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNV CYY+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL+WVT RTDW KE
Sbjct  441  AFVAYVNVACYYIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLILIWVTFRTDWNKE  500

Query  364  VEVAKKRLNQWDAKREPLL  308
            V  A KRLN+W+ K++PLL
Sbjct  501  VNEAIKRLNKWEDKKKPLL  519



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL LR+VISY FT+GE VA+AVSDLCP LA+TL+L+GVQP+ SGVAVGCGWQ
Sbjct  364  IAVVEAIIVLCLRNVISYAFTEGETVANAVSDLCPFLAVTLILSGVQPIFSGVAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGC Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KE
Sbjct  424  AFVAYVNVGCNYAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKE  483

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+ RL++W   +EPL
Sbjct  484  VEKARTRLDKWGNVKEPL  501



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+AA++VL+LR  ISY+FT+GE VA AVSDLCPLLA ++VLNG+QPVLSGVAVGCGWQ
Sbjct  385  VSVMAAMIVLSLRDYISYIFTEGETVARAVSDLCPLLAASIVLNGIQPVLSGVAVGCGWQ  444

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP G +LGF F LG KGIWCG+I GTV QT+ILL VT RTDW KE
Sbjct  445  AFVAYVNVGCYYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLILLVVTFRTDWNKE  504

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AKKRL++W+ K EPLL
Sbjct  505  VEEAKKRLDKWEEKEEPLL  523



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  154  LSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  213

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KE
Sbjct  214  AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKE  273

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  274  VEKASSRLDQWEESREPLLKQ  294



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++   A +VL+ RH+ISY+FT GE VA AV+DLCPLLA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  369  VAAAEAGIVLSQRHIISYIFTGGETVAKAVADLCPLLAVTLLLNGVQPVLSGVAVGCGWQ  428

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            +FVA +NVGCYY+VG+P+G +LGF FNLG KGIW GMIGGT+MQT+ILLWVT RTDW KE
Sbjct  429  SFVACINVGCYYMVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLILLWVTFRTDWNKE  488

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+KRL++W+   EPLL +
Sbjct  489  VEKARKRLDKWEEITEPLLKE  509



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -2

Query  700  VLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnv  521
            +LALRHVISY FT+GE VADAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNV
Sbjct  372  LLALRHVISYAFTEGEYVADAVSDLCPLLAITVVLNGIQPVLSGVAVGCGWQVFVAYVNV  431

Query  520  gcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  341
            GCYY VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIILLWV  RTDW +EVE A KRL
Sbjct  432  GCYYFVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRL  491

Query  340  NQWDAKRE  317
            N+W+ K +
Sbjct  492  NKWEDKHK  499



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ +IV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  356  ISVMLSIVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  415

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT ILLWVT+RTDW KE
Sbjct  416  QFVAYVNIGCYYIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAILLWVTLRTDWNKE  475

Query  364  VEVAKKRLNQWDAKR--EPLL  308
            VE A+KRL++W+ K+  EPLL
Sbjct  476  VEEAQKRLHKWEDKKTTEPLL  496



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  306  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  365

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  366  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  425

Query  328  AKREPLL  308
             K++PLL
Sbjct  426  DKKQPLL  432



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQT+
Sbjct  368  VILAIVILACRDVLSYLFTEGKEVSDAVSDLCPLLAVTIVLNGIQPVLSGVAVGCGWQTY  427

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VN+GCYYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E
Sbjct  428  VAKVNIGCYYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWSKEAE  487

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KR+++W  +++ ++P+
Sbjct  488  EASKRMDKWSNQKQEVVPE  506



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  354  ISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  413

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  E
Sbjct  414  QFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNE  473

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A+KRLN+W D K+EPLL
Sbjct  474  VEEAQKRLNKWEDKKKEPLL  493



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  354  ISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  413

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  E
Sbjct  414  QFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNE  473

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE A+KRLN+W D K+EPLL
Sbjct  474  VEEAQKRLNKWEDKKKEPLL  493



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL+LR+VISY FT+GEVVA  VS LCP LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  360  IAVVEAIIVLSLRNVISYAFTEGEVVAKEVSSLCPYLAVTLILNGIQPVLSGVAVGCGWQ  419

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIILLWVT  TDW KE
Sbjct  420  AFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKE  479

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL++W+  + PL
Sbjct  480  VESARKRLDKWENLKGPL  497



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A++V+  R VISY+FTDGE VA AVSDLCPLLALTLVLNGVQPVL+GVAVGCGWQ
Sbjct  374  ISIICALLVIIFRDVISYIFTDGEAVAAAVSDLCPLLALTLVLNGVQPVLTGVAVGCGWQ  433

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KE
Sbjct  434  AFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVILVWVTWRTDWNKE  493

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL++WD   +P++
Sbjct  494  VDEAIKRLSKWDDTAKPVV  512



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I  I A+VVLALR VISYVFT+GE VA AVSDL PLLAL +VLNGVQPVLSGVAVGCGWQ
Sbjct  379  ICAIIALVVLALRDVISYVFTEGEEVAAAVSDLSPLLALAIVLNGVQPVLSGVAVGCGWQ  438

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL+WVT RTDW  E
Sbjct  439  TFVAYVNVGCYYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIILMWVTFRTDWNNE  498

Query  364  VEVAKKRLNQWDAKREPLL  308
            V  + KRLN+W+ K E LL
Sbjct  499  VVESNKRLNKWEGKTESLL  517



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLA++L+LNGVQPVLSGVAVGCGWQ
Sbjct  359  ISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLAISLILNGVQPVLSGVAVGCGWQ  418

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KE
Sbjct  419  AFVAYVNVGCYYVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKE  478

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE AK RLN W +  ++PL 
Sbjct  479  VEQAKSRLNMWQNNSKKPLF  498



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ
Sbjct  367  IAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KE
Sbjct  427  AFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKE  486

Query  364  VEVAKKRLNQWDAKR-EPLL  308
            V  AK+RL++W+ K  EPLL
Sbjct  487  VGKAKQRLDKWEDKEDEPLL  506



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++AAI+VL  R  ISY FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  380  ISIVAAIIVLIWRDTISYAFTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQ  439

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KE
Sbjct  440  AFVAYVNVGCYYLVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKE  499

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A KRLN+W   +EPL
Sbjct  500  VEEAAKRLNKWGKVKEPL  517



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 125/141 (89%), Gaps = 2/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++ AIV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ
Sbjct  346  ISLVLAIVILCLRNYISYIFTEGEVVSNAVADLCPLLAITLVLNGIQPVLSGVAVGCGWQ  405

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT IL+W T+RTDW KE
Sbjct  406  EFVAYVNVGCYYIVGVPLGAILGFVFKLGVKGIWSGMIGGTFMQTAILVWATLRTDWNKE  465

Query  364  VEVAKKRLNQW-DAK-REPLL  308
            VE A+KRLN+W D+K  EPLL
Sbjct  466  VEEAQKRLNKWADSKTTEPLL  486



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+VI A+VVL LR+VISY FT+GE VA AVS+L PLLA+ L+LNG+QPVLSGVAVGCGWQ
Sbjct  366  IAVIEAVVVLCLRNVISYAFTEGETVAKAVSELSPLLAVALLLNGIQPVLSGVAVGCGWQ  425

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIILLWVT RTDW+KE
Sbjct  426  AFVAYVNVGCYYLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIILLWVTFRTDWIKE  485

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AK RL++WD  ++ L
Sbjct  486  VEKAKMRLDKWDDDKQTL  503



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  359  IAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  418

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T R DW KE
Sbjct  419  AFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRADWNKE  478

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AKK L++W+  +E L
Sbjct  479  VEKAKKHLDKWENVKETL  496



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  498

Query  328  AKREPLL  308
             K++PLL
Sbjct  499  DKKQPLL  505



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVIAAI+VL  R  ISY+FT+GEVVA A SDL P LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  361  VSVIAAIIVLIFRDSISYIFTEGEVVAKAASDLSPFLAVTLILNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+ILL VT RTDW KE
Sbjct  421  AFVAYVNVGCYYLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLGVTWRTDWNKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE AK RL+ WD K EPLL K
Sbjct  481  VEGAKNRLSTWDDKSEPLLQK  501



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTF
Sbjct  377  VILAIVILACRDVLSYAFTEGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTF  436

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL WVT RTDWVKEVE
Sbjct  437  VAKVNVGCYYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVILAWVTFRTDWVKEVE  496

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL++W  K+  ++P+
Sbjct  497  EASKRLDKWSNKKLEVVPE  515



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AIVVLALR+VISY FT+GE V++AVS L P LA++++LNG+QPVLSGVAVGCGWQ
Sbjct  366  ISVVCAIVVLALRNVISYAFTEGETVSNAVSALSPYLAVSIILNGIQPVLSGVAVGCGWQ  425

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G VLGF F+ GA+GIW GMIGGT +QT+ILLWVT RTDW KE
Sbjct  426  AFVAYVNVGCYYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLILLWVTFRTDWKKE  485

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE  K RL++WD K+EPLL +
Sbjct  486  VENVKNRLDRWDDKKEPLLTE  506



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  367  ISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KE
Sbjct  427  AFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKE  486

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A++RL +WD K++PLL
Sbjct  487  VEKARERLEKWDDKKQPLL  505



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++ AIV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  348  ISIMLAIVILCLRNYISYIFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQ  407

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+GA+LGF F  G KGIW GMIGGT MQT ILLW T+RTDW KE
Sbjct  408  EFVAYVNIGCYYIVGVPLGAILGFVFKFGVKGIWSGMIGGTFMQTAILLWATLRTDWNKE  467

Query  364  VEVAKKRLNQWDAKR----EPLL  308
            VE A+KRL++W+ ++    EPLL
Sbjct  468  VEEAQKRLHKWEDQKTTTTEPLL  490



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I++I A  +L+LRHVISYVFT GE VA+AVS+LCPLLA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  370  IALIEAGAILSLRHVISYVFTGGETVANAVSELCPLLAVTLILNGVQPVLSGVAVGCGWQ  429

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE
Sbjct  430  AFVAYVNVGCYYVVGIPFGCLIGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWKKE  489

Query  364  VEVAKKRLNQWDAKR  320
            VE AK RL++W+ KR
Sbjct  490  VEKAKSRLHKWEDKR  504



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++AAI+VL  R +ISY FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ
Sbjct  379  ISIVAAIIVLIWRDIISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQ  438

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KE
Sbjct  439  AFVAYVNVGCYYLVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKE  498

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A KRLN+W+  +E L
Sbjct  499  VEEAAKRLNKWEEVKEQL  516



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  359  IAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQ  418

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGT+MQT IL+W T R DW KE
Sbjct  419  AFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTIMQTFILIWFTFRADWNKE  478

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AKK L++W+  +E L
Sbjct  479  VEKAKKHLDKWENVKETL  496



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A++V+  R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ
Sbjct  259  ISIICALLVIIFRDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQ  318

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KE
Sbjct  319  AFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKE  378

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRL++WD   +P++
Sbjct  379  VEEAIKRLSKWDDTAKPIV  397



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KE
Sbjct  423  AFVAYVNVGCYYVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKE  482

Query  364  VEVAKKRLNQW--DAKRE  317
            VE AK RLN W  ++K++
Sbjct  483  VEQAKSRLNMWQNNSKKQ  500



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  +++VLALR+VISY FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ
Sbjct  356  ISVFCSVIVLALRNVISYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQ  415

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KE
Sbjct  416  AFVAYVNIGCYYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKE  475

Query  364  VEVAKKRLNQWDAKRE  317
            VE + KRLN+WD K+E
Sbjct  476  VEESMKRLNKWDDKQE  491



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGC  554
            I+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGC
Sbjct  349  IAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGC  408

Query  553  GWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDW  374
            GWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW
Sbjct  409  GWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDW  468

Query  373  VKEVEVAKKRLNQW-DAKREPLL  308
             KEVE A+KRLN+W D K+EPLL
Sbjct  469  SKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+ VL LR  +SY+FT+GE VA AVS+L PLL+LT++LNG+QPVLSGVAVGCGWQ
Sbjct  381  ISVIIAVAVLCLRDYLSYIFTEGETVAHAVSELAPLLSLTIILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNV CYY+VGVP+G +LGF FN GAKGIW GMIGGT+MQT+ILLWVT RTDW KE
Sbjct  441  TFVAYVNVTCYYLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVILLWVTFRTDWNKE  500

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A KRL++W+ K++ LL
Sbjct  501  VDQALKRLDKWEDKKQHLL  519



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A++V+ALR+VISY FT+GE VA AVS+LCPLLA++LVLNG+QPVLSGVAVGCGWQ
Sbjct  366  ISVIEAVIVIALRNVISYAFTEGETVAKAVSELCPLLAVSLVLNGIQPVLSGVAVGCGWQ  425

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGF F+LGA+GIW GM+GGT MQTIILLWVT   DW  E
Sbjct  426  KFVAYVNVGCYYVVGIPIGCLLGFKFHLGAQGIWSGMLGGTTMQTIILLWVTFHADWNAE  485

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+ RL++W+  +EPL
Sbjct  486  VEKARMRLDKWEDSKEPL  503



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  403  ISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQ  462

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KE
Sbjct  463  AFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKE  522

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A++RL +WD K++PLL
Sbjct  523  VEKARERLEKWDDKKQPLL  541



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  509
            R VISY FT+GE VA AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  508  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  329
            VVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+
Sbjct  451  VVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWE  510

Query  328  AKREPLL  308
             K+EPLL
Sbjct  511  DKKEPLL  517



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++  ++VL LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ
Sbjct  301  ISIMLGVLVLCLRNYISYLFTEGEVVSNAVADLCPLLAVTLVLNGIQPVLSGVAVGCGWQ  360

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+GAVLGF F LG KGIW GMIGGT MQT IL+WVT+RTDW KE
Sbjct  361  QFVAYVNIGCYYIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAILVWVTLRTDWNKE  420

Query  364  VEVAKKRLNQWDAKR--EPLL  308
            VE A+ RL++W+A +  EPLL
Sbjct  421  VEEAQNRLHKWEANKTTEPLL  441



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L+LRHVISY FT G  VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ +VAYVNVG
Sbjct  303  LSLRHVISYAFTSGGTVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAYVAYVNVG  362

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL+W T RTDW KEVE A++RL 
Sbjct  363  CYYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLR  422

Query  337  QWDAKREPLL  308
             WD K+EPLL
Sbjct  423  TWDDKKEPLL  432



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            +ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  266  MALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVG  325

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL+
Sbjct  326  CYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLD  385

Query  337  QWDAKREPLL  308
            +W+ K++PLL
Sbjct  386  KWEDKKKPLL  395



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            +ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  291  MALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVG  350

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL+
Sbjct  351  CYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLD  410

Query  337  QWDAKREPLL  308
            +W+ K++PLL
Sbjct  411  KWEDKKKPLL  420



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A++V+  R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ
Sbjct  374  ISIICALLVIIFRDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQ  433

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KE
Sbjct  434  AFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKE  493

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A KRL++WD   +P++
Sbjct  494  VEEAIKRLSKWDDTAKPIV  512



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
             +V+ A+VVL+LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  368  FAVLEAVVVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KE
Sbjct  428  AFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK R+ +WD K++PLL
Sbjct  488  VENAKSRVEKWDDKKQPLL  506



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI AI+VL LRHV+SY FT GE +A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVIFAILVLLLRHVMSYAFTSGETIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGF F L AKGIW GM+GGT MQTIILLWVT RT+W +E
Sbjct  428  AFVAYVNVGCYYVVGIPLGVILGFNFKLEAKGIWLGMLGGTAMQTIILLWVTFRTNWEQE  487

Query  364  VEVAKKRLNQW-DAKREPLL  308
            VE AK RLN W D  ++PLL
Sbjct  488  VEKAKSRLNMWQDQSKKPLL  507



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ
Sbjct  361  ISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KE
Sbjct  421  AFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE AK RL++W+ K++PLL  
Sbjct  481  VEKAKMRLDKWEDKQQPLLKN  501



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ
Sbjct  361  ISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KE
Sbjct  421  AFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE AK RL++W+ K++PLL  
Sbjct  481  VEKAKMRLDKWEDKQQPLLKN  501



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  331  LCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVG  390

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  341
            CYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL
Sbjct  391  CYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARL  450

Query  340  NQWDAKREPLL  308
            ++WD K++PLL
Sbjct  451  DKWDDKKQPLL  461



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ
Sbjct  361  ISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KE
Sbjct  421  AFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE AK RL++W+ K++PLL  
Sbjct  481  VEKAKMRLDKWEDKQQPLLKN  501



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A ++L LRH ISY FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  353  ISLIVATIMLCLRHYISYAFTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQ  412

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KE
Sbjct  413  AFVAYVNVGCYYFVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKE  472

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL++W+  ++PLL  
Sbjct  473  VEQAMRRLDKWEDNKQPLLSN  493



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGC  554
            I+++ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGC
Sbjct  349  IAIVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGC  408

Query  553  GWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDW  374
            GWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT +QT ILLWVTIRTDW
Sbjct  409  GWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWVTIRTDW  468

Query  373  VKEVEVAKKRLNQW-DAKREPLL  308
             KEVE A+KRLN+W D K+EPLL
Sbjct  469  SKEVEEAQKRLNKWDDTKKEPLL  491



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LSVFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ
Sbjct  292  IAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQ  351

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KE
Sbjct  352  AFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKE  411

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK RL  WD      L
Sbjct  412  VEKAKSRLETWDTNNSASL  430



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  381  LCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVG  440

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  341
            CYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL
Sbjct  441  CYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARL  500

Query  340  NQWDAKREPLL  308
            ++WD K++PLL
Sbjct  501  DKWDDKKQPLL  511



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            + + A+VVL LR  +SY FT GE VA AVSDLCPLLA TLVLNG+QPVLSGVAVGCGWQ 
Sbjct  372  ATVCAVVVLCLRDQLSYFFTGGEAVARAVSDLCPLLAATLVLNGIQPVLSGVAVGCGWQA  431

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKE  365
            FVAYVNVGCYYVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+ILLWVT+RTDW KE
Sbjct  432  FVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLILLWVTVRTDWNKE  491

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK RL++WD K++PLL
Sbjct  492  VENAKARLDKWDDKKQPLL  510



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+++ A+VVL+LRHVISY FT+GE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  371  IAIVEAVVVLSLRHVISYAFTEGETVANAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQ  430

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KE
Sbjct  431  AFVAYVNVGCYYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIILLWVTFRTDWNKE  490

Query  364  VEVAKKRLNQWDAKRE  317
            V  A  RL +WD ++E
Sbjct  491  VGTAINRLEKWDDRQE  506



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  700  VLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnv  521
            VLALRHVISY+FT+GE VADAVS+L P LA +LVLNG+QPVLSGVAVGCGWQTFVAYVNV
Sbjct  380  VLALRHVISYIFTEGETVADAVSELTPYLAASLVLNGIQPVLSGVAVGCGWQTFVAYVNV  439

Query  520  gcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  341
            GCYY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+ILLW T RTDW KEVE+A+KRL
Sbjct  440  GCYYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRL  499

Query  340  NQWDAKREPLL  308
              WD +++PLL
Sbjct  500  ATWDDQKQPLL  510



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ AI+VL LR+VISY FT GE VA+A   +CP LA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  363  IAVVEAIIVLCLRNVISYAFTKGETVANAQYLICPFLAVTLILNGVQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KE
Sbjct  423  AFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKE  482

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+ RL++W+  +EPL
Sbjct  483  VEKARTRLDKWENVKEPL  500



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAAI VL  R VISY FT+GEVVA AVSDL PLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  48   ISVIAAIAVLIFRDVISYAFTEGEVVAAAVSDLTPLLALTLLLNGIQPVLSGVAVGCGWQ  107

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIILLW+TIRTDW KE
Sbjct  108  AFVAYVNVGCYYLVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIILLWITIRTDWKKE  167

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A +RLN WD K EPL
Sbjct  168  VEEAARRLNNWDVK-EPL  184



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ
Sbjct  375  ISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQ  434

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE
Sbjct  435  ASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKE  494

Query  364  -----VEVAKKRLNQWDAKREPLL  308
                 VE AK RL++W+ KR+P L
Sbjct  495  MFQFQVEKAKSRLHKWEDKRKPSL  518



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VL LRH ISYVFT+GE V++AVSDL P LA+++VLNG+QPVLSGVAVGCGWQ
Sbjct  364  ISVVCAIIVLVLRHDISYVFTEGETVSNAVSDLSPYLAISIVLNGIQPVLSGVAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF F+ GA+GIW GMIGGT +QTIIL+WVT RTDW KE
Sbjct  424  AFVAYVNVGCYYIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTIILVWVTYRTDWNKE  483

Query  364  VEVAKKRLNQWDAKREP  314
            VE A+ RLN ++ K+EP
Sbjct  484  VEKAQSRLNTYEDKKEP  500



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+ A+VVL+ R VISY FTDGE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  371  IAVVEAVVVLSFRDVISYAFTDGETVANAVSHLTPYLAITLILNGIQPVLSGVAVGCGWQ  430

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW KE
Sbjct  431  AFVAYVNVGCYYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIILLWVTFRTDWNKE  490

Query  364  VEVAKKRLNQWDAKREP  314
            VE A  RL +W+ K+ P
Sbjct  491  VETAGNRLKKWEDKKLP  507



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ
Sbjct  365  IAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KE
Sbjct  425  AFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKE  484

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE AK RL  WD      L
Sbjct  485  VEKAKSRLETWDTNNSASL  503



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTF
Sbjct  373  VILAIVILAFRDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTF  432

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL W+T RTDW KEVE
Sbjct  433  VAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWITFRTDWTKEVE  492

Query  358  VAKKRLNQWDAKREPLLPK  302
             + KRL++W  K+  ++P+
Sbjct  493  ESAKRLDKWSNKKPEVVPE  511



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  691  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  512
             R  ISY+FT+GEVVA A SDL P LA TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSISYIFTEGEVVAKAASDLSPFLAATLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  511  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  332
            Y++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN W
Sbjct  430  YLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTW  489

Query  331  DAKREPLLPK  302
            D KR+P LP+
Sbjct  490  DDKRQPPLPE  499



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VVL+ RHVISY FTD   VA AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVLSWRHVISYAFTDSPAVAKAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FTDGE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  370  VILAIVILACRDVLSYAFTDGETVSAAVSDLCPLLAITLVLNGIQPVLSGVAVGCGWQTF  429

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE
Sbjct  430  VAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVE  489

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL+ W  K+  ++P+
Sbjct  490  EASKRLDIWSNKKLEVVPE  508



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L LR VISY FT+GE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVG
Sbjct  386  LLLRDVISYAFTEGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVG  445

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL+WVT RTDW KEV  A++RLN
Sbjct  446  CYYGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLN  505

Query  337  QWDAKREPLL  308
            QW+  +EPLL
Sbjct  506  QWEDVKEPLL  515



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+++ A+VVL+LRHVISY FTDGE VA+AVS L P LA+TL++NG+QPVLSGVAVGCGWQ
Sbjct  371  IAIVEAVVVLSLRHVISYAFTDGETVANAVSHLTPYLAVTLIINGIQPVLSGVAVGCGWQ  430

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G +LGF F+ GA+GIW GMIGGT+MQTIILLWVT RTDW KE
Sbjct  431  AFVAYVNVGCYYVVGIPLGCLLGFKFDFGAEGIWTGMIGGTLMQTIILLWVTFRTDWNKE  490

Query  364  VEVAKKRLNQWDAKRE  317
            V  A  RL +WD ++E
Sbjct  491  VGTAINRLEKWDDRKE  506



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+A R  ISYVFT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISVAEALAVMAARDYISYVFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  423  AFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  482

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  483  VEKARKRLDMWDDKKEPL  500



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            + LR V+SY FTDGEVV+ AVS+L P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  366  MGLRDVLSYAFTDGEVVSKAVSELSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVG  425

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEVE A++RLN
Sbjct  426  CYYLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLN  485

Query  337  QWDAKREPLL  308
             W+ K+EPLL
Sbjct  486  SWEDKKEPLL  495



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI ++V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  373  LSVIISVVILLCRDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+WVKE
Sbjct  433  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWVKE  492

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+W+ ++ PLL
Sbjct  493  VEEAQKRLNKWE-EKSPLL  510



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  691  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  512
             R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  511  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  332
            Y++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ W
Sbjct  430  YLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSW  489

Query  331  DAKREPLL  308
            D KR+PLL
Sbjct  490  DEKRQPLL  497



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  348  ISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQPVLSGVAVGCGWQ  407

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KE
Sbjct  408  TFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKE  467

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RLN+W+  + P +PK
Sbjct  468  VEAAQGRLNKWEDNKGP-VPK  487



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S+  AIV+L+ RHVISY+FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  80   LSLFEAIVILSWRHVISYIFTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQ  139

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKE
Sbjct  140  AYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKE  199

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+    PLL +
Sbjct  200  VEKASRRLDQWE-DTSPLLKQ  219



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISY FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  187  LAVFEAVVVMSWRNVISYAFTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQ  246

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KE
Sbjct  247  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKE  306

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE +  RL+QW+  REPLL +
Sbjct  307  VEKSSSRLDQWEESREPLLKQ  327



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISVAEALAVMAARDYISYIFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  423  AFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  482

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  483  VEKARKRLDMWDDKKEPL  500



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  369  LSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQ  428

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KE
Sbjct  429  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKE  488

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD  + PLL
Sbjct  489  VEEAQKRLNKWDDGKAPLL  507



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  371  LSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQ  430

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KE
Sbjct  431  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKE  490

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD  + PLL
Sbjct  491  VEEAQKRLNKWDDGKAPLL  509



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  373  ISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KE
Sbjct  433  TFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RLN+W+  + P +PK
Sbjct  493  VEAAQGRLNKWEDNKGP-VPK  512



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
             +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  388  FAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQ  447

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KE
Sbjct  448  AFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKE  507

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ AK R+ +WD K++PLL
Sbjct  508  VDKAKNRVEKWDDKKQPLL  526



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS++AAI+VL  R  ISY FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  380  ISIVAAIIVLIWRDTISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQ  439

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KE
Sbjct  440  AFVAYVNVGCYYLVGVPFGALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKE  499

Query  364  VEVAKKRLNQWDAKREPL  311
            V  A KRLN+W   +E L
Sbjct  500  VVEAAKRLNKWGEVKETL  517



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L  R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  274  LIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVG  333

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+
Sbjct  334  CYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLS  393

Query  337  QWDAKREPLL  308
             WD +R+PLL
Sbjct  394  SWDDRRQPLL  403



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
             +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  388  FAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQ  447

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KE
Sbjct  448  AFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKE  507

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ AK R+ +WD K++PLL
Sbjct  508  VDKAKNRVEKWDDKKQPLL  526



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAIFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAVTIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A  RL+QW+  REPLL +
Sbjct  481  VAKASSRLDQWEESREPLLKQ  501



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  AIV+L+ RHVISY FTD   VA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  361  LAVFEAIVLLSWRHVISYAFTDSPAVAEAVADLSPYLAITIILNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A  RL+QW+  REPLL +
Sbjct  481  VAKASSRLDQWEESREPLLKQ  501



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A++VL LRHVISY FT G VV+DAVSDL P LA ++VL GVQPVLSGVAVGCGWQ
Sbjct  376  ISVILAVIVLLLRHVISYAFTSGTVVSDAVSDLSPFLAASIVLGGVQPVLSGVAVGCGWQ  435

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT MQT++LLW T RT+W KE
Sbjct  436  AFVAYVNLACYYIIGIPLGCVLGFACDMGAKGIWTGMLGGTAMQTLVLLWATFRTNWGKE  495

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL+ WDA  EPLL +
Sbjct  496  VEKAQGRLDTWDATNEPLLKE  516



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI +IV+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  48   LSVIISIVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQ  107

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KE
Sbjct  108  ALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKE  167

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRLN+W+  + P+
Sbjct  168  VEEAQKRLNKWEDSKAPV  185



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L LR  +SY+FT+GE VA AVS+L PLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNV 
Sbjct  359  LCLRDYLSYIFTEGETVAHAVSELTPLLAITIILNGIQPVLSGVAVGCGWQAFVAYVNVA  418

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN
Sbjct  419  CYYIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLN  478

Query  337  QWDAKREPLL  308
            +W+ +++PLL
Sbjct  479  KWEDEKQPLL  488



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AI++LA R V+SY FT+GE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTF
Sbjct  375  VILAIIILACRDVLSYAFTEGENVSAAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTF  434

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE
Sbjct  435  VAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTIIQTVILAWVTFRTDWTKEVE  494

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL+ W  K+  ++P+
Sbjct  495  EASKRLDVWSNKKTEVVPE  513



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+ AAI VL LRH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ
Sbjct  375  ISIFAAIAVLLLRHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQ  434

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KE
Sbjct  435  AFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKE  494

Query  364  VEVAKKRLNQWDAKREPL  311
            VE AKKRLN+WD K EPL
Sbjct  495  VEEAKKRLNKWDVK-EPL  511



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  381  LSVVISLVILLCRDYISYIFTDGEDVATAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +E
Sbjct  441  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNRE  500

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A KRLN+W+ K  PLL +
Sbjct  501  VEEAMKRLNKWEDK-TPLLSE  520



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ
Sbjct  381  LSVVISLVILLCRDYISYIFTDGEDVAAAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQ  440

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +E
Sbjct  441  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNRE  500

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A KRLN+W+ K  PLL +
Sbjct  501  VEEAMKRLNKWEDKT-PLLSE  520



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI+AIVVL LR VISY FT+GEVVA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQT
Sbjct  358  SVISAIVVLFLRDVISYAFTEGEVVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQT  417

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
             VAY+NVGCYY VGVP+G++LGFYF LG KGIW GMIGGTVMQT+IL W+T RTDW KEV
Sbjct  418  LVAYINVGCYYAVGVPLGSLLGFYFKLGVKGIWLGMIGGTVMQTLILFWITFRTDWNKEV  477

Query  361  EVAKKRLNQWDAKREPLL  308
            E A KRL++WDA +EP+L
Sbjct  478  EEATKRLSKWDASKEPIL  495



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+VV++ R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVVMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR VISY+FT+GE V++AVS+L P LA +++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVCAIIVLALRDVISYIFTEGETVSNAVSELSPYLATSIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ GA+GIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  425  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGAQGIWAGMIGGTFMQTVILMWVTFRTDWNKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  485  VEKVRNRLDNWEDKKE  500



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L  R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  369  LIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVG  428

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+
Sbjct  429  CYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLS  488

Query  337  QWDAKREPLL  308
             WD +R+PLL
Sbjct  489  SWDDRRQPLL  498



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++V  A+V+++ R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  361  LAVFEAVVIMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+QW+  REPLL +
Sbjct  481  VEKASSRLDQWEESREPLLKQ  501



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ 
Sbjct  389  AVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQA  448

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV
Sbjct  449  FVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEV  508

Query  361  EVAKKRLNQWDAKREPLL  308
            + AK R+ +WD K++PLL
Sbjct  509  DKAKNRVEKWDDKKQPLL  526



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ 
Sbjct  392  AVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQA  451

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV
Sbjct  452  FVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEV  511

Query  361  EVAKKRLNQWDAKREPLL  308
            + AK R+ +WD K++PLL
Sbjct  512  DKAKNRVEKWDDKKQPLL  529



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ 
Sbjct  399  AVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQA  458

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV
Sbjct  459  FVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEV  518

Query  361  EVAKKRLNQWDAKREPLL  308
            + AK R+ +WD K++PLL
Sbjct  519  DKAKNRVEKWDDKKQPLL  536



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  691  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  512
             R  +SY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSMSYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  511  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  332
            Y++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN W
Sbjct  430  YLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTW  489

Query  331  DAKREPLLPK  302
            D KR+P L +
Sbjct  490  DDKRQPPLQE  499



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L  R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVG
Sbjct  368  LIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVG  427

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+
Sbjct  428  CYYLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLS  487

Query  337  QWDAKREPLL  308
             WD K +PLL
Sbjct  488  SWDEKGQPLL  497



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S+  A+V+L+ RHVISYVFTD  VVA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  367  LSLFEAVVILSWRHVISYVFTDSPVVAEAVAELAPYLAITIVLNGVQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL VT RTDW KE
Sbjct  427  AFVAYVNIGCYYIVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKE  486

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+  + PLL +
Sbjct  487  VEKASRRLDQWEDTQAPLLKQ  507



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ 
Sbjct  396  AVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQA  455

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV
Sbjct  456  FVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEV  515

Query  361  EVAKKRLNQWDAKREPLL  308
            + AK R+ +WD K++PLL
Sbjct  516  DKAKNRVEKWDDKKQPLL  533



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  319  LALFEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQ  378

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KE
Sbjct  379  AFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKE  438

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+  + PLL +
Sbjct  439  VETASRRLDQWEGSQAPLLKQ  459



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+++LA R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVAEAVILLASRDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYV+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+  L
Sbjct  488  VEKARKRLDMWDDKKNSL  505



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR VISY+FT+GE V++AVS+L P LA +++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVCAIIVLALRDVISYIFTEGETVSNAVSELSPYLATSIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ GA+GIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  425  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGAQGIWGGMIGGTFMQTVILMWVTFRTDWNKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  485  VEKVRNRLDNWEDKKE  500



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR VISY+FT+GE V++AVS+L P LA +++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVCAIIVLALRDVISYIFTEGETVSNAVSELSPYLATSIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ GA+GIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  425  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGAQGIWGGMIGGTFMQTVILMWVTFRTDWNKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  485  VEKVRNRLDNWEDKKE  500



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ++++ AI+VL  R+ +SY+FT G  V++AV+DL P LA++++LNG+QPVLSGVAVGCGWQ
Sbjct  369  VALVFAILVLIFRYELSYIFTGGTEVSEAVADLSPFLAISILLNGIQPVLSGVAVGCGWQ  428

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            +FVAYVNV CYYVVG+PVG +LGFYF LG KGIW GMIGGTV+QT+ILLWVT RTDW KE
Sbjct  429  SFVAYVNVACYYVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVILLWVTFRTDWQKE  488

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A  RL++W+A +EPLL
Sbjct  489  VEKAASRLDKWEAVKEPLL  507



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A  RL+QW+  REPLL +
Sbjct  481  VAKASSRLDQWEESREPLLKQ  501



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI AIV+LA R  +SY FT+G+ V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQ 
Sbjct  372  SVILAIVILACRDFLSYAFTEGKKVSVAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQA  431

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVA VNVGCYY++G+P+G + GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEV
Sbjct  432  FVAKVNVGCYYIIGIPLGVIFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEV  491

Query  361  EVAKKRLNQWDAKREPLLPK  302
            E A KRL++W  K+  ++P+
Sbjct  492  EEASKRLDKWSNKKLEVVPE  511



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S++ A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  319  LSLLEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGVQPVLSGVAVGCGWQ  378

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KE
Sbjct  379  AFVAYVNIGCYYFVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKE  438

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL++W+  + PLL +
Sbjct  439  VETASRRLDKWEDTQAPLLKQ  459



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A  RL+QW+  REPLL +
Sbjct  481  VAKASSRLDQWEESREPLLKQ  501



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+ AAI VL LRH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ
Sbjct  375  ISIFAAIAVLLLRHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQ  434

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KE
Sbjct  435  AFVAYVNIGCYYVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKE  494

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A KRLN+WD K EPL
Sbjct  495  VEEANKRLNKWDVK-EPL  511



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQPVLSGVAVGCGWQ
Sbjct  257  LSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KE
Sbjct  317  AFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKE  376

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ R+++W  K E LL +
Sbjct  377  VEKARNRMDEWGDKTEQLLKE  397



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  361  LAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ  420

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  421  AFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKE  480

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A  RL+QW+  REPLL +
Sbjct  481  VAKASSRLDQWEESREPLLKQ  501



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SV+ + V+L     ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ
Sbjct  369  LSVLVSAVILLCGDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQ  428

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KE
Sbjct  429  AFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKE  488

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRLN+WD  + PLL
Sbjct  489  VEEAQKRLNKWDDGKAPLL  507



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V  AIVVLALR+VISYVFT G  V+DAVS+L P LA++++LNG+QPVLSGVAVGCGWQ
Sbjct  374  IAVFLAIVVLALRNVISYVFTSGTTVSDAVSELSPYLAVSIILNGIQPVLSGVAVGCGWQ  433

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF F+ GAKGIW GMIGGT++QT+IL+W T RT+W KE
Sbjct  434  AFVAYVNVGCYYIIGIPIGVLLGFKFDFGAKGIWSGMIGGTLIQTMILIWFTSRTNWDKE  493

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+ RL+ W+  +EPL
Sbjct  494  VEKARNRLDTWEDNKEPL  511



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  AI V+A R  +SY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISVAEAIAVMAARDYVSYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT +TDW KE
Sbjct  423  TFVAYVNVGCYYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKE  482

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+E L
Sbjct  483  VEKARKRLDMWDDKKESL  500



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 2/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCG  551
            +SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCG
Sbjct  257  LSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCG  316

Query  550  WQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWV  371
            WQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W 
Sbjct  317  WQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWN  376

Query  370  KEVEVAKKRLNQWDAKREPLL  308
            KEVE A+KRLN+WD  + PLL
Sbjct  377  KEVEEAQKRLNKWDDGKAPLL  397



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR  ISY+FT+GE V++AVS+L P LA +++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVCAIIVLALRDAISYIFTEGETVSNAVSELSPYLATSIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ GA+GIW GMIGGT MQT+IL+WVT RTDW KE
Sbjct  425  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGAQGIWAGMIGGTFMQTVILMWVTFRTDWNKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  485  VEKVRNRLDNWEDKKE  500



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +++  A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ
Sbjct  364  LALFEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KE
Sbjct  424  AFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKE  483

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+  + PLL +
Sbjct  484  VETASRRLDQWEDSQAPLLKQ  504



>ref|XP_008364803.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=274

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR VISY+FT+GE V++AVS+L P +A++++LNG+QPVLSGVAVGCGWQ
Sbjct  130  ISVVCAIIVLALRDVISYIFTEGETVSNAVSELSPYVAISIILNGIQPVLSGVAVGCGWQ  189

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ G +GIW GMIGGT +QT+IL+WVT RTDW KE
Sbjct  190  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGVQGIWGGMIGGTFIQTVILMWVTFRTDWNKE  249

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  250  VEKVRNRLDNWEDKKE  265



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A+ VL LRHVISY FT G VVADAV++L P LA ++VLNGVQPVLSGVAVGCGWQ
Sbjct  373  ISVILAVAVLLLRHVISYAFTSGTVVADAVAELSPFLAASIVLNGVQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNV CYY++G+P+G VLGF  ++G KGIW GM+GGT++QTI+LLW TIRT+W KE
Sbjct  433  AFVAYVNVACYYIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTIVLLWATIRTNWGKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            V  A+ RL++WD  +EPLL +
Sbjct  493  VGKAQSRLDKWDDNKEPLLRE  513



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  363  ISVAEALAVMAARDYISYIFTSDPEVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQ  422

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  423  AFVAYVNVGCYYIVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  482

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  483  VEKARKRLDMWDDKKEPL  500



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+  R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVTEALAVIWFRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KE
Sbjct  428  TYVAYVNVGCYYVVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  488  VETARKRLDMWDDKKEPL  505



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  VIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTF  539
            VI AIV+LA R V+SY FT+GE V+ AVS+LCPLLALTL+LNG+QPVLSGVAVGCGWQTF
Sbjct  367  VILAIVILACRDVLSYAFTEGEKVSAAVSELCPLLALTLILNGIQPVLSGVAVGCGWQTF  426

Query  538  vayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVE  359
            VA VNVGCYY+VG+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE
Sbjct  427  VAKVNVGCYYIVGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVE  486

Query  358  VAKKRLNQWDAKREPLLPK  302
             A KRL++W   +  ++P+
Sbjct  487  EASKRLDKWSNIKLEVVPE  505



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  691  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  512
            LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  391  LRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACY  450

Query  511  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  332
            Y+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEV  A KRLN+W
Sbjct  451  YIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKW  510

Query  331  DAKREPLL  308
            + K++PLL
Sbjct  511  EDKKQPLL  518



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            +  R  ISY+FT+GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVG
Sbjct  370  MMFRDSISYIFTEGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVG  429

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYY++GVP+G +LGF F+LG KGIW GM+GGTV+QT+ILLWVT RTDW  EVEVAK RL+
Sbjct  430  CYYLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLS  489

Query  337  QWDAKREPLL  308
             WD KR+PLL
Sbjct  490  SWDDKRQPLL  499



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+  A+ ++A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISLAEALALMASRDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A+KRL+ WD K+EPLL
Sbjct  488  VKKARKRLDMWDDKKEPLL  506



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+  A+ ++A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISLAEALALMASRDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A+KRL+ WD K+EPLL
Sbjct  488  VKKARKRLDMWDDKKEPLL  506



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+++ A +VL LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ
Sbjct  368  IAIVEAAIVLLLRDVISYAFTSGETVAKAVSKLTPYLAVTLILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW+KE
Sbjct  428  AFVAYVNVGCYYVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIILLWVTFRTDWIKE  487

Query  364  VEVAKKRLNQWD----AKREPLLPKT*KRSIHEAK  272
            V  ++ RL +WD     +++PLL      S   A+
Sbjct  488  VGTSRDRLEKWDDSNKQQQQPLLKTDQSTSSSRAQ  522



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  709  AIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvay  530
            A +VLALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA 
Sbjct  366  ACIVLALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVAC  425

Query  529  vnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAK  350
            VNV CYY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A 
Sbjct  426  VNVCCYYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAV  485

Query  349  KRLNQWD  329
            KR+N+W+
Sbjct  486  KRINKWN  492



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  709  AIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvay  530
            A +VLALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA 
Sbjct  366  ACIVLALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVAC  425

Query  529  vnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAK  350
            VNV CYY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A 
Sbjct  426  VNVCCYYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAV  485

Query  349  KRLNQWD  329
            KR+N+W+
Sbjct  486  KRINKWN  492



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+V++A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVGEALVLMASRDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKRE  317
            VE AKKRL+ WD K++
Sbjct  488  VEKAKKRLDMWDDKKD  503



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQPVLSGVAVGCGWQ
Sbjct  368  LSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KE
Sbjct  428  AFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKE  487

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ R+++W  K E LL +
Sbjct  488  VEKARNRMDEWGDKTEQLLKE  508



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI AI VL LRHVISY FT G VVA AV++L P LA ++VL GVQPVLSGVAVGCGWQ
Sbjct  373  ISVILAIAVLLLRHVISYAFTSGTVVAGAVAELSPFLAASIVLGGVQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT+MQTI+LLW T RT+W KE
Sbjct  433  AFVAYVNIACYYIIGIPLGCVLGFTCDMGAKGIWSGMLGGTIMQTIVLLWATFRTNWKKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A  RL+ W+  +EPLL +
Sbjct  493  VEKAHSRLDSWNDNKEPLLKE  513



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+++LA R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVAEAVILLASRDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  AFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+  L
Sbjct  488  VEKARKRLDMWDDKKNSL  505



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS + AI+VL LRH ISYVFT+GE V++AVSDL P LA+++VLNG+QPVLSGVAVGCGWQ
Sbjct  344  ISAVCAIIVLVLRHDISYVFTEGETVSNAVSDLSPYLAISIVLNGIQPVLSGVAVGCGWQ  403

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF F+ GA+GIW GMIGGT +QTIILLWVT RTDW KE
Sbjct  404  AFVAYVNVGCYYIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTIILLWVTYRTDWNKE  463

Query  364  VEVAKKRLNQWDAKRE  317
            VE A+ RL+ ++ K++
Sbjct  464  VEKAQSRLDTYEDKKD  479



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 2/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCG  551
            +SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCG
Sbjct  369  LSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCG  428

Query  550  WQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWV  371
            WQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W 
Sbjct  429  WQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWN  488

Query  370  KEVEVAKKRLNQWDAKREPLL  308
            KEVE A+KRLN+WD  + PLL
Sbjct  489  KEVEEAQKRLNKWDDGKAPLL  509



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISVI A++VL+LRHVISY FT G VV+DAVS+L P LA ++VL GVQPVLSGVAVGCGWQ
Sbjct  373  ISVILAVIVLSLRHVISYAFTSGTVVSDAVSELSPFLAASIVLGGVQPVLSGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVN+GCYY++GVP+G VLGF  ++GAKGIW GM+GGT +QT++LLW T RT+W KE
Sbjct  433  AFVAYVNLGCYYIIGVPLGCVLGFACDMGAKGIWTGMLGGTAVQTLVLLWATFRTNWDKE  492

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ RL+ WD  +EPLL +
Sbjct  493  VEKAQSRLDTWDDVKEPLLKE  513



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A++++A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVGEALILMASRDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKRE  317
            VE AKKRL+ WD K++
Sbjct  488  VEKAKKRLDMWDDKKD  503



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI AI+VL LR+V+SY FT G  VAD+V++L P LAL+++LNG+QPVLSGVAVGCGWQ
Sbjct  367  LSVILAILVLILRNVMSYAFTGGSTVADSVAELSPFLALSVILNGIQPVLSGVAVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KE
Sbjct  427  AFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKE  486

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ R+++W  K E LL +
Sbjct  487  VEKARNRMDEWGDKTELLLKE  507



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+ I AI+VL LR V+SY FT G  VADAVS+L P LA++++LNG+QPVL+GVAVGCGWQ
Sbjct  373  IAAIFAILVLVLRRVMSYAFTSGSTVADAVSELSPYLAISVLLNGIQPVLTGVAVGCGWQ  432

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGC+Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT+IL++VT RTDW KE
Sbjct  433  AFVAYVNVGCFYFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQTLILMYVTFRTDWTKE  492

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE  + RL++W+ K+EPLL
Sbjct  493  VEKTRNRLDRWEDKKEPLL  511



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+  R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVTEALAVIWFRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  488  VEKARKRLDLWDDKKEPL  505



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  LALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvg  518
            L+LR VISY FT GE VA AVS L P LA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVG
Sbjct  377  LSLRDVISYAFTSGETVAKAVSHLTPYLAVTLVLNGIQPVLSGVAVGCGWQAFVAYVNVG  436

Query  517  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  338
            CYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEV+ AK R+ 
Sbjct  437  CYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVE  496

Query  337  QWDAKREPLL  308
            +WD K +PLL
Sbjct  497  KWDDKEQPLL  506



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+  R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISVTEALAVIWFRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  488  VEKARKRLDLWDDKKEPL  505



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -2

Query  721  SVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQT  542
            SVI AI+V   R V+SY FT+GE V+ AVSDLCP LA+TLVLNG+QPVLSGVAVGCGWQT
Sbjct  367  SVILAIIVWLCRDVLSYAFTEGEEVSAAVSDLCPFLAVTLVLNGIQPVLSGVAVGCGWQT  426

Query  541  FvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEV  362
            FVA VNVGCYY++G+P+G + GFYF   AKGIW GMIGGT++QT+IL+WV +RTDW KEV
Sbjct  427  FVAKVNVGCYYIIGIPIGTLFGFYFEYDAKGIWTGMIGGTLIQTVILVWVILRTDWTKEV  486

Query  361  EVAKKRLNQWDAKR  320
            E A KRL++W  K+
Sbjct  487  EKASKRLDKWSNKK  500



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+  R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  370  ISVTEALAVIWFRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQ  429

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  430  TYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  489

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  490  VEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV  A+ V+  R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  370  ISVTEALAVIWFRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQ  429

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYYVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  430  TYVAYVNVGCYYVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  489

Query  364  VEVAKKRLNQWDAKREPL  311
            VE A+KRL+ WD K+EPL
Sbjct  490  VEKARKRLDLWDDKKEPL  507



>gb|KDO78209.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=397

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI AI+VL LR+V+SY FT G  VAD+V++L P LAL+++LNG+QPVLSGVAVGCGWQ
Sbjct  257  LSVILAILVLILRNVMSYAFTGGSTVADSVAELSPFLALSVILNGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY++G+P+G +LGF FNLG KGIW GMIGGT++QTIIL++VT+RTDW KE
Sbjct  317  AFVAYVNVGCYYLIGIPIGCLLGFKFNLGTKGIWSGMIGGTLIQTIILVYVTLRTDWNKE  376

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A+ R+++W  K E LL +
Sbjct  377  VEKARNRMDEWGDKTELLLKE  397



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ AI+VLALR VISY+FT+GE V++AVS+L P LA +++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVCAIIVLALRDVISYIFTEGETVSNAVSELSPFLATSIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYY+VG+P+G +LGF F+ GA+GIW GMIGGT MQT+IL+WVT  TDW KE
Sbjct  425  AFVAYVNVGCYYIVGIPLGCLLGFKFDFGAQGIWGGMIGGTFMQTVILMWVTFLTDWNKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE  + RL+ W+ K+E
Sbjct  485  VEKVRNRLDNWEDKKE  500



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            ISV+ A+ V+A R  +SY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  365  ISVVEALAVIASRDYVSYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQ  424

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            T+VAYVNVGCYY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  425  TYVAYVNVGCYYIVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  484

Query  364  VEVAKKRLNQWDAKRE  317
            VE AKKRL+ WD  +E
Sbjct  485  VETAKKRLDMWDDVKE  500



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S IA +V   LRH +SY+FT GEVV+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ
Sbjct  354  VSAIAGLVTFLLRHKLSYIFTSGEVVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQ  413

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+T+RTDW KE
Sbjct  414  ATVAYINIGCYYFIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWITLRTDWNKE  473

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A+KRL++WD  R+PLL
Sbjct  474  VEEARKRLDKWDDTRQPLL  492



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            I+V+A ++V  LRH +SY+FT GE V+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ
Sbjct  257  IAVLAGVLVFLLRHKLSYIFTGGEAVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQ  316

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
              VAY+N+GCYY +GVP+GA+LGF F+ G KG+W GMIGGT++QTIILLW+T RTDW KE
Sbjct  317  ALVAYINIGCYYFIGVPLGALLGFKFDYGIKGLWGGMIGGTLIQTIILLWITFRTDWNKE  376

Query  364  VEVAKKRLNQWDAKREPLL  308
            VE A++RL++WD  ++PLL
Sbjct  377  VEEARRRLDKWDDAKQPLL  395



>ref|XP_011100217.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Sesamum 
indicum]
Length=507

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +SVI A + L  RH +SYVFT GEVV+DAV+DL PLLA +++LNGVQPVLSG+ VGCGWQ
Sbjct  367  LSVIFAFITLVFRHQLSYVFTSGEVVSDAVADLTPLLAASIILNGVQPVLSGIFVGCGWQ  426

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             FVAYVNVGCYYV+GVPVGAVLGF FNLGAKGIW GM+GGT+MQT+IL+W+T+RTDW  E
Sbjct  427  AFVAYVNVGCYYVIGVPVGAVLGFVFNLGAKGIWTGMLGGTLMQTLILIWITVRTDWNNE  486

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A+ R+++W+  +E  L
Sbjct  487  VDKARNRIDKWNDLKEGFL  505



>ref|XP_010493132.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=503

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S+  A+V+L+ RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  364  LSLFEAVVILSWRHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  424  AYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKE  483

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+    PLL +
Sbjct  484  VEKASRRLDQWE-DSSPLLKQ  503



>ref|XP_010476100.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010476101.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=503

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            +S+  A+V+L+ RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ
Sbjct  364  LSLFEAVVILSWRHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQ  423

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
             +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KE
Sbjct  424  AYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKE  483

Query  364  VEVAKKRLNQWDAKREPLLPK  302
            VE A +RL+QW+    PLL +
Sbjct  484  VEKASRRLDQWE-DSSPLLKQ  503



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  724  ISVIAAIVVLALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ  545
            IS+  A+ + A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQ
Sbjct  368  ISLAEALALTASRDYIGYIFTSDVEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQ  427

Query  544  TFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE  365
            TFVAYVNVGCYYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KE
Sbjct  428  TFVAYVNVGCYYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKE  487

Query  364  VEVAKKRLNQWDAKREPLL  308
            V+ A+KRL+ WD K+EPLL
Sbjct  488  VKKARKRLDMWDDKKEPLL  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440