BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033B22

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   93.2    4e-18   Nicotiana tomentosiformis
gb|AFH56407.1|  EIN3-like protein EIL1                                91.7    1e-17   Diospyros kaki [Japanese persimmon]
dbj|BAA74714.1|  transcription factor TEIL                            91.3    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   89.4    7e-17   Nicotiana sylvestris
ref|NP_001234721.1|  EIL2 protein                                     84.3    4e-15   Solanum lycopersicum
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   84.0    6e-15   Solanum tuberosum [potatoes]
emb|CDP19134.1|  unnamed protein product                              82.8    1e-14   Coffea canephora [robusta coffee]
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        81.6    3e-14   Sesamum indicum [beniseed]
gb|AAP70005.1|AF498235_1  EIL                                         79.7    3e-14   Solanum lycopersicum
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  79.3    2e-13   Solanum tuberosum [potatoes]
gb|AHA93899.1|  ethylene insensitive 3                                78.2    4e-13   Coffea arabica [arabica coffee]
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  75.5    3e-12   Nicotiana sylvestris
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...  71.2    7e-11   
ref|NP_001234541.1|  EIL1 protein                                     70.5    1e-10   Solanum lycopersicum
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.2    6e-10   Nicotiana tomentosiformis
gb|AGK07288.1|  EIN3-3                                                64.3    1e-08   Rosa hybrid cultivar
gb|AAP04000.1|  EIL4                                                  63.9    2e-08   Nicotiana tabacum [American tobacco]
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.9    2e-08   Nicotiana sylvestris
gb|KHG00335.1|  ethylene insensitive 3 -like protein                  63.5    2e-08   Gossypium arboreum [tree cotton]
ref|NP_001233931.1|  EIN3-like protein                                62.8    4e-08   Solanum lycopersicum
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   62.4    6e-08   Solanum tuberosum [potatoes]
ref|XP_002312841.2|  EIN3-like family protein                         61.6    1e-07   
ref|XP_007016682.1|  Ethylene insensitive 3 family protein            61.6    1e-07   
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   61.6    1e-07   Nicotiana tomentosiformis
gb|KJB26156.1|  hypothetical protein B456_004G227800                  61.2    1e-07   Gossypium raimondii
gb|ACP56697.1|  EIN3-like protein                                     61.2    1e-07   Lithospermum erythrorhizon
gb|KDP42896.1|  hypothetical protein JCGZ_23838                       59.7    5e-07   Jatropha curcas
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        59.7    5e-07   Fragaria vesca subsp. vesca
ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  59.3    5e-07   Vitis vinifera
gb|AID55343.1|  EIN3-like protein EIL1                                59.3    5e-07   Actinidia chinensis
gb|KJB56070.1|  hypothetical protein B456_009G105400                  59.3    6e-07   Gossypium raimondii
gb|ABY28269.1|  EIN3-like protein EIL1                                58.9    7e-07   Actinidia deliciosa [Chinese gooseberry]
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        58.9    8e-07   Populus euphratica
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   58.5    9e-07   Populus euphratica
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative          57.4    3e-06   Ricinus communis
ref|XP_004144109.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   57.0    3e-06   
gb|KHG04095.1|  ethylene insensitive 3 -like protein                  56.6    4e-06   Gossypium arboreum [tree cotton]
ref|XP_006384758.1|  EIN3-like family protein                         56.6    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   55.8    7e-06   Eucalyptus grandis [rose gum]
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  53.9    4e-05   Cicer arietinum [garbanzo]
gb|AFK45610.1|  unknown                                               53.1    4e-05   Lotus japonicus
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        52.8    1e-04   Cucumis melo [Oriental melon]
gb|AHB18380.1|  ethylene insensitive 3                                52.4    1e-04   Momordica charantia [balsam pear]
gb|KGN66413.1|  EIN3-like protein                                     52.4    1e-04   Cucumis sativus [cucumbers]
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                   51.2    3e-04   Morus notabilis
ref|XP_004171661.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   51.2    3e-04   
gb|KJB20248.1|  hypothetical protein B456_003G140600                  50.8    4e-04   Gossypium raimondii
gb|ACJ70675.1|  EIN3-like protein EIL2                                50.8    4e-04   Actinidia deliciosa [Chinese gooseberry]
gb|KHG09663.1|  ethylene insensitive 3 -like protein                  50.4    5e-04   Gossypium arboreum [tree cotton]
gb|AID55344.1|  EIN3-like protein EIL2                                50.4    5e-04   Actinidia chinensis
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                   50.4    5e-04   
gb|AFK80347.1|  ethylene-insensitive 3                                50.1    7e-04   Cucumis sativus [cucumbers]



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFE  506
            KS + G + + K     +P+ Q  Q  +L NQGII  GNIF ++NIS+   MF  GD+F+
Sbjct  508  KSSMAGNVVMSKEQPRQQPSIQ--QNNYLHNQGIILDGNIFGDTNISANHSMFPQGDRFD  565

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            Q K L SPFN  S +   FMFG PFNL  +DY+E L G+    +PK+D+  WY
Sbjct  566  QSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTEALSGITQDNMPKQDVPVWY  618



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 66/109 (61%), Gaps = 5/109 (5%)
 Frame = -2

Query  664  TLDLLKNNLFNKPTFQCHQ-GGFLQNQGIIPG-NIFQESNISSTRPMFTS-GDQFEQPKA  494
            T D       ++P   C Q   ++  QG++ G NIF+E+N+SS R MF+  GDQF+Q KA
Sbjct  486  TKDQTPQQALSQPNLHCQQENNYIHGQGVVMGVNIFEEANMSSNRSMFSRQGDQFDQCKA  545

Query  493  LNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            LNSPF  +  +    MFG PFNLPP DY+EG+ GV    L K D+  WY
Sbjct  546  LNSPFEANPNDNFHLMFGSPFNLPPVDYTEGIPGVARDMLSKPDVSIWY  594



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFE  506
            KS +   + + K     +P+ Q  Q  +L NQGII  GNIF ++NIS+   MF  GD+F+
Sbjct  505  KSSMAANVVMSKEQPRQQPSIQ--QNNYLHNQGIILDGNIFGDTNISANHSMFPQGDRFD  562

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            Q K L SPFN  S +   FMFG PFNL  +DY+E L G+    +PK+D+  WY
Sbjct  563  QSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTEALSGITQDNMPKQDVPVWY  615



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFE  506
            K+ + G + + K     +P+ Q  Q  +L NQGI+  GNIF ++NIS+   +F  GD+F+
Sbjct  506  KNSMAGNVVMSKEQPRQQPSIQ--QNNYLHNQGIVLDGNIFGDTNISANHSVFPQGDRFD  563

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            Q K L SPFN  S +   FMFG PFNL  +DY+E L G+    +PK+D+  WY
Sbjct  564  QSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTEALSGITQDNMPKQDVPVWY  616



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFTSGDQFE  506
            KS + G   + K     +P+ Q  Q  +LQ+QG ++ G+IF ++NIS+   MF  GD+F+
Sbjct  504  KSSMAGNSVMSKEQPLQQPSIQ--QNNYLQSQGNVLEGSIFGDTNISANNSMFVQGDRFD  561

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVP--PLPKKDILSWY  353
            Q K L SPFN SS +   FMFG PFN+  +D SE L G+    + K+D   WY
Sbjct  562  QSKVLTSPFNASSTDDFNFMFGSPFNMQSTDLSECLSGISHDDVTKQDASVWY  614



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFTSGDQFE  506
            KS + G + + K     +P+ Q  Q  +LQ+QG ++ G+IF ++NIS+   MF  GD+F+
Sbjct  504  KSSMAGNVVMSKEQPLQQPSIQ--QNNYLQSQGNVLEGSIFGDTNISANNSMFVQGDRFD  561

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVP--PLPKKDILSWY  353
            Q K L SPFN  S +   FMFG PFNL  +D SE L G+    + K+D   WY
Sbjct  562  QSKVLTSPFNAGSNDDFNFMFGSPFNLQSTDLSECLSGISHDDMTKQDTSVWY  614



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 22/126 (17%)
 Frame = -2

Query  667  GTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISS-----------------  542
            G   ++K     +P  QC    +L  QGI+  GNIF+++N+SS                 
Sbjct  509  GNAAVIKEQSVQQPGMQCQSDNYLHGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIP  568

Query  541  -TRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKK  371
             +RPMF  GD+F+Q K  +SPFN S+ E   FMFG PFNLP  D++EGL G+      K+
Sbjct  569  ASRPMFQHGDRFDQCKITSSPFNNSN-ENFQFMFGSPFNLPSVDFTEGLPGISRDNASKQ  627

Query  370  DILSWY  353
            D+  WY
Sbjct  628  DLPIWY  633



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = -2

Query  649  KNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNV  473
            K     + + Q  Q G+LQNQG++  GNIF++  I +   +F   D+F+  K + SPFN 
Sbjct  515  KEQSLQQHSAQSRQDGYLQNQGLVLEGNIFEDKTIPNNLSIFRPPDRFDHSKVITSPFNP  574

Query  472  SSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            +  E    MF  PFN+PP DY+E   GVP   LPK+DI  WY
Sbjct  575  NPTENFQLMFSSPFNIPPVDYTENFPGVPRNNLPKQDITIWY  616



>gb|AAP70005.1|AF498235_1 EIL [Solanum lycopersicum]
Length=359

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFTSGDQFE  506
            KS + G   + K     +P+ Q  Q  +LQ+QG ++ G+IF ++NIS++  MF  GD+F+
Sbjct  246  KSSMAGNSVMSKEQPLQQPSIQ--QNNYLQSQGNVLEGSIFGDTNISASNSMFVQGDRFD  303

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGV  389
            Q K L SPFN SS +   FMFG PFN+  +D SE L G+
Sbjct  304  QSKVLTSPFNASSTDDFNFMFGSPFNMQSTDLSECLSGI  342



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            K +  G + L K     +P  + HQ  +L +QGI+ GNIF+ +NIS+T+ M    D F+Q
Sbjct  507  KRQNRGNVTLTKEQPHQQP--RVHQDNYLLSQGIMEGNIFKNTNISTTQSMLPQVDPFDQ  564

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
             KALNS FN  S ++  FMFG  FN+  ++Y+  L  +G    PK+D   WY
Sbjct  565  SKALNSAFNAGSNDSFHFMFGSSFNIQSTNYNGNLPSIGYDTTPKQDAPIWY  616



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 22/126 (17%)
 Frame = -2

Query  667  GTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISS-----------------  542
            G   ++K     +P  QC    +L  QGI+  GNIF+++N+SS                 
Sbjct  454  GNAAVIKEQSVQQPGMQCQSDNYLHGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIP  513

Query  541  -TRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKK  371
             +RPMF  GD+F+Q K  +SPFN S+ E   FMFG PFNLP  D++  L G+      K+
Sbjct  514  ASRPMFQHGDRFDQCKITSSPFNNSN-EKFQFMFGSPFNLPSVDFTXSLPGISRDNASKQ  572

Query  370  DILSWY  353
            D+  WY
Sbjct  573  DLPIWY  578



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            KS+  G + L K     +P    +Q  +L +QG++  NIF+++NIS++ P+   G+  +Q
Sbjct  506  KSQNTGNVALTKEQPHQQPRL--NQDNYLHSQGMMERNIFKDTNISASHPILPQGNLADQ  563

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
             K LNS F+  S +   FMFG PFNL  ++Y+  L  +G    PK+DI  WY
Sbjct  564  CKVLNSSFDTGSSDNFNFMFGSPFNLQSTNYTGSLPGIGCDNTPKQDIPIWY  615



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = -2

Query  604  GFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNL  425
            G+L+ QG+   NIF+++NI +   +F+  D+F+Q K +NSPF+ +  E    MF  PFN+
Sbjct  516  GYLRGQGM---NIFEDNNIPNNPSIFSPPDRFDQCKVMNSPFSSNPAENFQLMFSSPFNV  572

Query  424  PPSDYSEGLLGVPP--LPKKDILSWY  353
            P  DY+E   GVP   LPK+D+  WY
Sbjct  573  PSIDYTEAFPGVPRDNLPKQDVTIWY  598



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            K +  G + L K     +P  + HQ  +L +QGI+ GNIF+ +NIS+T+ M    D F+Q
Sbjct  505  KRQNRGNIALTKEQPHQQP--RVHQDNYLLSQGIMDGNIFKNTNISTTQSMLPQVDPFDQ  562

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
             KA    FN  S +   FMFG PFN+  ++Y+  L  +G    PK+D   WY
Sbjct  563  SKA----FNAGSNDNFHFMFGSPFNIQSTNYNGNLPSIGYDTTPKQDAPIWY  610



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 4/107 (4%)
 Frame = -2

Query  667  GTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALN  488
            G + L K     +P    +Q  +L +QG++ GNIF++++IS+  P+   G+  +Q K LN
Sbjct  511  GNVALTKGQPHQQPRL--NQDNYLHSQGMMEGNIFKDTSISAIHPILPQGNLTDQCKVLN  568

Query  487  SPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            S FN  S +   FM G  F+L  ++YS  L  +G    PK+DI  WY
Sbjct  569  SSFNAGSSDNFNFMLGSLFDLQSTNYSGSLPGIGCDNTPKQDIPIWY  615



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 4/99 (4%)
 Frame = -2

Query  637  FNKPTFQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSI  464
            F++P     Q  + + QG+ + GN F+ESNISS   +F   + QFEQ K ++SPF  +  
Sbjct  519  FSQPKVAHQQDEYFRGQGVRLDGNFFEESNISSNHHLFPREEGQFEQFKVVSSPFETNHN  578

Query  463  ETLPFMFGPPFNLPPSDYSEGLLGVP-PLPKKDILS-WY  353
               P MFG PF+L   DY E L G+  P+ K+   S W+
Sbjct  579  SNFPMMFGSPFDLASFDYKEDLQGLALPMEKQSETSIWF  617



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 14/112 (13%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            KS+  G + L K     +P  + +Q  +L +QGI+ GNIF+++NIS++  M         
Sbjct  504  KSQNTGNVALTKEQPHQQP--RVNQDNYLHSQGIMEGNIFKDANISTSHSML--------  553

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            P+A  SPFN    +   FMFG PFNL  ++Y+  L  +G    PK+++ +WY
Sbjct  554  PQA--SPFNAGPNDNFHFMFGSPFNLQSANYTGNLPGIGYDTTPKQNLPTWY  603



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 14/112 (13%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            KS+  G + L K     +P  + +Q  +L +QGI+ GNIF+++NIS++  M         
Sbjct  504  KSQNTGNVALTKEQPHQQP--RVNQDNYLHSQGIMEGNIFKDANISTSHSML--------  553

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            P+A  SPFN    +   FMFG PFNL  ++Y+  L  +G    PK+++ +WY
Sbjct  554  PQA--SPFNAGPNDNFHFMFGSPFNLQSANYTGNLPGIGYDTTPKQNLPTWY  603



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 11/109 (10%)
 Frame = -2

Query  646  NNLFNK------PTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKAL  491
            NNL  K      P  Q  Q  F + QG++  GN F++S++   + MF+ G+ QFE+ K L
Sbjct  288  NNLVTKGQNVLQPKIQHQQDEFFRGQGVMMEGNFFEDSSMLHNQQMFSQGEAQFERFKGL  347

Query  490  NSPFNVSSIET-LPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            NSP + +        MFG PF+L   DY E L  +G+  +PK+D+  W+
Sbjct  348  NSPLDSNHNNNGFQLMFGSPFDLASFDYKEDLHAVGMDSMPKQDVSIWF  396



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = -2

Query  610  QGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPF  431
            Q  +L ++G++ GNIF++ N+S+++ M   G+  +Q K LNS  N      L FMFGPPF
Sbjct  524  QVNYLHSRGMMEGNIFKDINVSASQSMQPQGNLVDQCKILNSSDN------LQFMFGPPF  577

Query  430  NLPPSDYSEGL--LGVPPLPKKDILSWY  353
            NL  ++Y   L  +G    PK+DI  WY
Sbjct  578  NLQSTNYPGSLPGIGCDTTPKQDIPIWY  605



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 11/113 (10%)
 Frame = -2

Query  682  KSRILGTLDLLKNN-LFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFE  506
            KS+  G + + K   L  +P  +  Q  +L ++G++ GNIF++ N+S+++ M    +  +
Sbjct  501  KSQNTGNVAVTKEQQLHQQP--RVDQVNYLHSRGMMEGNIFKDINVSASQSMHPQSNPVD  558

Query  505  QPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            Q K LNS  N      L FMFGPPFNL  ++Y   L  +G    PK+DI  WY
Sbjct  559  QCKILNSSDN------LHFMFGPPFNLQSTNYPGSLSGIGCDATPKQDIPIWY  605



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 8/105 (8%)
 Frame = -2

Query  646  NNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNV  473
            +N+F +P  Q  QG   ++QG +I GN+F+ESNI+S   +F+  G QF++ K LNSPF  
Sbjct  522  HNVF-QPKIQHQQGNHFRSQGNVIDGNVFKESNINSNHQLFSQEGGQFDRFKPLNSPFET  580

Query  472  S-SIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  353
            S +  +   MF  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  581  SQNNSSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  625



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = -2

Query  631  KPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSP-FNVS-SI  464
            +P  Q  Q  + + QG+I  GN F+ES++ +   MF+ G+ QF++ KALN+P F  + + 
Sbjct  516  QPKIQQQQDEYFRGQGVIMEGNFFEESSMPNNNQMFSQGEGQFDRFKALNTPQFETNHNN  575

Query  463  ETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
             +   MFG PF+L   DY E L  +G+  LPK+D+  W+
Sbjct  576  NSFQLMFGSPFDLASFDYKEDLQAVGMDTLPKQDVSMWF  614



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 17/112 (15%)
 Frame = -2

Query  682  KSRILGTLDLLKNNLFNKPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQ  503
            KS+  G + L K     +P     +  +L +QGI+ GNIF+++NIS++  M   G     
Sbjct  504  KSQNTGNIALTKEQPHQQP-----RDNYLHSQGIMEGNIFKDANISTSHSMLPHG-----  553

Query  502  PKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
                 SPFN    +    MFG PFNL  ++Y+  L  +G    PK+D+ +WY
Sbjct  554  -----SPFNAGPNDNFHCMFGSPFNLQSANYTGNLPCIGYDTTPKQDLPTWY  600



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (55%), Gaps = 12/110 (11%)
 Frame = -2

Query  646  NNLFNK------PTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKAL  491
            NNL  K      P  Q  Q  F + QG++  GN F++S++     MF+ G+ QFE+ K L
Sbjct  504  NNLVTKGQNVLQPKIQHQQDEFFRGQGVMMEGNFFEDSSMLHNHQMFSQGEAQFERFKGL  563

Query  490  NSPF--NVSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            NSP   N ++  +   MFG  F+L   DY E L  +G+  +PK+D+  W+
Sbjct  564  NSPLDSNHNNNNSFQLMFGSSFDLASFDYKEDLHAVGMDSMPKQDVSIWF  613



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 23/118 (19%)
 Frame = -2

Query  637  FNKPTFQCHQGGFLQNQG--------------------IIPGNIFQESNISSTRPMFTSG  518
             ++P   C Q  +L  QG                    +I GN+FQ+SNI++    +  G
Sbjct  518  VHQPNIHCQQVNYLPTQGATHQQTGTQGLSNNYQGQGLMIEGNMFQDSNINANPSPYPQG  577

Query  517  DQFEQPKALNSPF-NVSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  353
            D F+Q K L+SPF N  + E    MFG PFN+   DY+EG  G     + K+D   W+
Sbjct  578  DHFDQRKVLSSPFDNNHNNENFQLMFGSPFNMASGDYTEGFPGATRDNMSKQDESIWF  635



>gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 12/110 (11%)
 Frame = -2

Query  646  NNLFNKPTFQCHQ-GGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFN  476
            ++LF       HQ   + + Q  +I GNIF+ESNI +   MF+   +QFE+ KALNSPF 
Sbjct  509  HSLFQPKIHHHHQPDNYFRGQANVIEGNIFEESNIHNNHQMFSQDSNQFERFKALNSPFE  568

Query  475  ------VSSIETLPFMFGPPFNLPPSDYSEGLLG--VPPLPK-KDILSWY  353
                   ++     F FG PF+L   DY E L G  +  LPK +D+  W+
Sbjct  569  SNHHPTAAATNNSSFKFGSPFDLASFDYKEDLQGLVMDALPKQQDVSIWF  618



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -2

Query  637  FNKPTFQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSI  464
            F++P     Q  + + QG+ + GN F+ESNISS   +FT  + QF+Q K  +SPF  +  
Sbjct  519  FSQPNVAHQQDEYFRGQGVRLDGNFFEESNISSNHHVFTREEGQFDQFKVTSSPFETNHN  578

Query  463  ETLPFMFGPPFNLPPSDYSEGLLGV  389
               P MFG  F+L   DY E L G+
Sbjct  579  SNFPMMFGSSFDLASFDYKEDLQGL  603



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 8/83 (10%)
 Frame = -2

Query  592  NQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNLP  422
            NQG++  GNI +E+N+     +F+S + QF+Q KA +SPF+ +  + +  F FG PFNL 
Sbjct  538  NQGVMMGGNITEETNMPLNHSVFSSSEIQFDQCKAFDSPFDTNPNDNIADFRFGSPFNLA  597

Query  421  PSDYSEGLLGVPPLPKKDILSWY  353
              DY+     V PLPK+D+  WY
Sbjct  598  AVDYT-----VDPLPKQDVSMWY  615



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 54/107 (50%), Gaps = 6/107 (6%)
 Frame = -2

Query  673  ILGTLDLLKNNLFNKPTFQCHQ-GGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQP  500
            I G+LD   +    +P  QC Q   ++  QG + G++ +E+N+     MF+  + +F+Q 
Sbjct  510  ISGSLDRALSQSLPQPNIQCQQDNNYIHGQGFVEGHVHEEANLPINLSMFSQQENRFDQR  569

Query  499  KALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPPLPKKDILS  359
            K L+S F     +  P MFG P  LP  DY E L    P   +D LS
Sbjct  570  KVLSSQFEADPNDNFPLMFGSPLYLPCMDYPEHL----PAVARDTLS  612



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = -2

Query  622  FQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPF  449
            F  HQG  ++      GN F+ES++     MF  G+ QF++ K LNSPF  + +  +   
Sbjct  525  FNGHQGVMME------GNFFEESSMPRNHQMFMQGEGQFDRFKGLNSPFEANHNNNSFQL  578

Query  448  MFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
            MFG PF+L   DY E L  +GV  +PK+D+  W+
Sbjct  579  MFGSPFDLASFDYKEDLQAVGVDTMPKQDVSIWF  612



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 54/107 (50%), Gaps = 6/107 (6%)
 Frame = -2

Query  673  ILGTLDLLKNNLFNKPTFQCHQ-GGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQP  500
            I G+LD   +    +P  QC Q   ++  QG + G++ +E+N+     MF+  + +F+Q 
Sbjct  460  ISGSLDRALSQSLPQPNIQCQQDNNYIHGQGFVEGHVHEEANLPINFSMFSQQENRFDQR  519

Query  499  KALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGLLGVPPLPKKDILS  359
            K L+S F     +  P MFG P  LP  DY E L    P   +D LS
Sbjct  520  KVLSSQFEADPNDNFPLMFGSPLYLPCMDYPEHL----PAVARDTLS  562



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = -2

Query  646  NNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNV  473
            +N+F +P  Q  QG   ++QG +I GN+F+E NI+S   +F+  G QF++ K LNSPF  
Sbjct  529  HNVF-QPKIQHQQGNHFRSQGNVIGGNVFKEYNINSNHQLFSQEGGQFDRFKPLNSPFET  587

Query  472  S-SIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  353
            S +  +   MF  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  588  SQNNSSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  632



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  646  NNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFTSG-DQFEQPKALNSPFNV  473
            +N+F +P  Q  Q    + Q  +I GNIF+ESNI+    MF+    QF++ K LNSPF  
Sbjct  515  HNVF-QPKIQHQQDNHFRGQSNMINGNIFEESNINQNHQMFSQEVGQFDRFKPLNSPFET  573

Query  472  SSIET-LPFMFGPPFNLPPSDYSEGL--LGVPPLPK-KDILSWY  353
            +   +    MFG PF+L   DY + L  LG+  LPK +D+ +W+
Sbjct  574  NQNNSGFSLMFGSPFDLSSFDYKDDLQVLGMDTLPKHQDVSTWF  617



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 11/108 (10%)
 Frame = -2

Query  646  NNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFN-  476
            +NLF +P     Q  + ++Q  ++  NIF++SNI +   MF+  G QF++ KALNSPF  
Sbjct  510  HNLF-QPKIHHQQDNYFRSQSNVMDANIFEDSNIHNNHQMFSQDGSQFDRFKALNSPFES  568

Query  475  ----VSSIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPK-KDILSWY  353
                 ++  +   MFG PF+L   DY E L  L +  LPK +D   W+
Sbjct  569  SNQHNNNNSSFNLMFGSPFDLSSFDYKEDLQGLAMESLPKQQDAAIWF  616



>ref|XP_004144109.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=622

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 8/98 (8%)
 Frame = -2

Query  622  FQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF  449
             Q  Q  + +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF  +      F
Sbjct  524  IQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHNNNF  583

Query  448  --MFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
              MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  584  HLMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  621



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (54%), Gaps = 11/99 (11%)
 Frame = -2

Query  628  PTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIE---  461
            P  Q  Q  + + QG    N F++S++ +   MF  G+ QF++ K LNSPF         
Sbjct  374  PKIQQPQDEYFRGQG----NFFEDSSMPNNHQMFQQGEGQFDRFKGLNSPFETEHNNNNN  429

Query  460  -TLPFMFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  353
             + P MFG PF+L   DY E L  +G+  +P++D+  W+
Sbjct  430  NSFPLMFGSPFDLSTFDYKEDLQTVGMDTIPRQDVSIWF  468



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = -2

Query  646  NNLFNKPTFQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNV  473
            +N+F +P  Q  Q    ++Q  +I G+IF+ SNI+    MF+  G QF++ K LNSPF  
Sbjct  515  HNVF-QPKIQHQQDNHFRSQSNMINGSIFEGSNINQNHQMFSQEGGQFDRFKPLNSPFET  573

Query  472  SSIET-LPFMFGPPFNLPPSDYSEGL--LGVPPLPK-KDILSWY  353
            +   +    MFG PF+L   DY + L  LG+  LPK +D+ +W+
Sbjct  574  NQNNSGFNLMFGSPFDLSSFDYKDDLQVLGMDTLPKHQDVSTWF  617



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = -2

Query  598  LQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFN  428
            LQ Q    G+ FQ+ N S+   MF+  D QF++ K +NS F  N  + + L  MFG PF+
Sbjct  523  LQQQNEFVGSFFQQPNASANHHMFSREDIQFDRFKTMNSSFEANNHNHDNLQLMFGSPFD  582

Query  427  LPPSDYSEGLLG--VPPLPKKDILSWY  353
            L   D+ E L G  + PLPK+D+  W+
Sbjct  583  LSSFDFKEELPGGVMDPLPKQDVTIWF  609



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = -2

Query  631  KPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN----VS  470
            +P  Q  QG F ++QGI+  GN+FQE+++S+   MF   + QF++ KALNSPF      +
Sbjct  522  QPNIQPQQGSFYRSQGIVMGGNLFQETSMSNNHHMFARDEGQFDRFKALNSPFENHHNHN  581

Query  469  SIETLPFMFGPPFNLPPSDYSEGL--LGVPPLPKK-DILSWY  353
                   MFG   +L   D+ + +  +GV  L K+ DI  WY
Sbjct  582  HNNNYHLMFGSHCDLTSFDFKDDMHGVGVDGLQKQPDISIWY  623



>gb|AFK45610.1| unknown [Lotus japonicus]
Length=238

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  583  IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV---SSIETLPFMFGPPFNLPPS  416
            I+ GN F+E+NIS+   MF   + QF++ KALNSPF     SS      MFG P +L   
Sbjct  153  IMEGNFFEEANISTNHHMFAREENQFDRFKALNSPFEAPHQSSNNNFHLMFGSPCDLASF  212

Query  415  DYSEGL---LGVPPLPKK-DILSWY  353
            D+ E +   +G+    K+ DI  WY
Sbjct  213  DFKEDMQQGVGMEAHQKQPDISIWY  237



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 11/101 (11%)
 Frame = -2

Query  622  FQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN-----VSSI  464
             Q  Q  + +NQG++  GN F  SN+SS+  MFT  + QF++ K +NSPF       ++ 
Sbjct  524  IQPQQDDYFRNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNN  583

Query  463  ETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
                 MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  584  NNFHLMFSSPFDLSTFDYKEEVPGVAAIDTLSKQQDIPLWY  624



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 15/105 (14%)
 Frame = -2

Query  622  FQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------  476
             Q  Q  + +NQGI+  GN F+ SN+SS+ PMF   + QF++ K +N+PF          
Sbjct  524  IQPQQDEYFRNQGIMMEGNFFEGSNVSSSHPMFPRDEGQFDRFKPMNTPFENNHHQHNHN  583

Query  475  VSSIETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
             ++      MFG PF+L   DY E + G   +     ++DI  WY
Sbjct  584  HNNNNNFHLMFGSPFDLSTFDYKEEVPGAAAIDTLSKQQDIPLWY  628



>gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 16/106 (15%)
 Frame = -2

Query  622  FQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------  476
             Q  Q  + +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF          
Sbjct  524  IQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNN  583

Query  475  -VSSIETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
              ++      MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  584  NNNNNNNFHLMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  629



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -2

Query  622  FQCHQGGFLQNQGIIPGNIFQ--ESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP  452
            FQ   G + Q  G++ GN     ++NI S   +F S D QF+Q KA +S  + +  + + 
Sbjct  528  FQMDDGFYSQGSGVMGGNTNAPLQTNIPSHHAVFPSSDVQFDQCKAFDSSLDNNPTDNIS  587

Query  451  -FMFGPPFNLPPSDYSEGLLGVPPLPKKDILSWY  353
               FG PFNL P++Y+     V  LPK+D+  WY
Sbjct  588  DIRFGSPFNLAPAEYT-----VDSLPKQDVSLWY  616



>ref|XP_004171661.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=632

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 18/108 (17%)
 Frame = -2

Query  622  FQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------  476
             Q  Q  + +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF          
Sbjct  524  IQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNN  583

Query  475  ---VSSIETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
                ++      MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  584  NNNNNNNNNFHLMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  631



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 5/79 (6%)
 Frame = -2

Query  574  GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV--SSIETLPFMFGPPFNLPPSDYSE  404
            GN F++S++ +   MF  G+ QF++ K LNS F    ++  + P MFG PF+L   DY E
Sbjct  536  GNFFEDSSMPNNHQMFPQGEGQFDRFKGLNSLFETEHNNNNSFPLMFGSPFDLSTFDYKE  595

Query  403  GL--LGVPPLPKKDILSWY  353
             L  +G+  +P++D+  W+
Sbjct  596  DLQTVGMDTIPRQDVSIWF  614



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = -2

Query  601  FLQNQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFN  428
            ++  QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  PF 
Sbjct  531  YIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASPFY  590

Query  427  LPPSDYSEGLLGVPPLPKKDILS  359
            LP  DY E L   P LP+ D LS
Sbjct  591  LPSVDYPEHL---PGLPRGDTLS  610



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 9/99 (9%)
 Frame = -2

Query  631  KPTFQCHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS---SI  464
            +P  Q  Q  F + QG+   + F ESNI +   +   G+ QF+Q K  NSPF  +   + 
Sbjct  539  QPKTQQQQDEFFRGQGL---SFFNESNIPANNQILPQGEAQFDQLKTSNSPFETTYNNNN  595

Query  463  ETLPFMFGPPFNLPPSDYSEGLL--GVPPLPKKDILSWY  353
                 MFG PF+L   DY++ L   G+  +PK+D+  W+
Sbjct  596  NGFKLMFGSPFDLSSFDYNDDLQADGMDAMPKQDVSIWF  634



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = -2

Query  601  FLQNQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFN  428
            ++  QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  PF 
Sbjct  531  YIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASPFY  590

Query  427  LPPSDYSEGLLGVPPLPKKDILS  359
            LP  DY E L   P LP+ D LS
Sbjct  591  LPSVDYPEHL---PGLPRGDTLS  610



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 8/108 (7%)
 Frame = -2

Query  667  GTLDLLKNNLFNKPTFQCHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKA  494
            GTL+ ++N+   +  +Q         QG++  GNI +++NISS   +F S + QF+Q KA
Sbjct  504  GTLNAMENHNPAQQKYQFQIDDSYFGQGVVMGGNIPEQANISSQNAVFPSTEVQFDQCKA  563

Query  493  LNSPF-NVSSIETLPFMFGPPFNLPPSDYSEGLLGVPPLPKKDILSWY  353
             +SPF N  +   +   F  PFN+ P ++      V  LPK+D+  WY
Sbjct  564  FDSPFDNNPNDNIVDLRFSSPFNMAPVEFP-----VDSLPKQDVSLWY  606



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (48%), Gaps = 21/111 (19%)
 Frame = -2

Query  622  FQCHQGGFLQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------  476
             Q  Q  + +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF          
Sbjct  524  IQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNN  583

Query  475  ------VSSIETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  353
                   ++      MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  584  NNNNNNNNNNNNFHLMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  634



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060