BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF033B16

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593728.1|  PREDICTED: probable receptor-like protein ki...    120   1e-44   Nicotiana tomentosiformis
ref|XP_009793441.1|  PREDICTED: probable receptor-like protein ki...    120   3e-44   Nicotiana sylvestris
emb|CDP15187.1|  unnamed protein product                                120   8e-44   Coffea canephora [robusta coffee]
ref|XP_010276545.1|  PREDICTED: probable receptor-like protein ki...    119   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006358542.1|  PREDICTED: probable receptor-like protein ki...    115   3e-42   Solanum tuberosum [potatoes]
ref|XP_010313851.1|  PREDICTED: probable receptor-like protein ki...    114   3e-42   Solanum lycopersicum
ref|XP_008370349.1|  PREDICTED: probable receptor-like protein ki...    114   5e-42   Malus domestica [apple tree]
ref|XP_004297081.1|  PREDICTED: probable receptor-like protein ki...    112   7e-42   Fragaria vesca subsp. vesca
ref|XP_002280159.1|  PREDICTED: probable receptor-like protein ki...    112   7e-42   Vitis vinifera
ref|XP_008246302.1|  PREDICTED: probable receptor-like protein ki...    112   1e-41   Prunus mume [ume]
ref|XP_009366039.1|  PREDICTED: probable receptor-like protein ki...    113   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_008388433.1|  PREDICTED: probable receptor-like protein ki...    111   3e-41   Malus domestica [apple tree]
ref|XP_004302336.1|  PREDICTED: probable receptor-like protein ki...    112   3e-41   Fragaria vesca subsp. vesca
ref|XP_007207381.1|  hypothetical protein PRUPE_ppa004429mg             111   3e-41   Prunus persica
ref|XP_009365468.1|  PREDICTED: probable receptor-like protein ki...    110   6e-41   Pyrus x bretschneideri [bai li]
ref|XP_010270970.1|  PREDICTED: probable receptor-like protein ki...    113   8e-41   Nelumbo nucifera [Indian lotus]
emb|CAN65734.1|  hypothetical protein VITISV_037750                     107   1e-40   Vitis vinifera
ref|XP_008223491.1|  PREDICTED: probable receptor-like protein ki...    108   3e-40   Prunus mume [ume]
ref|XP_010094892.1|  putative receptor-like protein kinase              109   4e-40   
ref|XP_010070090.1|  PREDICTED: probable receptor-like protein ki...    106   9e-40   Eucalyptus grandis [rose gum]
ref|XP_007223307.1|  hypothetical protein PRUPE_ppa004549mg             108   1e-39   Prunus persica
gb|KDP23343.1|  hypothetical protein JCGZ_23176                         104   2e-39   Jatropha curcas
ref|XP_010674509.1|  PREDICTED: probable receptor-like protein ki...    105   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006600404.1|  PREDICTED: probable receptor-like protein ki...    110   6e-39   Glycine max [soybeans]
gb|KHN03235.1|  Putative receptor-like protein kinase                   110   6e-39   Glycine soja [wild soybean]
ref|XP_011039031.1|  PREDICTED: probable receptor-like protein ki...    107   6e-39   Populus euphratica
ref|XP_006600403.1|  PREDICTED: probable receptor-like protein ki...    110   8e-39   Glycine max [soybeans]
ref|XP_006480375.1|  PREDICTED: probable receptor-like protein ki...    105   9e-39   Citrus sinensis [apfelsine]
ref|XP_007031244.1|  Interleukin-1 receptor-associated kinase, pu...    104   1e-38   
gb|AFK47437.1|  unknown                                                 110   1e-38   Medicago truncatula
ref|XP_006382268.1|  kinase family protein                              106   1e-38   Populus trichocarpa [western balsam poplar]
gb|KDO41830.1|  hypothetical protein CISIN_1g010653mg                   104   2e-38   Citrus sinensis [apfelsine]
ref|XP_002267270.1|  PREDICTED: probable receptor-like protein ki...    103   2e-38   Vitis vinifera
ref|XP_007154459.1|  hypothetical protein PHAVU_003G121000g             108   3e-38   Phaseolus vulgaris [French bean]
emb|CAN71111.1|  hypothetical protein VITISV_001481                     102   3e-38   Vitis vinifera
gb|KJB45483.1|  hypothetical protein B456_007G308900                    101   6e-38   Gossypium raimondii
gb|AES92067.2|  receptor-like kinase plant                              107   6e-38   Medicago truncatula
ref|XP_003609870.1|  Protein kinase domain containing protein exp...    107   7e-38   
ref|XP_003529491.1|  PREDICTED: probable receptor-like protein ki...    107   7e-38   Glycine max [soybeans]
ref|XP_010024866.1|  PREDICTED: probable receptor-like protein ki...    103   8e-38   Eucalyptus grandis [rose gum]
gb|KJB45484.1|  hypothetical protein B456_007G308900                    101   8e-38   Gossypium raimondii
gb|KEH37722.1|  receptor-like kinase plant                              106   7e-37   Medicago truncatula
ref|XP_006597074.1|  PREDICTED: receptor-like protein kinase 3-li...    103   9e-37   Glycine max [soybeans]
ref|XP_006597073.1|  PREDICTED: receptor-like protein kinase 3-li...    103   1e-36   
ref|XP_008367127.1|  PREDICTED: probable receptor-like protein ki...  97.8    1e-36   Malus domestica [apple tree]
ref|XP_009359782.1|  PREDICTED: probable receptor-like protein ki...  97.4    2e-36   Pyrus x bretschneideri [bai li]
gb|KDP28001.1|  hypothetical protein JCGZ_19081                         107   2e-36   Jatropha curcas
ref|XP_007138557.1|  hypothetical protein PHAVU_009G219300g             101   5e-36   Phaseolus vulgaris [French bean]
ref|NP_001238457.1|  receptor-like protein kinase 3-like                103   6e-36   
ref|XP_006587101.1|  PREDICTED: probable receptor-like protein ki...    103   7e-36   
ref|XP_006587102.1|  PREDICTED: probable receptor-like protein ki...    103   7e-36   
ref|XP_011023858.1|  PREDICTED: probable receptor-like protein ki...  95.5    7e-36   Populus euphratica
ref|XP_004508087.1|  PREDICTED: probable receptor-like protein ki...  99.0    7e-36   Cicer arietinum [garbanzo]
gb|KHN29771.1|  Putative receptor-like protein kinase                   103   8e-36   Glycine soja [wild soybean]
ref|XP_006587104.1|  PREDICTED: probable receptor-like protein ki...    103   8e-36   Glycine max [soybeans]
ref|XP_006587103.1|  PREDICTED: probable receptor-like protein ki...    103   8e-36   Glycine max [soybeans]
ref|XP_004488197.1|  PREDICTED: probable receptor-like protein ki...    100   9e-36   Cicer arietinum [garbanzo]
ref|XP_011087539.1|  PREDICTED: probable receptor-like protein ki...  98.6    9e-36   Sesamum indicum [beniseed]
gb|EMT12813.1|  Putative serine/threonine-protein kinase              97.4    2e-35   
emb|CDM82475.1|  unnamed protein product                              97.1    2e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011092198.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  95.1    2e-35   
ref|XP_009353418.1|  PREDICTED: probable receptor-like protein ki...  93.2    5e-35   Pyrus x bretschneideri [bai li]
ref|XP_003567627.1|  PREDICTED: probable receptor-like protein ki...  96.7    5e-35   
ref|XP_006488742.1|  PREDICTED: probable receptor-like protein ki...    106   6e-35   Citrus sinensis [apfelsine]
ref|XP_006419244.1|  hypothetical protein CICLE_v10004820mg             106   6e-35   Citrus clementina [clementine]
ref|XP_010914767.1|  PREDICTED: probable receptor-like protein ki...  92.0    7e-35   Elaeis guineensis
ref|XP_010091289.1|  putative receptor-like protein kinase            94.7    1e-34   
ref|XP_002318928.1|  kinase family protein                            92.0    2e-34   
ref|XP_008810332.1|  PREDICTED: probable receptor-like protein ki...  90.1    3e-34   Phoenix dactylifera
ref|XP_006644125.1|  PREDICTED: probable receptor-like protein ki...  92.4    3e-34   Oryza brachyantha
ref|XP_002455559.1|  hypothetical protein SORBIDRAFT_03g013130        94.7    3e-34   Sorghum bicolor [broomcorn]
gb|EEC70529.1|  hypothetical protein OsI_01645                        92.0    3e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001042894.1|  Os01g0323000                                     92.0    3e-34   
ref|XP_004252942.1|  PREDICTED: probable receptor-like protein ki...  93.6    4e-34   Solanum lycopersicum
ref|XP_009772905.1|  PREDICTED: probable receptor-like protein ki...  93.6    4e-34   Nicotiana sylvestris
ref|XP_008390361.1|  PREDICTED: probable receptor-like protein ki...  90.9    6e-34   
ref|XP_008390362.1|  PREDICTED: probable receptor-like protein ki...  90.9    7e-34   
ref|XP_004968653.1|  PREDICTED: probable receptor-like protein ki...  90.1    1e-33   Setaria italica
ref|XP_002512571.1|  Interleukin-1 receptor-associated kinase, pu...    110   2e-33   
ref|XP_010549255.1|  PREDICTED: probable receptor-like protein ki...  90.9    3e-33   
ref|XP_009407998.1|  PREDICTED: probable receptor-like protein ki...  85.5    6e-33   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85608.1|  predicted protein                                    91.3    7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010941477.1|  PREDICTED: probable receptor-like protein ki...  85.1    9e-33   Elaeis guineensis
dbj|BAJ88412.1|  predicted protein                                    90.1    1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011011317.1|  PREDICTED: probable receptor-like protein ki...    100   1e-32   Populus euphratica
ref|XP_007145035.1|  hypothetical protein PHAVU_007G204300g           88.6    2e-32   Phaseolus vulgaris [French bean]
ref|XP_010910396.1|  PREDICTED: probable receptor-like protein ki...  89.7    3e-32   Elaeis guineensis
ref|XP_007035974.1|  Kinase superfamily protein                       98.2    3e-32   Theobroma cacao [chocolate]
ref|XP_010910397.1|  PREDICTED: probable receptor-like protein ki...  89.4    4e-32   Elaeis guineensis
ref|XP_004495624.1|  PREDICTED: probable receptor-like protein ki...  83.2    4e-32   Cicer arietinum [garbanzo]
ref|XP_009625425.1|  PREDICTED: probable receptor-like protein ki...  85.9    8e-32   Nicotiana tomentosiformis
ref|NP_001130748.1|  LOC100191852                                     85.9    1e-31   Zea mays [maize]
ref|XP_008672049.1|  PREDICTED: LOC100191852 isoform X1               85.9    1e-31   Zea mays [maize]
tpg|DAA54435.1|  TPA: putative protein kinase superfamily protein     85.9    1e-31   
ref|XP_010672612.1|  PREDICTED: probable receptor-like protein ki...  89.0    2e-31   
gb|AFK44454.1|  unknown                                               82.4    2e-31   Lotus japonicus
ref|XP_010672611.1|  PREDICTED: probable receptor-like protein ki...  89.0    2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004494518.1|  PREDICTED: probable receptor-like protein ki...  82.0    4e-31   Cicer arietinum [garbanzo]
ref|XP_003521648.1|  PREDICTED: probable receptor-like protein ki...  81.3    5e-31   Glycine max [soybeans]
ref|XP_003626158.1|  hypothetical protein MTR_7g111690                81.6    6e-31   Medicago truncatula
ref|XP_009398688.1|  PREDICTED: probable receptor-like protein ki...  83.2    8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009148240.1|  PREDICTED: probable receptor-like protein ki...  85.9    3e-30   Brassica rapa
emb|CDY64751.1|  BnaA06g37910D                                        85.9    3e-30   Brassica napus [oilseed rape]
ref|XP_006417572.1|  hypothetical protein EUTSA_v10007579mg           84.0    3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010458229.1|  PREDICTED: probable receptor-like protein ki...  83.2    4e-30   Camelina sativa [gold-of-pleasure]
emb|CDX94971.1|  BnaC05g07000D                                        85.1    4e-30   
ref|XP_010475775.1|  PREDICTED: probable receptor-like protein ki...  83.2    4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010489978.1|  PREDICTED: probable receptor-like protein ki...  83.2    4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008800690.1|  PREDICTED: probable receptor-like protein ki...  83.2    6e-30   Phoenix dactylifera
ref|XP_007163295.1|  hypothetical protein PHAVU_001G222700g           80.1    6e-30   Phaseolus vulgaris [French bean]
emb|CDO98700.1|  unnamed protein product                              84.3    8e-30   Coffea canephora [robusta coffee]
ref|XP_007048877.1|  Kinase superfamily protein                       78.6    1e-29   
ref|XP_004138595.1|  PREDICTED: probable receptor-like protein ki...  81.6    1e-29   Cucumis sativus [cucumbers]
gb|KHG07145.1|  hypothetical protein F383_33874                       80.1    1e-29   Gossypium arboreum [tree cotton]
gb|KJB28776.1|  hypothetical protein B456_005G071600                  89.4    1e-29   Gossypium raimondii
gb|KJB75408.1|  hypothetical protein B456_012G040400                  80.1    2e-29   Gossypium raimondii
ref|XP_002300876.1|  kinase family protein                            79.0    3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010924307.1|  PREDICTED: probable receptor-like protein ki...  80.5    4e-29   Elaeis guineensis
ref|XP_011026246.1|  PREDICTED: probable receptor-like protein ki...  79.0    4e-29   Populus euphratica
gb|KHN26187.1|  Putative receptor-like protein kinase                 80.1    4e-29   Glycine soja [wild soybean]
ref|XP_006605287.1|  PREDICTED: receptor protein kinase isoform X1    80.1    4e-29   Glycine max [soybeans]
ref|XP_008458290.1|  PREDICTED: probable receptor-like protein ki...  79.0    5e-29   Cucumis melo [Oriental melon]
ref|XP_010458230.1|  PREDICTED: probable receptor-like protein ki...  79.3    6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006428296.1|  hypothetical protein CICLE_v100116733mg          82.4    6e-29   
ref|NP_001238381.1|  receptor protein kinase                          80.5    6e-29   Glycine max [soybeans]
ref|XP_002315464.2|  hypothetical protein POPTR_0010s00400g           87.4    8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010999309.1|  PREDICTED: probable receptor-like protein ki...  87.4    8e-29   Populus euphratica
ref|XP_010549295.1|  PREDICTED: probable receptor-like protein ki...  78.6    1e-28   Tarenaya hassleriana [spider flower]
gb|KDO60973.1|  hypothetical protein CISIN_1g010519mg                 77.8    1e-28   Citrus sinensis [apfelsine]
ref|XP_006484873.1|  PREDICTED: probable receptor-like protein ki...  77.8    1e-28   Citrus sinensis [apfelsine]
ref|XP_010243707.1|  PREDICTED: probable receptor-like protein ki...  82.8    1e-28   Nelumbo nucifera [Indian lotus]
gb|AES92068.2|  receptor-like kinase plant                            77.4    2e-28   Medicago truncatula
ref|XP_008807804.1|  PREDICTED: probable receptor-like protein ki...  82.4    2e-28   Phoenix dactylifera
ref|XP_011044777.1|  PREDICTED: probable receptor-like protein ki...  77.0    2e-28   Populus euphratica
emb|CDX92604.1|  BnaA10g16430D                                        89.7    2e-28   
ref|XP_003609871.1|  Protein kinase domain containing protein exp...  77.4    2e-28   
ref|XP_002307552.2|  kinase family protein                            77.0    2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002526652.1|  ATP binding protein, putative                    78.6    2e-28   Ricinus communis
ref|NP_564722.1|  protein kinase                                      80.1    2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892506.1|  hypothetical protein ARALYDRAFT_311987           77.0    3e-28   
ref|XP_006437163.1|  hypothetical protein CICLE_v10031290mg           77.4    3e-28   Citrus clementina [clementine]
gb|AAM65034.1|  Putative protein kinase                               80.1    3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAG09092.1|AC009323_3  Putative protein kinase                     80.1    3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131671.1|  PREDICTED: probable receptor-like protein ki...  88.6    3e-28   Brassica rapa
ref|XP_009394806.1|  PREDICTED: probable receptor-like protein ki...  79.7    3e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88934.1|  BnaA03g07150D                                        88.6    3e-28   
gb|AAC33204.1|  Putative protein kinase                               76.6    4e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70823.1|  BnaC03g09070D                                        88.2    4e-28   
ref|XP_010275616.1|  PREDICTED: probable receptor-like protein ki...  81.6    5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002519317.1|  conserved hypothetical protein                   99.8    5e-28   
ref|XP_009120967.1|  PREDICTED: probable receptor-like protein ki...  87.8    6e-28   Brassica rapa
ref|XP_003536030.1|  PREDICTED: probable receptor-like protein ki...  79.7    6e-28   Glycine max [soybeans]
ref|XP_010546937.1|  PREDICTED: probable receptor-like protein ki...  90.9    7e-28   Tarenaya hassleriana [spider flower]
ref|XP_010558464.1|  PREDICTED: probable receptor-like protein ki...  87.4    7e-28   Tarenaya hassleriana [spider flower]
emb|CDY63248.1|  BnaCnng41740D                                        87.8    7e-28   Brassica napus [oilseed rape]
ref|XP_006380205.1|  hypothetical protein POPTR_0008s22920g           85.9    8e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010926408.1|  PREDICTED: probable receptor-like protein ki...  77.8    1e-27   Elaeis guineensis
ref|XP_004303875.1|  PREDICTED: probable receptor-like protein ki...  75.9    1e-27   Fragaria vesca subsp. vesca
ref|XP_010926424.1|  PREDICTED: probable receptor-like protein ki...  77.4    1e-27   Elaeis guineensis
ref|XP_010511315.1|  PREDICTED: probable receptor-like protein ki...  80.1    1e-27   
ref|XP_002894669.1|  kinase family protein                            80.1    1e-27   
ref|XP_010415021.1|  PREDICTED: probable receptor-like protein ki...  80.1    1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007216751.1|  hypothetical protein PRUPE_ppa024910mg           76.6    2e-27   
ref|XP_008342350.1|  PREDICTED: probable receptor-like protein ki...  77.4    2e-27   Malus domestica [apple tree]
ref|XP_009377357.1|  PREDICTED: probable receptor-like protein ki...  77.4    2e-27   Pyrus x bretschneideri [bai li]
ref|XP_006301386.1|  hypothetical protein CARUB_v10021799mg           80.1    2e-27   Capsella rubella
ref|XP_008229427.1|  PREDICTED: probable receptor-like protein ki...  76.3    3e-27   Prunus mume [ume]
ref|XP_008797511.1|  PREDICTED: probable receptor-like protein ki...  75.5    3e-27   Phoenix dactylifera
gb|KDP38903.1|  hypothetical protein JCGZ_05288                       77.0    3e-27   Jatropha curcas
gb|KJB38676.1|  hypothetical protein B456_006G266500                  80.9    4e-27   Gossypium raimondii
ref|XP_006392400.1|  hypothetical protein EUTSA_v10023423mg           79.0    4e-27   Eutrema salsugineum [saltwater cress]
ref|XP_011082904.1|  PREDICTED: probable receptor-like protein ki...  76.6    9e-27   Sesamum indicum [beniseed]
ref|XP_008797510.1|  PREDICTED: probable receptor-like protein ki...  73.9    1e-26   
ref|XP_010544138.1|  PREDICTED: probable receptor-like protein ki...  89.0    2e-26   Tarenaya hassleriana [spider flower]
ref|XP_002283589.2|  PREDICTED: probable receptor-like protein ki...  75.5    2e-26   Vitis vinifera
emb|CBI22107.3|  unnamed protein product                              75.9    2e-26   Vitis vinifera
gb|KGN45621.1|  hypothetical protein Csa_6G000690                     82.0    2e-26   Cucumis sativus [cucumbers]
emb|CAH55606.1|  putative protein kinase                              73.2    3e-26   Zea mays [maize]
ref|XP_008670010.1|  PREDICTED: probable receptor-like protein ki...  73.2    3e-26   
ref|XP_006840316.1|  hypothetical protein AMTR_s00045p00079270        84.0    3e-26   
ref|XP_006287624.1|  hypothetical protein CARUB_v10000836mg           82.4    3e-26   
ref|XP_010454092.1|  PREDICTED: probable receptor-like protein ki...  82.0    3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009356614.1|  PREDICTED: probable receptor-like protein ki...  76.3    4e-26   Pyrus x bretschneideri [bai li]
ref|XP_009410960.1|  PREDICTED: probable receptor-like protein ki...  73.6    4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053573.1|  PREDICTED: probable receptor-like protein ki...  73.2    5e-26   Eucalyptus grandis [rose gum]
emb|CDP11896.1|  unnamed protein product                              83.2    5e-26   Coffea canephora [robusta coffee]
ref|XP_002459575.1|  hypothetical protein SORBIDRAFT_02g006870        74.3    6e-26   Sorghum bicolor [broomcorn]
ref|XP_010688888.1|  PREDICTED: probable receptor-like protein ki...  76.3    7e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009113370.1|  PREDICTED: probable receptor-like protein ki...  79.3    7e-26   Brassica rapa
emb|CDY66239.1|  BnaCnng50120D                                        79.3    8e-26   Brassica napus [oilseed rape]
ref|XP_010420613.1|  PREDICTED: probable receptor-like protein ki...  80.5    9e-26   Camelina sativa [gold-of-pleasure]
emb|CDX95286.1|  BnaC09g15840D                                        79.3    1e-25   
ref|XP_004139824.1|  PREDICTED: probable receptor-like protein ki...  75.5    1e-25   Cucumis sativus [cucumbers]
ref|XP_006662656.1|  PREDICTED: probable receptor-like protein ki...  72.4    1e-25   Oryza brachyantha
ref|XP_006644104.1|  PREDICTED: probable receptor-like protein ki...  72.4    1e-25   Oryza brachyantha
ref|XP_008358013.1|  PREDICTED: probable receptor-like protein ki...  76.3    1e-25   
ref|XP_008447129.1|  PREDICTED: probable receptor-like protein ki...  75.5    1e-25   
ref|XP_002871819.1|  kinase family protein                            80.1    1e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_007141407.1|  hypothetical protein PHAVU_008G192900g           75.1    1e-25   Phaseolus vulgaris [French bean]
ref|XP_004516932.1|  PREDICTED: probable receptor-like protein ki...  74.3    2e-25   Cicer arietinum [garbanzo]
ref|XP_006400399.1|  hypothetical protein EUTSA_v10013401mg           80.1    2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_004491330.1|  PREDICTED: probable receptor-like protein ki...  74.3    2e-25   Cicer arietinum [garbanzo]
ref|XP_009396002.1|  PREDICTED: probable receptor-like protein ki...  74.3    2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010102143.1|  putative receptor-like protein kinase            73.6    2e-25   Morus notabilis
ref|XP_010524108.1|  PREDICTED: probable receptor-like protein ki...  73.6    3e-25   
ref|XP_010555340.1|  PREDICTED: probable receptor-like protein ki...  78.6    3e-25   Tarenaya hassleriana [spider flower]
ref|XP_010524107.1|  PREDICTED: probable receptor-like protein ki...  73.6    3e-25   
ref|XP_010524101.1|  PREDICTED: probable receptor-like protein ki...  73.6    3e-25   
ref|XP_009126257.1|  PREDICTED: probable receptor-like protein ki...  79.0    4e-25   Brassica rapa
emb|CDY58111.1|  BnaA02g35130D                                        79.0    4e-25   Brassica napus [oilseed rape]
ref|XP_010555265.1|  PREDICTED: probable receptor-like protein ki...  78.6    4e-25   Tarenaya hassleriana [spider flower]
gb|EEC67522.1|  hypothetical protein OsI_34817                        72.8    6e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_197351.1|  probable receptor-like protein kinase               77.8    6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003599843.1|  hypothetical protein MTR_3g047890                72.4    7e-25   Medicago truncatula
gb|EEC68703.1|  hypothetical protein OsI_37182                        72.4    7e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_002440368.1|  hypothetical protein SORBIDRAFT_09g030440        71.2    7e-25   Sorghum bicolor [broomcorn]
gb|EEE52619.1|  hypothetical protein OsJ_34956                        72.4    7e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91125.2|  Protein kinase domain containing protein, expressed   72.4    7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003617422.1|  Receptor-like protein kinase                     74.3    7e-25   
ref|XP_003551921.1|  PREDICTED: probable receptor-like protein ki...  74.3    8e-25   Glycine max [soybeans]
gb|KHN18088.1|  Putative receptor-like protein kinase                 74.3    8e-25   Glycine soja [wild soybean]
ref|NP_001065949.1|  Os12g0108100                                     72.0    9e-25   
ref|XP_010035923.1|  PREDICTED: probable receptor-like protein ki...  72.4    9e-25   Eucalyptus grandis [rose gum]
ref|XP_006661911.1|  PREDICTED: probable receptor-like protein ki...  70.9    9e-25   Oryza brachyantha
ref|NP_172415.2|  protein kinase family protein                       75.9    1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411599.1|  PREDICTED: probable receptor-like protein ki...  70.5    1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28778.1|  hypothetical protein B456_005G071600                  72.4    2e-24   Gossypium raimondii
gb|AFW79385.1|  putative protein kinase superfamily protein           71.2    2e-24   
gb|ACR36632.1|  unknown                                               71.2    2e-24   Zea mays [maize]
emb|CAH39851.1|  putative protein kinase                              71.2    2e-24   Zea mays [maize]
ref|XP_004955836.1|  PREDICTED: probable receptor-like protein ki...  70.1    2e-24   Setaria italica
ref|NP_001105820.1|  putative protein kinase                          70.9    2e-24   Zea mays [maize]
ref|XP_011026247.1|  PREDICTED: probable receptor-like protein ki...  76.6    2e-24   Populus euphratica
ref|XP_004961033.1|  PREDICTED: probable receptor-like protein ki...  70.5    3e-24   
ref|XP_007146341.1|  hypothetical protein PHAVU_006G032300g           70.1    4e-24   Phaseolus vulgaris [French bean]
ref|XP_006595756.1|  PREDICTED: probable receptor-like protein ki...  74.7    4e-24   Glycine max [soybeans]
ref|NP_001064960.1|  Os10g0497600                                     72.0    4e-24   
gb|KHN11969.1|  Putative receptor-like protein kinase                 74.7    4e-24   Glycine soja [wild soybean]
gb|EPS72812.1|  hypothetical protein M569_01940                       75.9    5e-24   Genlisea aurea
ref|NP_191470.1|  protein kinase family protein                       71.2    6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142894.1|  PREDICTED: probable receptor-like protein ki...  72.4    7e-24   Brassica rapa
emb|CDY53651.1|  BnaC04g52850D                                        72.4    7e-24   Brassica napus [oilseed rape]
gb|KHN38324.1|  Putative receptor-like protein kinase                 73.9    7e-24   Glycine soja [wild soybean]
ref|XP_006575654.1|  PREDICTED: probable receptor-like protein ki...  73.9    7e-24   Glycine max [soybeans]
emb|CDX79837.1|  BnaA05g03190D                                        72.4    8e-24   
ref|XP_006575659.1|  PREDICTED: probable receptor-like protein ki...  73.9    8e-24   Glycine max [soybeans]
gb|EPS65102.1|  hypothetical protein M569_09677                       73.9    9e-24   Genlisea aurea
ref|XP_002440788.1|  hypothetical protein SORBIDRAFT_09g006610        72.8    1e-23   Sorghum bicolor [broomcorn]
ref|NP_181825.1|  putative receptor-like protein kinase               72.4    1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586072.1|  PREDICTED: probable receptor-like protein ki...  70.5    1e-23   Glycine max [soybeans]
gb|KHM99632.1|  Putative receptor-like protein kinase                 70.5    1e-23   Glycine soja [wild soybean]
ref|XP_009798431.1|  PREDICTED: probable receptor-like protein ki...  75.1    2e-23   Nicotiana sylvestris
dbj|BAF00936.1|  Ser/Thr specific protein kinase like protein         75.9    2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071324.1|  PREDICTED: probable receptor-like protein ki...  76.3    2e-23   Sesamum indicum [beniseed]
ref|XP_008649473.1|  PREDICTED: probable receptor-like protein ki...  71.6    2e-23   Zea mays [maize]
ref|XP_004960621.1|  PREDICTED: probable receptor-like protein ki...  72.0    2e-23   Setaria italica
ref|XP_010480284.1|  PREDICTED: probable receptor-like protein ki...  80.1    2e-23   Camelina sativa [gold-of-pleasure]
gb|EEE51214.1|  hypothetical protein OsJ_32036                        72.0    2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58279.1|AC068923_21  putative kinase                            72.0    2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006290922.1|  hypothetical protein CARUB_v10017038mg           72.4    2e-23   Capsella rubella
gb|ABA96204.1|  pentatricopeptide, putative                           75.5    2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010558470.1|  PREDICTED: probable receptor-like protein ki...  71.6    3e-23   
ref|XP_009615723.1|  PREDICTED: probable receptor-like protein ki...  74.7    3e-23   Nicotiana tomentosiformis
ref|XP_006663731.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-23   
ref|XP_011098386.1|  PREDICTED: probable receptor-like protein ki...  74.3    3e-23   
emb|CDM83465.1|  unnamed protein product                              69.3    3e-23   Triticum aestivum [Canadian hard winter wheat]
emb|CDY06022.1|  BnaA09g37580D                                        72.8    4e-23   
gb|EAZ19413.1|  hypothetical protein OsJ_34968                        75.1    4e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF01042.1|  receptor-like protein kinase                         71.2    4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67247.1|  hypothetical protein OsI_34186                        71.2    4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010512145.1|  PREDICTED: probable receptor-like protein ki...  70.9    5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009116584.1|  PREDICTED: probable receptor-like protein ki...  72.8    6e-23   Brassica rapa
ref|XP_004243208.1|  PREDICTED: probable receptor-like protein ki...  73.6    6e-23   Solanum lycopersicum
ref|XP_009416546.1|  PREDICTED: probable receptor-like protein ki...  70.9    6e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF69953.1|  protein kinase family protein                         70.9    7e-23   Musa acuminata [banana]
ref|XP_010517847.1|  PREDICTED: probable receptor-like protein ki...  72.4    7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006402719.1|  hypothetical protein EUTSA_v10005898mg           72.8    8e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006294056.1|  hypothetical protein CARUB_v10023054mg           72.4    8e-23   
ref|XP_010506149.1|  PREDICTED: probable receptor-like protein ki...  72.4    8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010413743.1|  PREDICTED: probable receptor-like protein ki...  70.9    9e-23   
ref|XP_006348958.1|  PREDICTED: probable receptor-like protein ki...  72.8    1e-22   
ref|XP_010469363.1|  PREDICTED: probable receptor-like protein ki...  70.9    1e-22   
emb|CDX71912.1|  BnaC08g29620D                                        72.8    2e-22   
ref|XP_001783289.1|  predicted protein                                68.2    2e-22   
ref|XP_002982189.1|  hypothetical protein SELMODRAFT_179365           70.5    2e-22   
ref|XP_004145735.1|  PREDICTED: probable receptor-like protein ki...  68.2    3e-22   
ref|XP_010508490.1|  PREDICTED: probable receptor-like protein ki...  69.3    3e-22   
ref|XP_002966111.1|  hypothetical protein SELMODRAFT_85374            70.5    3e-22   
ref|XP_002881882.1|  predicted protein                                72.8    4e-22   
dbj|BAJ85729.1|  predicted protein                                    67.4    4e-22   
ref|XP_002976451.1|  hypothetical protein SELMODRAFT_105160           71.2    7e-22   
ref|XP_008456348.1|  PREDICTED: probable receptor-like protein ki...  67.8    8e-22   
emb|CDP06160.1|  unnamed protein product                              73.2    9e-22   
emb|CDX98349.1|  BnaC06g17100D                                        66.2    1e-21   
ref|XP_009382462.1|  PREDICTED: probable receptor-like protein ki...  67.8    1e-21   
ref|XP_010525575.1|  PREDICTED: probable receptor-like protein ki...  72.0    1e-21   
ref|XP_001785967.1|  predicted protein                                68.2    1e-21   
gb|EMT05604.1|  Putative serine/threonine-protein kinase              65.1    2e-21   
ref|XP_003577900.1|  PREDICTED: probable receptor-like protein ki...  68.6    4e-21   
dbj|BAJ89946.1|  predicted protein                                    68.2    5e-21   
gb|AFK41564.1|  unknown                                               84.3    6e-21   
ref|XP_003569411.1|  PREDICTED: probable receptor-like protein ki...  67.8    6e-21   
ref|XP_009406282.1|  PREDICTED: probable receptor-like protein ki...  71.2    7e-21   
ref|XP_002876490.1|  kinase family protein                            65.5    9e-21   
ref|XP_009406279.1|  PREDICTED: probable receptor-like protein ki...  71.2    9e-21   
ref|XP_002971265.1|  hypothetical protein SELMODRAFT_171909           66.6    9e-21   
ref|XP_008453191.1|  PREDICTED: probable receptor-like protein ki...  72.4    1e-20   
ref|XP_006644402.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-20   
ref|XP_009406281.1|  PREDICTED: probable receptor-like protein ki...  71.2    1e-20   
gb|EMT04589.1|  Putative serine/threonine-protein kinase              67.8    1e-20   
gb|ACL52597.1|  unknown                                               64.7    2e-20   
ref|NP_001145793.1|  uncharacterized LOC100279300                     64.7    2e-20   
gb|AGT17266.1|  hypothetical protein SHCRBa_022_D05_R_300             63.5    3e-20   
ref|NP_001043648.1|  Os01g0631700                                     63.2    3e-20   
gb|AGT16797.1|  ATP binding protein                                   63.5    4e-20   
ref|XP_002961551.1|  hypothetical protein SELMODRAFT_77393            66.2    4e-20   
ref|XP_002456009.1|  hypothetical protein SORBIDRAFT_03g028800        63.2    4e-20   
ref|XP_009104186.1|  PREDICTED: probable receptor-like protein ki...  66.2    4e-20   
ref|XP_006411569.1|  hypothetical protein EUTSA_v10017807mg           69.7    5e-20   
gb|KJB12699.1|  hypothetical protein B456_002G031900                  63.2    5e-20   
emb|CDX67778.1|  BnaA07g18180D                                        66.2    5e-20   
emb|CDX92131.1|  BnaA05g22760D                                        75.9    5e-20   
ref|XP_009146013.1|  PREDICTED: probable receptor-like protein ki...  75.5    6e-20   
gb|EPS70226.1|  hypothetical protein M569_04534                       62.8    1e-19   
emb|CDX95853.1|  BnaC05g36040D                                        74.7    1e-19   
gb|EEC68713.1|  hypothetical protein OsI_37195                        67.8    1e-19   
ref|XP_010263506.1|  PREDICTED: probable serine/threonine-protein...  63.2    1e-19   
gb|AFK38528.1|  unknown                                               65.1    2e-19   
ref|XP_003622458.1|  hypothetical protein MTR_7g037990                65.1    2e-19   
ref|XP_003548643.1|  PREDICTED: probable serine/threonine-protein...  63.5    2e-19   
ref|XP_004969248.1|  PREDICTED: probable receptor-like protein ki...  62.0    2e-19   
gb|KHN46701.1|  Putative serine/threonine-protein kinase              63.5    2e-19   
ref|XP_006829016.1|  hypothetical protein AMTR_s00001p00248610        62.8    3e-19   
gb|KGN61025.1|  hypothetical protein Csa_2G034780                     69.7    3e-19   
ref|XP_011093121.1|  PREDICTED: probable serine/threonine-protein...  66.6    3e-19   
ref|XP_006339616.1|  PREDICTED: probable serine/threonine-protein...  66.6    3e-19   
ref|NP_001235315.1|  protein kinase family protein                    62.4    3e-19   
ref|XP_003633957.1|  PREDICTED: probable serine/threonine-protein...  61.2    3e-19   
ref|XP_004229894.1|  PREDICTED: probable serine/threonine-protein...  66.2    3e-19   
gb|KHN26930.1|  Putative serine/threonine-protein kinase              62.8    4e-19   
ref|XP_008649474.1|  PREDICTED: probable receptor-like protein ki...  71.6    4e-19   
ref|XP_004173507.1|  PREDICTED: probable receptor-like protein ki...  68.9    5e-19   
ref|XP_010112173.1|  putative serine/threonine-protein kinase         62.8    6e-19   
ref|XP_010556568.1|  PREDICTED: probable serine/threonine-protein...  64.3    6e-19   
ref|XP_004144803.1|  PREDICTED: probable receptor-like protein ki...  69.3    6e-19   
ref|XP_002874989.1|  predicted protein                                62.4    8e-19   
ref|XP_002862255.1|  predicted protein                                63.2    8e-19   
ref|XP_011458923.1|  PREDICTED: probable serine/threonine-protein...  63.2    9e-19   
emb|CDY15170.1|  BnaC05g00490D                                        63.9    1e-18   
ref|XP_006358586.1|  PREDICTED: probable receptor-like protein ki...  79.7    1e-18   
ref|XP_006358587.1|  PREDICTED: probable receptor-like protein ki...  79.0    1e-18   
ref|XP_006358588.1|  PREDICTED: probable receptor-like protein ki...  79.0    1e-18   
ref|XP_008675251.1|  PREDICTED: probable receptor-like protein ki...  64.7    1e-18   
ref|XP_009119704.1|  PREDICTED: probable serine/threonine-protein...  63.9    1e-18   
ref|XP_010652807.1|  PREDICTED: probable serine/threonine-protein...  63.5    1e-18   
ref|NP_001043791.1|  Os01g0664200                                     63.5    2e-18   
emb|CBI21413.3|  unnamed protein product                              63.5    2e-18   
ref|XP_011074389.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-18   
ref|XP_004492785.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-18   
ref|NP_188368.2|  glyoxysomal protein kinase 1                        68.2    2e-18   
gb|EPS65809.1|  hypothetical protein M569_08968                       62.0    2e-18   
ref|XP_006303639.1|  hypothetical protein CARUB_v10011595mg           63.5    3e-18   
ref|XP_006856018.1|  hypothetical protein AMTR_s00059p00049260        64.3    3e-18   
ref|XP_004156368.1|  PREDICTED: probable serine/threonine-protein...  62.4    3e-18   
ref|XP_008444605.1|  PREDICTED: probable serine/threonine-protein...  62.4    3e-18   
ref|XP_011092804.1|  PREDICTED: probable serine/threonine-protein...  63.2    3e-18   
ref|XP_003624053.1|  Protein kinase family protein                    60.8    3e-18   
gb|KDP28584.1|  hypothetical protein JCGZ_14355                       60.5    3e-18   
ref|XP_002885210.1|  hypothetical protein ARALYDRAFT_479218           66.6    3e-18   
ref|XP_002510192.1|  Serine/threonine-protein kinase PBS1, putative   65.9    3e-18   
ref|XP_004969447.1|  PREDICTED: probable receptor-like protein ki...  63.9    3e-18   
ref|NP_192042.5|  protein kinase family protein                       62.4    3e-18   
ref|XP_009767889.1|  PREDICTED: probable serine/threonine-protein...  62.0    4e-18   
ref|XP_010555148.1|  PREDICTED: probable receptor-like protein ki...  66.2    4e-18   
dbj|BAJ91013.1|  predicted protein                                    67.4    4e-18   
gb|AAK56254.1|AF367265_1  At1g01540/F22L4_6                           63.2    4e-18   
ref|XP_006418432.1|  hypothetical protein EUTSA_v10007528mg           63.2    4e-18   
ref|XP_003552413.1|  PREDICTED: probable serine/threonine-protein...  60.8    4e-18   
ref|NP_001190651.1|  protein kinase family protein                    62.4    4e-18   
ref|XP_002458272.1|  hypothetical protein SORBIDRAFT_03g030400        63.2    4e-18   
gb|KFK42539.1|  hypothetical protein AALP_AA1G007600                  62.8    4e-18   
ref|NP_171661.1|  putative serine/threonine-protein kinase            62.8    5e-18   
ref|XP_010465791.1|  PREDICTED: probable receptor-like protein ki...  65.9    5e-18   
ref|XP_002892058.1|  kinase family protein                            62.8    5e-18   
gb|EYU36349.1|  hypothetical protein MIMGU_mgv1a005189mg              66.2    5e-18   
ref|XP_010457114.1|  PREDICTED: probable serine/threonine-protein...  63.2    5e-18   
ref|XP_006297612.1|  hypothetical protein CARUB_v10013633mg           67.4    5e-18   
ref|XP_010480177.1|  PREDICTED: probable serine/threonine-protein...  62.8    5e-18   
gb|AAF81312.1|AC061957_8  Contains a strong similarity to an unkn...  62.8    5e-18   
ref|XP_006444971.1|  hypothetical protein CICLE_v10019913mg           63.5    5e-18   
ref|XP_006444970.1|  hypothetical protein CICLE_v10019913mg           63.9    5e-18   
ref|XP_008241473.1|  PREDICTED: probable serine/threonine-protein...  60.8    5e-18   
ref|XP_010474755.1|  PREDICTED: probable serine/threonine-protein...  62.8    5e-18   
ref|XP_009118815.1|  PREDICTED: probable serine/threonine-protein...  61.6    6e-18   
ref|XP_009411430.1|  PREDICTED: probable serine/threonine-protein...  62.4    6e-18   
gb|KFK30714.1|  hypothetical protein AALP_AA6G017900                  62.0    6e-18   
ref|XP_006396277.1|  hypothetical protein EUTSA_v10028635mg           62.8    6e-18   
gb|KDP41708.1|  hypothetical protein JCGZ_16115                       65.1    6e-18   
ref|XP_006342633.1|  PREDICTED: probable serine/threonine-protein...  60.5    6e-18   
gb|KFK30713.1|  hypothetical protein AALP_AA6G017900                  62.0    6e-18   
ref|XP_010669936.1|  PREDICTED: probable serine/threonine-protein...  61.2    6e-18   
ref|XP_007047293.1|  Serine/threonine-protein kinase isoform 3        61.2    6e-18   
emb|CDX70782.1|  BnaC03g08660D                                        60.8    7e-18   
ref|XP_007047291.1|  Serine/threonine-protein kinase isoform 1        61.2    7e-18   
ref|XP_011029604.1|  PREDICTED: probable serine/threonine-protein...  63.2    7e-18   
ref|NP_001065959.1|  Os12g0109800                                     60.8    8e-18   
ref|XP_009111450.1|  PREDICTED: probable serine/threonine-protein...  63.5    8e-18   
ref|XP_004511920.1|  PREDICTED: probable serine/threonine-protein...  60.1    8e-18   
ref|XP_007047292.1|  Kinase superfamily protein isoform 2             61.6    8e-18   
ref|XP_009604560.1|  PREDICTED: probable serine/threonine-protein...  61.6    8e-18   
emb|CDY48518.1|  BnaA09g00050D                                        63.5    8e-18   
emb|CDX90040.1|  BnaA10g00420D                                        63.9    8e-18   
ref|XP_009792774.1|  PREDICTED: probable serine/threonine-protein...  61.6    9e-18   
ref|XP_007139796.1|  hypothetical protein PHAVU_008G059400g           63.5    9e-18   
ref|XP_004155835.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  62.8    9e-18   
ref|XP_007135125.1|  hypothetical protein PHAVU_010G103100g           63.5    9e-18   
ref|XP_009111449.1|  PREDICTED: probable serine/threonine-protein...  63.5    9e-18   
emb|CDY07192.1|  BnaCnng02070D                                        63.5    9e-18   
gb|KDP31947.1|  hypothetical protein JCGZ_12408                       62.8    9e-18   
ref|XP_009393805.1|  PREDICTED: probable serine/threonine-protein...  60.1    9e-18   
ref|XP_004510748.1|  PREDICTED: probable serine/threonine-protein...  61.6    9e-18   
ref|XP_004510749.1|  PREDICTED: probable serine/threonine-protein...  61.6    9e-18   
ref|XP_009393804.1|  PREDICTED: probable serine/threonine-protein...  60.1    9e-18   
ref|XP_006406732.1|  hypothetical protein EUTSA_v10020672mg           65.1    1e-17   
emb|CDP08772.1|  unnamed protein product                              61.2    1e-17   
ref|XP_011069664.1|  PREDICTED: probable serine/threonine-protein...  58.9    1e-17   
ref|XP_008338324.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-17   
ref|XP_010456238.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-17   
ref|XP_010912027.1|  PREDICTED: probable serine/threonine-protein...  61.6    1e-17   
ref|XP_010427508.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-17   
ref|XP_010505336.1|  PREDICTED: probable receptor-like protein ki...  64.3    1e-17   
ref|XP_007156789.1|  hypothetical protein PHAVU_002G017700g           60.1    1e-17   
ref|XP_010053752.1|  PREDICTED: probable serine/threonine-protein...  60.5    1e-17   
ref|NP_001141514.1|  uncharacterized LOC100273626                     60.5    1e-17   
ref|XP_010427500.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-17   
ref|XP_010422805.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-17   
ref|XP_010456237.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-17   
gb|KJB12701.1|  hypothetical protein B456_002G031900                  63.2    1e-17   
ref|XP_010059914.1|  PREDICTED: probable serine/threonine-protein...  63.5    2e-17   
ref|XP_006354864.1|  PREDICTED: probable serine/threonine-protein...  60.1    2e-17   
gb|KJB58525.1|  hypothetical protein B456_009G213700                  62.0    2e-17   
ref|XP_007051724.1|  Kinase superfamily protein                       60.5    2e-17   
gb|EPS58181.1|  hypothetical protein M569_16635                       59.7    2e-17   
ref|XP_010320325.1|  PREDICTED: probable serine/threonine-protein...  60.1    2e-17   
ref|XP_010422804.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-17   
ref|XP_010522961.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-17   
ref|XP_010939278.1|  PREDICTED: probable receptor-like serine/thr...  58.5    2e-17   
ref|XP_008438006.1|  PREDICTED: probable serine/threonine-protein...  60.5    2e-17   
ref|XP_010664563.1|  PREDICTED: probable serine/threonine-protein...  61.2    2e-17   
emb|CBI19499.3|  unnamed protein product                              61.6    2e-17   
ref|XP_006287640.1|  hypothetical protein CARUB_v10000851mg           60.8    2e-17   
ref|XP_003569509.1|  PREDICTED: probable receptor-like protein ki...  62.8    2e-17   
ref|XP_002523608.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  62.4    2e-17   
ref|XP_009367227.1|  PREDICTED: probable serine/threonine-protein...  58.2    2e-17   
ref|XP_010112963.1|  putative serine/threonine-protein kinase         58.5    2e-17   
gb|EMT26503.1|  Putative serine/threonine-protein kinase              62.4    2e-17   
ref|XP_009343291.1|  PREDICTED: probable serine/threonine-protein...  58.2    2e-17   
gb|EMT07873.1|  Putative serine/threonine-protein kinase              58.5    2e-17   
ref|XP_003517305.1|  PREDICTED: probable serine/threonine-protein...  58.9    2e-17   
gb|AEQ94107.1|  putative kinase family protein                        58.9    2e-17   
ref|XP_004252762.1|  PREDICTED: probable serine/threonine-protein...  58.5    3e-17   
gb|AAB61036.1|  Similar to protein kinase                             62.4    3e-17   
ref|XP_010522963.1|  PREDICTED: probable serine/threonine-protein...  62.0    3e-17   
emb|CDP01314.1|  unnamed protein product                              59.3    3e-17   
ref|XP_009114044.1|  PREDICTED: probable receptor-like protein ki...  65.1    3e-17   
gb|KHN29322.1|  Putative serine/threonine-protein kinase              58.5    3e-17   
ref|XP_003562161.1|  PREDICTED: probable serine/threonine-protein...  59.7    3e-17   
ref|XP_010930906.1|  PREDICTED: probable serine/threonine-protein...  58.5    3e-17   
ref|XP_003539357.1|  PREDICTED: probable serine/threonine-protein...  58.9    3e-17   
gb|KHG11678.1|  hypothetical protein F383_12503                       62.0    3e-17   
ref|XP_007017190.1|  Serine/threonine-protein kinase                  62.4    3e-17   
gb|KHN42090.1|  Putative serine/threonine-protein kinase              58.9    3e-17   
ref|XP_007217938.1|  hypothetical protein PRUPE_ppa004985mg           57.8    3e-17   
gb|AES94676.2|  receptor-like kinase plant                            58.2    3e-17   
ref|XP_002511906.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  60.5    3e-17   
ref|XP_004306745.1|  PREDICTED: probable serine/threonine-protein...  58.5    3e-17   
ref|XP_003534544.1|  PREDICTED: probable serine/threonine-protein...  58.9    4e-17   
ref|XP_003611718.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  58.2    4e-17   
ref|XP_009345957.1|  PREDICTED: probable serine/threonine-protein...  58.5    4e-17   
ref|XP_009343171.1|  PREDICTED: probable serine/threonine-protein...  58.5    4e-17   
ref|XP_009349806.1|  PREDICTED: probable serine/threonine-protein...  58.9    4e-17   
ref|XP_009597783.1|  PREDICTED: probable serine/threonine-protein...  59.3    4e-17   
ref|XP_009597781.1|  PREDICTED: probable serine/threonine-protein...  59.3    4e-17   
ref|XP_008340239.1|  PREDICTED: probable serine/threonine-protein...  58.2    4e-17   
ref|XP_008346227.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  58.9    4e-17   
ref|XP_004133851.1|  PREDICTED: probable serine/threonine-protein...  62.8    5e-17   
gb|KJB41391.1|  hypothetical protein B456_007G102400                  57.8    5e-17   
gb|ADN33721.1|  serine/threonine-protein kinase                       57.8    5e-17   
gb|EPS71815.1|  hypothetical protein M569_02943                       59.7    5e-17   
gb|KJB41389.1|  hypothetical protein B456_007G102400                  57.4    5e-17   
ref|XP_010688830.1|  PREDICTED: probable serine/threonine-protein...  61.2    5e-17   
ref|XP_006434735.1|  hypothetical protein CICLE_v10000865mg           62.0    5e-17   
ref|XP_007223279.1|  hypothetical protein PRUPE_ppa005531mg           63.5    6e-17   
ref|XP_004142867.1|  PREDICTED: uncharacterized protein LOC101203008  57.4    6e-17   
ref|XP_006473303.1|  PREDICTED: probable serine/threonine-protein...  62.0    6e-17   
gb|KDO84125.1|  hypothetical protein CISIN_1g009979mg                 62.0    6e-17   
gb|KHG15701.1|  hypothetical protein F383_10484                       57.8    6e-17   
ref|XP_008656720.1|  PREDICTED: probable receptor-like protein ki...  65.1    7e-17   
ref|XP_008785669.1|  PREDICTED: probable receptor-like serine/thr...  57.8    7e-17   
ref|XP_008656719.1|  PREDICTED: probable receptor-like protein ki...  65.1    7e-17   



>ref|XP_009593728.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
tomentosiformis]
Length=507

 Score =   120 bits (302),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRRQR+ QAG AESE Q  N
Sbjct  429  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRQRRAQAGNAESESQ--N  486

Query  397  YETDKXDNPDSTSDNKGN  344
            Y+TDK DNPDS S+++ N
Sbjct  487  YDTDKSDNPDSRSESRRN  504


 Score = 86.7 bits (213),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI SRP TR  
Sbjct  384  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIESRPPTRAL  430



>ref|XP_009793441.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
sylvestris]
Length=507

 Score =   120 bits (302),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRRQR+ QAG AESE Q  N
Sbjct  429  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRQRRAQAGNAESESQ--N  486

Query  397  YETDKXDNPDSTSDNKGN  344
            Y+TDK DNPDS S+++ N
Sbjct  487  YDTDKSDNPDSRSESRRN  504


 Score = 85.1 bits (209),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI S+P TR  
Sbjct  384  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIESKPPTRAL  430



>emb|CDP15187.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   120 bits (301),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR+LLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR R+ QAG+ E E QREN
Sbjct  429  ALKRSLLTALRCVDPDSDKRPRMSQVVRMLESEEYPIPREDRRHRRTQAGSTEIESQREN  488

Query  397  YETDKXDNPDSTSDNKGN  344
            Y+TDK DNP+  S++K N
Sbjct  489  YDTDKSDNPEPRSESKRN  506


 Score = 84.3 bits (207),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR  QEVNLV+WLKMMVGSRRSEEVVDPNI SRPSTR  
Sbjct  384  TGRDPVDYGRPPQEVNLVEWLKMMVGSRRSEEVVDPNIESRPSTRAL  430



>ref|XP_010276545.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nelumbo 
nucifera]
Length=510

 Score =   119 bits (299),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ QAG+ E E QREN
Sbjct  431  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRHRRSQAGSIEIESQREN  490

Query  397  YETDKXDNPDSTSDNK  350
             +TDK DNPDS +D++
Sbjct  491  SDTDKSDNPDSRADSR  506


 Score = 82.0 bits (201),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVN+VDWLKMMVGSRRSEEVVDPNI +RPSTR  
Sbjct  386  TGRDPVDYSRPANEVNMVDWLKMMVGSRRSEEVVDPNIQTRPSTRAL  432



>ref|XP_006358542.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006358543.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006358544.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006358545.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X4 [Solanum tuberosum]
Length=508

 Score =   115 bits (287),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRRQR+ QAG  ES+ Q  N
Sbjct  430  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRQRRSQAGNGESDSQ--N  487

Query  397  YETDKXDNPDSTSDNKGN  344
            Y+TDK DNPD  S+++ N
Sbjct  488  YDTDKSDNPDPRSESRRN  505


 Score = 85.1 bits (209),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI +RP TR  
Sbjct  385  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIETRPPTRAL  431



>ref|XP_010313851.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum 
lycopersicum]
 ref|XP_010313854.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum 
lycopersicum]
Length=508

 Score =   114 bits (286),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRRQR+ QAG  ES+ Q  N
Sbjct  430  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRQRRSQAGNGESDSQ--N  487

Query  397  YETDKXDNPDSTSDNK  350
            Y+TDK DNPD  S+++
Sbjct  488  YDTDKSDNPDPRSESR  503


 Score = 85.1 bits (209),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI +RP TR  
Sbjct  385  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIETRPPTRAL  431



>ref|XP_008370349.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Malus 
domestica]
Length=511

 Score =   114 bits (286),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ + G+ E + QREN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTEGGSVEIDSQREN  490

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  491  SDTDRSDYPGSRSESKG  507


 Score = 84.3 bits (207),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_004297081.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Fragaria 
vesca subsp. vesca]
Length=501

 Score =   112 bits (280),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYP+ REDRR+RK QA   E E Q+EN
Sbjct  421  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPVLREDRRRRKSQASNVEGESQKEN  480

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD+ DNPD+ +D K N
Sbjct  481  SDTDRSDNPDTRADTKKN  498


 Score = 86.3 bits (212),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI +RPST   
Sbjct  376  TGRDPVDYGRQAQEVNLVDWLKMMVGSRRSEEVVDPNIETRPSTSAL  422



>ref|XP_002280159.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Vitis 
vinifera]
 emb|CBI39658.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   112 bits (280),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ QAG+ E E Q+EN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTQAGSMEIESQKEN  490

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ +N  S S+++G
Sbjct  491  SDTDQSENLGSRSESRG  507


 Score = 86.3 bits (212),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_008246302.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Prunus 
mume]
 ref|XP_008246303.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Prunus 
mume]
 ref|XP_008246304.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Prunus 
mume]
Length=510

 Score =   112 bits (281),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ +AG+ + + QREN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTEAGSMDIDSQREN  489

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  490  SDTDRSDYPGSRSESKG  506


 Score = 84.7 bits (208),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  431



>ref|XP_009366039.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
 ref|XP_009366040.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
Length=511

 Score =   113 bits (282),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ + G+ + + QREN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTEGGSVDIDSQREN  490

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  491  SDTDRSDYPGSRSESKG  507


 Score = 83.6 bits (205),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_008388433.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Malus 
domestica]
 ref|XP_008388434.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Malus 
domestica]
Length=511

 Score =   111 bits (278),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ +  +A+ + QREN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTEGSSADIDSQREN  490

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  491  SDTDRSDYPGSRSESKG  507


 Score = 84.3 bits (207),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_004302336.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Fragaria 
vesca subsp. vesca]
Length=510

 Score =   112 bits (280),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ QAG+ E + Q+EN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRNRRTQAGSMEIDSQKEN  489

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D P S S++K
Sbjct  490  SDTDRSDYPVSRSESK  505


 Score = 84.0 bits (206),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPAAEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  431



>ref|XP_007207381.1| hypothetical protein PRUPE_ppa004429mg [Prunus persica]
 gb|EMJ08580.1| hypothetical protein PRUPE_ppa004429mg [Prunus persica]
Length=510

 Score =   111 bits (278),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ +AG+ + + Q+EN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTEAGSMDIDSQKEN  489

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  490  SDTDRSDYPGSRSESKG  506


 Score = 84.7 bits (208),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  431



>ref|XP_009365468.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
 ref|XP_009335534.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
Length=511

 Score =   110 bits (276),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ +  +A+ + QREN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTEGDSADIDSQREN  490

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ D P S S++KG
Sbjct  491  SDTDRSDYPGSRSESKG  507


 Score = 84.3 bits (207),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_010270970.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nelumbo 
nucifera]
Length=511

 Score =   113 bits (282),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QV  MLESEEYPIPREDRR R+ QAG+ E E QREN
Sbjct  431  ALKRALLTALRCVDPDSDKRPKMGQVARMLESEEYPIPREDRRHRRSQAGSMEIECQREN  490

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  491  SDTDKSDNPD  500


 Score = 81.6 bits (200),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVN+VDWLKMMVGSRRSEEVVDPNI +RPSTR  
Sbjct  386  TGRDPVDYSRPANEVNMVDWLKMMVGSRRSEEVVDPNIETRPSTRAL  432



>emb|CAN65734.1| hypothetical protein VITISV_037750 [Vitis vinifera]
Length=510

 Score =   107 bits (268),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ QAG+ E E Q+EN
Sbjct  431  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTQAGSMEIESQKEN  490

Query  397  YETDKXDNPDS  365
             +TD+ +N  S
Sbjct  491  SDTDQSENLGS  501


 Score = 86.3 bits (212),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_008223491.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Prunus 
mume]
Length=503

 Score =   108 bits (269),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ QAG  E+   ++N
Sbjct  423  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRGRRSQAGNMEAGSLKDN  482

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD+ DNPD  +D++ N
Sbjct  483  SDTDRSDNPDIRADSRRN  500


 Score = 84.7 bits (208),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI +RPST
Sbjct  378  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIETRPST  421



>ref|XP_010094892.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB57535.1| putative receptor-like protein kinase [Morus notabilis]
Length=590

 Score =   109 bits (273),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPI REDRR R+ QAG+ E + Q+E 
Sbjct  510  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPISREDRRHRRAQAGSMEIDSQKEF  569

Query  397  YETDKXDNPDSTSDNKG  347
             +TD+ DNP S S+++G
Sbjct  570  SDTDRSDNPGSRSNSRG  586


 Score = 83.2 bits (204),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  465  TGRDPVDYGRPAPEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  511



>ref|XP_010070090.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Eucalyptus 
grandis]
 gb|KCW58659.1| hypothetical protein EUGRSUZ_H01314 [Eucalyptus grandis]
 gb|KCW58660.1| hypothetical protein EUGRSUZ_H01314 [Eucalyptus grandis]
Length=512

 Score =   106 bits (265),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ Q G++ + + QRE
Sbjct  431  ALKRALLTALRCVDPDHEKRPKMGQVVRMLESEEYPIPREDRRHRRTQGGSSMDMDSQRE  490

Query  400  NYETDKXDNPDSTSDNK  350
            N +TD+ D P S S++K
Sbjct  491  NSDTDRSDYPGSRSESK  507


 Score = 84.7 bits (208),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  386  TGRDPVDYGRQANEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  432



>ref|XP_007223307.1| hypothetical protein PRUPE_ppa004549mg [Prunus persica]
 gb|EMJ24506.1| hypothetical protein PRUPE_ppa004549mg [Prunus persica]
Length=503

 Score =   108 bits (270),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ QAG  E+   ++N
Sbjct  423  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRGRRSQAGNTEAGSLKDN  482

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD+ DNPD  +D++ N
Sbjct  483  SDTDRSDNPDIRTDSRRN  500


 Score = 82.8 bits (203),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR AQEVNLVDWLKMMVGSRRSEEVVDPNI +RPS
Sbjct  378  TGRDPVDYGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIETRPS  420



>gb|KDP23343.1| hypothetical protein JCGZ_23176 [Jatropha curcas]
Length=508

 Score =   104 bits (259),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+   G + E E Q+E
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTHGGGSMEIESQKE  489

Query  400  NYETDKXDNPDS  365
            N +TD+ D P S
Sbjct  490  NSDTDRSDYPGS  501


 Score = 85.9 bits (211),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI +RPSTR  
Sbjct  385  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEARPSTRAL  431



>ref|XP_010674509.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Beta 
vulgaris subsp. vulgaris]
Length=510

 Score =   105 bits (263),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE-PQRE  401
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR RK +A +AE E  QR+
Sbjct  426  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRHRKGRANSAEIESSQRD  485

Query  400  NYETDKXDNPDS  365
              +TDK DNPDS
Sbjct  486  FSDTDKSDNPDS  497


 Score = 83.6 bits (205),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR  QEVNLVDWLKMMVGSRRSEEVVDPNI ++PSTR  
Sbjct  381  TGRDPVDYGRPPQEVNLVDWLKMMVGSRRSEEVVDPNIEAKPSTRAL  427



>ref|XP_006600404.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X2 [Glycine max]
Length=503

 Score =   110 bits (275),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK QAG  E E Q+E 
Sbjct  423  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSQAGNMELEAQKET  482

Query  397  YETDKXDNPDSTSDNKGN  344
             +T+  +NPDS S+ + N
Sbjct  483  SDTEMTENPDSKSNGRRN  500


 Score = 77.8 bits (190),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST
Sbjct  378  TGRDPVDYSRPATEVNLVDWLKMMVGNRRAEEVVDPNIETRPST  421



>gb|KHN03235.1| Putative receptor-like protein kinase [Glycine soja]
Length=503

 Score =   110 bits (275),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK QAG  E E Q+E 
Sbjct  423  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSQAGNMELEAQKET  482

Query  397  YETDKXDNPDSTSDNKGN  344
             +T+  +NPDS S+ + N
Sbjct  483  SDTEMTENPDSKSNGRRN  500


 Score = 77.8 bits (190),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST
Sbjct  378  TGRDPVDYSRPATEVNLVDWLKMMVGNRRAEEVVDPNIETRPST  421



>ref|XP_011039031.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Populus 
euphratica]
Length=506

 Score =   107 bits (266),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ Q G  E E Q+EN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTQ-GGMEIESQKEN  488

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D P S S+++
Sbjct  489  SDTDRSDYPGSRSESR  504


 Score = 81.3 bits (199),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVG+RRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPTHEVNLVDWLKMMVGNRRSEEVVDPNIEVRPSTRAL  431



>ref|XP_006600403.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X1 [Glycine max]
Length=537

 Score =   110 bits (275),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK QAG  E E Q+E 
Sbjct  457  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSQAGNMELEAQKET  516

Query  397  YETDKXDNPDSTSDNKGN  344
             +T+  +NPDS S+ + N
Sbjct  517  SDTEMTENPDSKSNGRRN  534


 Score = 77.8 bits (190),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST
Sbjct  412  TGRDPVDYSRPATEVNLVDWLKMMVGNRRAEEVVDPNIETRPST  455



>ref|XP_006480375.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Citrus sinensis]
 gb|KDO41831.1| hypothetical protein CISIN_1g010653mg [Citrus sinensis]
Length=505

 Score =   105 bits (262),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR+LLTALRCVDPD  KRPKMSQVV MLESEEYPI REDRR R+ Q G + E E Q+E
Sbjct  427  ALKRSLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIVREDRRHRRTQGGTSMEIESQKE  486

Query  400  NYETDKXDNPDSTSDNK  350
            N +TD+ D P S S++K
Sbjct  487  NSDTDRSDYPGSRSESK  503


 Score = 82.8 bits (203),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  382  TGRDPVDHGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  428



>ref|XP_007031244.1| Interleukin-1 receptor-associated kinase, putative isoform 1 
[Theobroma cacao]
 gb|EOY11746.1| Interleukin-1 receptor-associated kinase, putative isoform 1 
[Theobroma cacao]
Length=509

 Score =   104 bits (260),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+    + E + QR+N
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRNHGSSLEIDSQRDN  489

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D P S S++K
Sbjct  490  SDTDRSDYPASRSESK  505


 Score = 83.2 bits (204),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR + EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPSHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  431



>gb|AFK47437.1| unknown [Medicago truncatula]
Length=501

 Score =   110 bits (275),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK  A + + E Q+E 
Sbjct  421  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSNARSTDVEMQKEA  480

Query  397  YETDKXDNPDSTSDNKGN  344
            ++TDK D+PDS S+ + N
Sbjct  481  FDTDKSDHPDSKSNGRRN  498


 Score = 77.4 bits (189),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+R +EEVVDPNI +RPST   
Sbjct  376  TGRDPVDYNRSAAEVNLVDWLKMMVGNRHAEEVVDPNIETRPSTSAL  422



>ref|XP_006382268.1| kinase family protein [Populus trichocarpa]
 gb|ERP60065.1| kinase family protein [Populus trichocarpa]
Length=506

 Score =   106 bits (264),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR R+ Q G  E E Q+EN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRHRRTQ-GGMEIESQKEN  488

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D P S ++++
Sbjct  489  SDTDRSDYPGSRTESR  504


 Score = 81.3 bits (199),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVG+RRSEEVVDPNI  RPSTR  
Sbjct  385  TGRDPVDYGRPTHEVNLVDWLKMMVGNRRSEEVVDPNIEVRPSTRAL  431



>gb|KDO41830.1| hypothetical protein CISIN_1g010653mg [Citrus sinensis]
Length=463

 Score =   104 bits (260),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR+LLTALRCVDPD  KRPKMSQVV MLESEEYPI REDRR R+ Q G + E E Q+E
Sbjct  385  ALKRSLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIVREDRRHRRTQGGTSMEIESQKE  444

Query  400  NYETDKXDNPDSTSDNK  350
            N +TD+ D P S S++K
Sbjct  445  NSDTDRSDYPGSRSESK  461


 Score = 82.4 bits (202),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  340  TGRDPVDHGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  386



>ref|XP_002267270.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Vitis 
vinifera]
 ref|XP_010649679.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Vitis 
vinifera]
 emb|CBI26006.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   103 bits (257),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+  AG  E+E QREN
Sbjct  425  ALKRGLLTALRCVDPDADKRPKMSQVVRMLESEEYPIPREDRRRRRSHAGNNEAESQREN  484

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ + PDS ++N+
Sbjct  485  SDTDRSEIPDSRAENR  500


 Score = 83.6 bits (205),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI +RPST   
Sbjct  380  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIETRPSTSAL  426



>ref|XP_007154459.1| hypothetical protein PHAVU_003G121000g [Phaseolus vulgaris]
 ref|XP_007154460.1| hypothetical protein PHAVU_003G121000g [Phaseolus vulgaris]
 gb|ESW26453.1| hypothetical protein PHAVU_003G121000g [Phaseolus vulgaris]
 gb|ESW26454.1| hypothetical protein PHAVU_003G121000g [Phaseolus vulgaris]
Length=504

 Score =   108 bits (270),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK Q G  E E Q+E 
Sbjct  424  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSQTGNMEVEAQKEI  483

Query  397  YETDKXDNPDSTSDNKGN  344
             +T+K D+PD  S+ + N
Sbjct  484  SDTEKSDSPDPKSNGRRN  501


 Score = 77.8 bits (190),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST   
Sbjct  379  TGRDPVDYSRPATEVNLVDWLKMMVGNRRAEEVVDPNIETRPSTSAL  425



>emb|CAN71111.1| hypothetical protein VITISV_001481 [Vitis vinifera]
Length=481

 Score =   102 bits (255),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+  AG  E+E QREN
Sbjct  393  ALKRGLLTALRCVDPDADKRPKMSQVVRMLESEEYPIPREDRRRRRSHAGNNEAESQREN  452

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ + PDS ++N+
Sbjct  453  SDTDRSEIPDSRAENR  468


 Score = 83.6 bits (205),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI +RPST   
Sbjct  348  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIETRPSTSAL  394



>gb|KJB45483.1| hypothetical protein B456_007G308900 [Gossypium raimondii]
Length=510

 Score =   101 bits (251),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENY  395
             KRALLTALRCVDPD  KRPKM QV  MLESEEYPIPREDRR R+     +E + Q++N 
Sbjct  432  LKRALLTALRCVDPDSEKRPKMGQVARMLESEEYPIPREDRRHRRTHGNNSEIDSQKDNS  491

Query  394  ETDKXDNPDSTSDNK  350
            +TDK D P S S++K
Sbjct  492  DTDKSDYPASRSESK  506


 Score = 84.0 bits (206),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR
Sbjct  386  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTR  430



>gb|AES92067.2| receptor-like kinase plant [Medicago truncatula]
Length=501

 Score =   107 bits (268),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK  A + + E Q+E 
Sbjct  421  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSNARSTDVEMQKEA  480

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK D+PDS S+ + N
Sbjct  481  SDTDKSDHPDSKSNGRRN  498


 Score = 77.4 bits (189),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+R +EEVVDPNI +RPST   
Sbjct  376  TGRDPVDYNRSAAEVNLVDWLKMMVGNRHAEEVVDPNIETRPSTSAL  422



>ref|XP_003609870.1| Protein kinase domain containing protein expressed [Medicago 
truncatula]
Length=478

 Score =   107 bits (268),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK  A + + E Q+E 
Sbjct  398  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSNARSTDVEMQKEA  457

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK D+PDS S+ + N
Sbjct  458  SDTDKSDHPDSKSNGRRN  475


 Score = 77.4 bits (189),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+R +EEVVDPNI +RPST   
Sbjct  353  TGRDPVDYNRSAAEVNLVDWLKMMVGNRHAEEVVDPNIETRPSTSAL  399



>ref|XP_003529491.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Glycine max]
 gb|KHN28182.1| Putative receptor-like protein kinase [Glycine soja]
Length=504

 Score =   107 bits (266),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK  AG  E   Q+E 
Sbjct  424  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSLAGNIELGDQKET  483

Query  397  YETDKXDNPDSTSDNKGN  344
             +T+K +NPDS S+ + N
Sbjct  484  SDTEKTENPDSKSNGRRN  501


 Score = 77.8 bits (190),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST
Sbjct  379  TGRDPVDYNRPAAEVNLVDWLKMMVGNRRAEEVVDPNIETRPST  422



>ref|XP_010024866.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Eucalyptus 
grandis]
 ref|XP_010024867.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Eucalyptus 
grandis]
 gb|KCW61385.1| hypothetical protein EUGRSUZ_H04118 [Eucalyptus grandis]
Length=506

 Score =   103 bits (257),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+ Q GAAE+EP+R +
Sbjct  422  ALKRALLTALRCVDPDAEKRPKMSQVVRMLESEEYPIPREDRRRRRSQTGAAETEPRRSS  481

Query  397  YETDKXDNPDSTSDNKGN  344
             E D+ D  D  SD + N
Sbjct  482  AELDQSDASDLRSDARRN  499


 Score = 81.3 bits (199),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI ++PST   
Sbjct  377  TGRDPVDYGRPAPEVNLVDWLKMMVGSRRSEEVVDPNIETKPSTSAL  423



>gb|KJB45484.1| hypothetical protein B456_007G308900 [Gossypium raimondii]
Length=482

 Score =   101 bits (251),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRPKM QV  MLESEEYPIPREDRR R+     +E + Q++N
Sbjct  403  TLKRALLTALRCVDPDSEKRPKMGQVARMLESEEYPIPREDRRHRRTHGNNSEIDSQKDN  462

Query  397  YETDKXDNPDSTSDNK  350
             +TDK D P S S++K
Sbjct  463  SDTDKSDYPASRSESK  478


 Score = 83.6 bits (205),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR
Sbjct  358  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTR  402



>gb|KEH37722.1| receptor-like kinase plant [Medicago truncatula]
Length=506

 Score =   106 bits (264),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR+LLTALRCVDPD  KRPKM+QVV MLESEEYPIPREDRR+R+ QAG  E E QRE 
Sbjct  426  ALKRSLLTALRCVDPDSEKRPKMTQVVRMLESEEYPIPREDRRRRRSQAGNTEVESQRET  485

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK DNPD  S+ + N
Sbjct  486  SDTDKSDNPDHKSNGRRN  503


 Score = 75.5 bits (184),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG RRSEEVVDP I +RPST
Sbjct  381  TGRDPVDYSRPAAEVNLVDWLKMMVGCRRSEEVVDPMIETRPST  424



>ref|XP_006597074.1| PREDICTED: receptor-like protein kinase 3-like isoform X2 [Glycine 
max]
 gb|KHN42243.1| Putative receptor-like protein kinase [Glycine soja]
Length=504

 Score =   103 bits (257),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPI REDRR+R+ QAG  E E QREN
Sbjct  424  ALKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPILREDRRRRRSQAGNMEVETQREN  483

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  484  SDTDKSDNPD  493


 Score = 77.8 bits (190),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG RRSEEV+DPNI +RPST   
Sbjct  379  TGRDPVDYSRPAAEVNLVDWLKMMVGCRRSEEVLDPNIETRPSTSAL  425



>ref|XP_006597073.1| PREDICTED: receptor-like protein kinase 3-like isoform X1 [Glycine 
max]
Length=564

 Score =   103 bits (257),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPI REDRR+R+ QAG  E E QREN
Sbjct  484  ALKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPILREDRRRRRSQAGNMEVETQREN  543

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  544  SDTDKSDNPD  553


 Score = 77.8 bits (190),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG RRSEEV+DPNI +RPST   
Sbjct  439  TGRDPVDYSRPAAEVNLVDWLKMMVGCRRSEEVLDPNIETRPSTSAL  485



>ref|XP_008367127.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Malus 
domestica]
Length=500

 Score = 97.8 bits (242),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR+R+ QAG  E+E    N
Sbjct  422  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRRRRNQAGNTEAESL--N  479

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK +NPD+ +D++ N
Sbjct  480  SDTDKSENPDTKTDSRRN  497


 Score = 83.2 bits (204),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR  QEVNLVDWLKMMVGSRRSEEVVDPNI +RPST   
Sbjct  377  TGRDPVDYGRPEQEVNLVDWLKMMVGSRRSEEVVDPNIETRPSTSAL  423



>ref|XP_009359782.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
 ref|XP_009369713.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
Length=500

 Score = 97.4 bits (241),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR+R+ QAG  E+E    N
Sbjct  422  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRRRRNQAGNTEAESL--N  479

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK +NPD+ +D++ N
Sbjct  480  SDTDKGENPDAKTDSRRN  497


 Score = 83.2 bits (204),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR  QEVNLVDWLKMMVGSRRSEEVVDPNI +RPST   
Sbjct  377  TGRDPVDYGRPEQEVNLVDWLKMMVGSRRSEEVVDPNIETRPSTSAL  423



>gb|KDP28001.1| hypothetical protein JCGZ_19081 [Jatropha curcas]
Length=489

 Score =   107 bits (267),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK QAG  ++E QREN
Sbjct  413  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSQAGVKDNETQREN  472

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD    PD  +D++ N
Sbjct  473  SDTD----PDPKADSRRN  486


 Score = 72.8 bits (177),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLKMMV +RRSEEVVDP I +RPST   
Sbjct  368  TGRDPVDYGRPENEVNLVEWLKMMVATRRSEEVVDPMIETRPSTSAL  414



>ref|XP_007138557.1| hypothetical protein PHAVU_009G219300g [Phaseolus vulgaris]
 gb|ESW10551.1| hypothetical protein PHAVU_009G219300g [Phaseolus vulgaris]
Length=501

 Score =   101 bits (252),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+RK QAG  E E     
Sbjct  424  ALKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRKSQAGNMEVETHS--  481

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK +N D  S+ + N
Sbjct  482  -DTDKSENADFKSNGRRN  498


 Score = 77.4 bits (189),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG RRSEEV+DPNI +RPST
Sbjct  379  TGRDPVDYSRPAAEVNLVDWLKMMVGFRRSEEVLDPNIETRPST  422



>ref|NP_001238457.1| receptor-like protein kinase 3-like [Glycine max]
 gb|AAU10525.1| putative receptor-like protein kinase 3 [Glycine max]
Length=504

 Score =   103 bits (257),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPI REDRR+R+ QAG  E E QREN
Sbjct  424  ALKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPILREDRRRRRSQAGNMEVETQREN  483

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  484  SDTDKSDNPD  493


 Score = 75.1 bits (183),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG RRSE V+DPNI +RPST   
Sbjct  379  TGRDPVDYSRPAAEVNLVDWLKMMVGCRRSEGVLDPNIETRPSTSAL  425



>ref|XP_006587101.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X1 [Glycine max]
Length=579

 Score =   103 bits (256),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+R+ QAG  E E  REN
Sbjct  499  TLKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRRSQAGNMEVETHREN  558

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  559  SDTDKSDNPD  568


 Score = 75.1 bits (183),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG R SEEV+DPNI +RPST
Sbjct  454  TGRDPVDYSRPAAEVNLVDWLKMMVGCRCSEEVLDPNIETRPST  497



>ref|XP_006587102.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X2 [Glycine max]
Length=538

 Score =   103 bits (256),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+R+ QAG  E E  REN
Sbjct  458  TLKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRRSQAGNMEVETHREN  517

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  518  SDTDKSDNPD  527


 Score = 75.1 bits (183),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG R SEEV+DPNI +RPST
Sbjct  413  TGRDPVDYSRPAAEVNLVDWLKMMVGCRCSEEVLDPNIETRPST  456



>ref|XP_011023858.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Populus 
euphratica]
Length=507

 Score = 95.5 bits (236),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ + G+ E E QREN
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTRGGSMEIESQREN  489

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D+P S S+++
Sbjct  490  SDTDRSDHPGSRSESR  505


 Score = 82.8 bits (203),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVG+RRSEEVVDPNI +RPSTR  
Sbjct  385  TGRDPVDYGRPTHEVNLVDWLKMMVGNRRSEEVVDPNIEARPSTRAL  431



>ref|XP_004508087.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cicer arietinum]
Length=494

 Score = 99.0 bits (245),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 58/78 (74%), Gaps = 4/78 (5%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+RK  A +A+ E     
Sbjct  418  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREDRRRRKSNARSADVEAS---  474

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK D+PDS  + + N
Sbjct  475  -DTDKSDHPDSKLNGRRN  491


 Score = 79.3 bits (194),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+RR+EEVVDPNI +RPST   
Sbjct  373  TGRDPVDYSRSAAEVNLVDWLKMMVGNRRAEEVVDPNIETRPSTSAL  419



>gb|KHN29771.1| Putative receptor-like protein kinase [Glycine soja]
Length=504

 Score =   103 bits (257),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+R+ QAG  E E  REN
Sbjct  424  TLKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRRSQAGNMEVETHREN  483

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  484  SDTDKSDNPD  493


 Score = 74.7 bits (182),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG R SEEV+DPNI +RPST
Sbjct  379  TGRDPVDYSRPAAEVNLVDWLKMMVGCRCSEEVLDPNIETRPST  422



>ref|XP_006587104.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X4 [Glycine max]
Length=504

 Score =   103 bits (257),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+R+ QAG  E E  REN
Sbjct  424  TLKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRRSQAGNMEVETHREN  483

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  484  SDTDKSDNPD  493


 Score = 74.7 bits (182),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG R SEEV+DPNI +RPST
Sbjct  379  TGRDPVDYSRPAAEVNLVDWLKMMVGCRCSEEVLDPNIETRPST  422



>ref|XP_006587103.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X3 [Glycine max]
Length=524

 Score =   103 bits (256),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR+R+ QAG  E E  REN
Sbjct  444  TLKRALLTALRCVDPDAEKRPRMSQVVRMLESEEYPIPREDRRRRRSQAGNMEVETHREN  503

Query  397  YETDKXDNPD  368
             +TDK DNPD
Sbjct  504  SDTDKSDNPD  513


 Score = 74.7 bits (182),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV Y R A EVNLVDWLKMMVG R SEEV+DPNI +RPST
Sbjct  399  TGRDPVDYSRPAAEVNLVDWLKMMVGCRCSEEVLDPNIETRPST  442



>ref|XP_004488197.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cicer arietinum]
Length=505

 Score =   100 bits (249),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLES+EYPIPREDRR+R+ QAG  E E Q+E 
Sbjct  425  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESDEYPIPREDRRRRRSQAGNNEVESQKET  484

Query  397  YETDKXDNPD  368
             +TDK DN D
Sbjct  485  SDTDKSDNTD  494


 Score = 77.8 bits (190),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG RRSEEV+DPNI +RPST   
Sbjct  380  TGRDPVDYSRPAAEVNLVDWLKMMVGFRRSEEVLDPNIETRPSTSAL  426



>ref|XP_011087539.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Sesamum 
indicum]
 ref|XP_011087541.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Sesamum 
indicum]
Length=508

 Score = 98.6 bits (244),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR R+ +A + E + QR+N
Sbjct  430  ALKRALLTALRCVDPDSDKRPRMSQVVRMLESEEYPIPREDRRHRRARASSIEMDSQRDN  489

Query  397  YETDKXDNPDSTSDNKGN  344
            Y+TDK DN D  SD+K N
Sbjct  490  YDTDKSDNQDLRSDSKRN  507


 Score = 79.3 bits (194),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPN+  +PST+  
Sbjct  385  TGRDPVDYGRPAPEVNLVDWLKMMVGSRRSEEVVDPNMELQPSTKAL  431



>gb|EMT12813.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=512

 Score = 97.4 bits (241),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR R  + G+ E + QREN
Sbjct  432  VLKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRVDRRSRHNRGGSTEMDSQREN  490

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  491  SDTDKSDNPDS  501


 Score = 79.7 bits (195),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR
Sbjct  387  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTR  431



>emb|CDM82475.1| unnamed protein product [Triticum aestivum]
Length=512

 Score = 97.1 bits (240),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR R  + G+ E + QREN
Sbjct  432  VLKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRVDRRSRHNRGGSTEMDSQREN  490

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  491  SDTDKSDNPDS  501


 Score = 79.7 bits (195),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR
Sbjct  387  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTR  431



>ref|XP_011092198.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At5g18500 [Sesamum indicum]
Length=506

 Score = 95.1 bits (235),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP+MSQVV MLESEEYPIPREDRR R+ +A + E + QR++
Sbjct  428  ALKRALLTALRCVDPDSDKRPRMSQVVRMLESEEYPIPREDRRHRRTRANSIEMDTQRDS  487

Query  397  YETDKXDNPDSTSDNKGNL  341
            Y+TDK DN +  SD++ NL
Sbjct  488  YDTDKSDNQELRSDSRRNL  506


 Score = 81.6 bits (200),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPN+  RPSTR  
Sbjct  383  TGRDPVDYGRPAPEVNLVDWLKMMVGSRRSEEVVDPNMDVRPSTRAL  429



>ref|XP_009353418.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Pyrus 
x bretschneideri]
Length=500

 Score = 93.2 bits (230),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR+R+ QAG  E+E    N
Sbjct  422  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRRRRSQAGITEAESL--N  479

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD+ + P++ +D++ N
Sbjct  480  SDTDRSEKPNTKTDSRRN  497


 Score = 82.4 bits (202),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVG RRSEEVVDPNI ++PST   
Sbjct  377  TGRDPVDYGRPAQEVNLVDWLKMMVGGRRSEEVVDPNIETKPSTSAL  423



>ref|XP_003567627.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brachypodium 
distachyon]
Length=515

 Score = 96.7 bits (239),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR R  + G+ E + QR+N
Sbjct  435  SLKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSRHNRGGSTEMDSQRDN  493

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  494  SDTDKSDNPDS  504


 Score = 78.6 bits (192),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRS+EVVDP I +RPSTR  
Sbjct  390  TGRDPVDYGRPANEVNLVDWLKMMVASRRSDEVVDPTIETRPSTRSL  436



>ref|XP_006488742.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Citrus sinensis]
 gb|KDO72180.1| hypothetical protein CISIN_1g010893mg [Citrus sinensis]
 gb|KDO72181.1| hypothetical protein CISIN_1g010893mg [Citrus sinensis]
Length=498

 Score =   106 bits (265),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+ QAGA+E+E QRE+
Sbjct  418  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRRRNQAGASEAESQRES  477

Query  397  YETDKXDNPDS  365
             +TDK +NP+S
Sbjct  478  SDTDKNENPES  488


 Score = 68.6 bits (166),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV YGR   EVNLV+WLKMMV  RRSE+VVDPNI +RPST   
Sbjct  373  TGRYPVDYGRPQSEVNLVEWLKMMVQLRRSEDVVDPNIETRPSTSAL  419



>ref|XP_006419244.1| hypothetical protein CICLE_v10004820mg [Citrus clementina]
 gb|ESR32484.1| hypothetical protein CICLE_v10004820mg [Citrus clementina]
Length=498

 Score =   106 bits (265),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+ QAGA+E+E QRE+
Sbjct  418  ALKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRRRNQAGASEAESQRES  477

Query  397  YETDKXDNPDS  365
             +TDK +NP+S
Sbjct  478  SDTDKNENPES  488


 Score = 68.6 bits (166),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV YGR   EVNLV+WLKMMV  RRSE+VVDPNI +RPST   
Sbjct  373  TGRYPVDYGRPQSEVNLVEWLKMMVQLRRSEDVVDPNIETRPSTSAL  419



>ref|XP_010914767.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Elaeis 
guineensis]
 ref|XP_010914768.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Elaeis 
guineensis]
Length=515

 Score = 92.0 bits (227),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLES+E PIPREDRR R+ +AG+ E E QREN
Sbjct  433  ALKRALLTALRCVDPDAEKRPKMGQVVRMLESDE-PIPREDRRHRRNRAGSTEIESQREN  491

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  492  SDTDKSDNPDS  502


 Score = 83.2 bits (204),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDP+I +RPSTR  
Sbjct  388  TGRDPVDYGRPANEVNLVDWLKMMVGSRRSEEVVDPSIETRPSTRAL  434



>ref|XP_010091289.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB44246.1| putative receptor-like protein kinase [Morus notabilis]
Length=482

 Score = 94.7 bits (234),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 57/91 (63%), Gaps = 20/91 (22%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE--------------------  458
            A KRALLTALRC+DP+  +RPKM QVV MLESEEYPIPRE                    
Sbjct  386  ALKRALLTALRCLDPESDRRPKMGQVVRMLESEEYPIPREAFSDLLYRCLLSKKIWLDLQ  445

Query  457  DRRQRKIQAGAAESEPQRENYETDKXDNPDS  365
            DRR+RK QAG   +E Q EN +TDK DNPD 
Sbjct  446  DRRRRKSQAGNTLAEFQMENSDTDKSDNPDG  476


 Score = 79.3 bits (194),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDP I +RPST   
Sbjct  341  TGRDPVDYGRPAHEVNLVDWLKMMVGNRRSEEVVDPKIENRPSTSAL  387



>ref|XP_002318928.1| kinase family protein [Populus trichocarpa]
 gb|EEE94851.1| kinase family protein [Populus trichocarpa]
Length=521

 Score = 92.0 bits (227),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYP PREDRR R+ + G+ E E QREN
Sbjct  444  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPFPREDRRHRRTRGGSMEIESQREN  503

Query  397  YETDKXDNPDSTSDN  353
             +TD+ D P S S++
Sbjct  504  SDTDRSDYPGSRSES  518


 Score = 81.3 bits (199),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVG+RRSEEV DPNI +RPSTR  
Sbjct  399  TGRDPVDYGRPTHEVNLVDWLKMMVGNRRSEEVADPNIEARPSTRAL  445



>ref|XP_008810332.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Phoenix 
dactylifera]
Length=515

 Score = 90.1 bits (222),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLES+E PIPREDRR R+ + G+ E E QREN
Sbjct  433  ALKRALLTALRCVDPDAEKRPKMGQVVRMLESDE-PIPREDRRHRRNRCGSTEIESQREN  491

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  492  SDTDKSDNPDS  502


 Score = 83.2 bits (204),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDP+I +RPSTR  
Sbjct  388  TGRDPVDYGRPANEVNLVDWLKMMVGSRRSEEVVDPSIETRPSTRAL  434



>ref|XP_006644125.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Oryza brachyantha]
Length=515

 Score = 92.4 bits (228),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +    G+ E + QR+ 
Sbjct  435  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHNHGGSTEMDSQRDN  493

Query  400  NYETDKXDNPDS  365
            N +TDK DNPDS
Sbjct  494  NSDTDKSDNPDS  505


 Score = 80.5 bits (197),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  390  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  436



>ref|XP_002455559.1| hypothetical protein SORBIDRAFT_03g013130 [Sorghum bicolor]
 gb|EES00679.1| hypothetical protein SORBIDRAFT_03g013130 [Sorghum bicolor]
Length=513

 Score = 94.7 bits (234),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + QR+N
Sbjct  433  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHHRGGSTEMDSQRDN  491

Query  397  YETDKXDNPDS  365
             +T+K DNPDS
Sbjct  492  SDTEKSDNPDS  502


 Score = 78.2 bits (191),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  388  TGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  434



>gb|EEC70529.1| hypothetical protein OsI_01645 [Oryza sativa Indica Group]
Length=516

 Score = 92.0 bits (227),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + QR+ 
Sbjct  435  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHNRGGSTEMDSQRDN  493

Query  400  NYETDKXDNPDS  365
            N +TDK DNPDS
Sbjct  494  NSDTDKSDNPDS  505


 Score = 80.5 bits (197),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  390  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  436



>ref|NP_001042894.1| Os01g0323000 [Oryza sativa Japonica Group]
 dbj|BAB21240.1| receptor protein kinase PERK1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF04808.1| Os01g0323000 [Oryza sativa Japonica Group]
 gb|EEE54448.1| hypothetical protein OsJ_01535 [Oryza sativa Japonica Group]
Length=516

 Score = 92.0 bits (227),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + QR+ 
Sbjct  435  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHNRGGSTEMDSQRDN  493

Query  400  NYETDKXDNPDS  365
            N +TDK DNPDS
Sbjct  494  NSDTDKSDNPDS  505


 Score = 80.5 bits (197),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  390  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  436



>ref|XP_004252942.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum 
lycopersicum]
 ref|XP_004252943.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum 
lycopersicum]
Length=503

 Score = 93.6 bits (231),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLT LRC+DPD  KRP MSQVV MLESEEYPIPRE RR+RK QAGA E+E     
Sbjct  422  ALKRALLTTLRCLDPDSDKRPTMSQVVRMLESEEYPIPREGRRRRKNQAGAVETESHNRK  481

Query  397  YETDKXDNP  371
              TD  D P
Sbjct  482  -STDSSDRP  489


 Score = 79.0 bits (193),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLKMMVGS+RSEEVVDP I +RPST
Sbjct  377  TGRDPVDYGRPAPEVNLVDWLKMMVGSKRSEEVVDPTIETRPST  420



>ref|XP_009772905.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
sylvestris]
 ref|XP_009772906.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
sylvestris]
Length=500

 Score = 93.6 bits (231),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLT LRC+DPD  KRP MSQVV MLESEEYPIPRE RR+RK Q GA E+E     
Sbjct  422  ALKRALLTTLRCLDPDSDKRPTMSQVVRMLESEEYPIPREGRRRRKSQTGAEETESHNRK  481

Query  397  YETDKXDNPDST  362
              TD  + P  T
Sbjct  482  SNTDSSEKPILT  493


 Score = 79.0 bits (193),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLKMMVGS+RSEEVVDP I +RPST
Sbjct  377  TGRDPVDYGRPAPEVNLVDWLKMMVGSKRSEEVVDPTIETRPST  420



>ref|XP_008390361.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Malus domestica]
Length=500

 Score = 90.9 bits (224),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR+R+ QAG  E+E    N
Sbjct  422  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRRRRSQAGNTEAESL--N  479

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD  + P + +D++ N
Sbjct  480  SDTDWSEKPTTKTDSRRN  497


 Score = 81.3 bits (199),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR AQEVNLVDWLKMMVG RRSEE+VDPNI ++PST
Sbjct  377  TGRDPVDYGRPAQEVNLVDWLKMMVGGRRSEELVDPNIETKPST  420



>ref|XP_008390362.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X2 [Malus domestica]
Length=362

 Score = 90.9 bits (224),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR+R+ QAG  E+E    N
Sbjct  284  ALKRALLTALRCVDPDSDKRPKMGQVVRMLESEEYPIPREDRRRRRSQAGNTEAESL--N  341

Query  397  YETDKXDNPDSTSDNKGN  344
             +TD  + P + +D++ N
Sbjct  342  SDTDWSEKPTTKTDSRRN  359


 Score = 80.9 bits (198),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVNLVDWLKMMVG RRSEE+VDPNI ++PST   
Sbjct  239  TGRDPVDYGRPAQEVNLVDWLKMMVGGRRSEELVDPNIETKPSTSAL  285



>ref|XP_004968653.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X1 [Setaria italica]
 ref|XP_004968654.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
isoform X2 [Setaria italica]
Length=513

 Score = 90.1 bits (222),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + QR+ 
Sbjct  432  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHHRGGSTEMDSQRDN  490

Query  400  NYETDKXDNPDS  365
            N +T+K DNPDS
Sbjct  491  NSDTEKSDNPDS  502


 Score = 80.9 bits (198),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  387  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  433



>ref|XP_002512571.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis]
 gb|EEF50023.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis]
Length=461

 Score =   110 bits (276),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYPIPREDRR R+ Q G+ + E Q+EN
Sbjct  384  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPIPREDRRHRRTQGGSMDIESQKEN  443

Query  397  YETDKXDNPDSTSDNK  350
             +TD+ D+P S S+++
Sbjct  444  SDTDRSDHPGSRSESR  459


 Score = 59.3 bits (142),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  671  VNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            VNLVDWLKMMVGSRRSEEVVDPNI  RP TR  
Sbjct  353  VNLVDWLKMMVGSRRSEEVVDPNIDVRPPTRAL  385



>ref|XP_010549255.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549262.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549269.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549277.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549286.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
Length=498

 Score = 90.9 bits (224),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP MSQVV MLESEEYPIPREDRR+ +    + + E Q+E+
Sbjct  422  ALKRALLTALRCVDPDSDKRPNMSQVVRMLESEEYPIPREDRRRSRTNGESMDIELQKES  481

Query  397  YETDKXDN  374
             +TD+ ++
Sbjct  482  SDTDRSNS  489


 Score = 78.6 bits (192),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  +P  R  
Sbjct  377  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVKPPRRAL  423



>ref|XP_009407998.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 85.5 bits (210),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV ML+S+E PIPRE+RR R+ +AG+ + + QRE+
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLDSDE-PIPRENRRHRRNRAGSIDMDSQRES  488

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  489  SDTDKSDNPDS  499


 Score = 83.2 bits (204),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDP+I +RPSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVDWLKMMVGSRRSEEVVDPSIETRPSTRAL  431



>dbj|BAJ85608.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score = 91.3 bits (225),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DR  R  + G+   + QR+N
Sbjct  432  VLKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRVDRGSRHNRGGSTGMDSQRDN  490

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  491  SDTDKSDNPDS  501


 Score = 77.0 bits (188),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR  +EVNLVDWLKMMV SRRSEEVVDP I ++PSTR
Sbjct  387  TGRDPVDYGRPTKEVNLVDWLKMMVASRRSEEVVDPTIETQPSTR  431



>ref|XP_010941477.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Elaeis 
guineensis]
 ref|XP_010941478.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Elaeis 
guineensis]
Length=511

 Score = 85.1 bits (209),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPREDRR R+ +AG  + E QREN
Sbjct  432  ALKRALLTALRCVDPDAEKRPKMGQVVRMLESDD-PIPREDRRHRRNRAGITDIESQREN  490

Query  397  YETDKXDNPDS  365
             +TDK DN DS
Sbjct  491  SDTDKSDNQDS  501


 Score = 83.2 bits (204),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDP+I +RPSTR  
Sbjct  387  TGRDPVDYGRPANEVNLVDWLKMMVGSRRSEEVVDPSIETRPSTRAL  433



>dbj|BAJ88412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score = 90.1 bits (222),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DR  R  + G+   + QR+N
Sbjct  246  VLKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRVDRGSRHNRGGSTGMDSQRDN  304

Query  397  YETDKXDNPDS  365
             +TDK DNPDS
Sbjct  305  SDTDKSDNPDS  315


 Score = 77.0 bits (188),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR  +EVNLVDWLKMMV SRRSEEVVDP I ++PSTR
Sbjct  201  TGRDPVDYGRPTKEVNLVDWLKMMVASRRSEEVVDPTIETQPSTR  245



>ref|XP_011011317.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Populus 
euphratica]
Length=487

 Score =   100 bits (249),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYP+PR+DRR ++  AG  E E Q EN
Sbjct  417  ALKRGLLTALRCVDPDAEKRPKMSQVVRMLESEEYPMPRQDRRHQRSHAG--EGESQMEN  474

Query  397  YETDKXDNPDS  365
             +TD+ +NPD+
Sbjct  475  SDTDRNENPDT  485


 Score = 67.0 bits (162),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR   EVNLV+WLK MV  RRSEEVVDP I +RPST   
Sbjct  372  TGRDPVDHGRPENEVNLVEWLKTMVARRRSEEVVDPMIETRPSTSAL  418



>ref|XP_007145035.1| hypothetical protein PHAVU_007G204300g [Phaseolus vulgaris]
 gb|ESW17029.1| hypothetical protein PHAVU_007G204300g [Phaseolus vulgaris]
Length=506

 Score = 88.6 bits (218),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENY  395
             KRALLTALRCVDPD  KRPKM QVV MLESEEYP+ REDRR R+     +E E  +++ 
Sbjct  431  LKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPLAREDRRHRRNHGVNSEIESHKDSS  490

Query  394  ETDKXDNPDSTSDN  353
            +TD  D   S S++
Sbjct  491  DTDGSDIQGSRSES  504


 Score = 77.8 bits (190),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR AQEVN+VDWLKMMVG+RRSEE VD NI  +PSTR
Sbjct  385  TGRDPVDYGRPAQEVNMVDWLKMMVGNRRSEEAVDANIEVKPSTR  429



>ref|XP_010910396.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Elaeis guineensis]
Length=516

 Score = 89.7 bits (221),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = -2

Query  544  CVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENYETDKXDNPDS  365
            CVDPD  KRPKMSQVV ML+S+++ IPREDRR R+ +AG+ E E Q+ENY+TDK DNPDS
Sbjct  445  CVDPDSEKRPKMSQVVRMLDSDDH-IPREDRRHRRNKAGSGEIESQKENYDTDKSDNPDS  503

Query  364  T  362
            T
Sbjct  504  T  504


 Score = 76.6 bits (187),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLK MVGSRRSE+VVDPN+ +RPST
Sbjct  389  TGRDPVDYGRPANEVNLVDWLKRMVGSRRSEDVVDPNMGTRPST  432



>ref|XP_007035974.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY06900.1| Kinase superfamily protein [Theobroma cacao]
Length=497

 Score = 98.2 bits (243),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+ QA  ++++PQR+N
Sbjct  417  ALKRALLTALRCVDPDADKRPKMSQVVRMLESEEYPIPREDRRRRRNQAVNSDADPQRKN  476

Query  397  YETDKXDNPDSTSDNK  350
             + D+ D+PD   D++
Sbjct  477  SDADRSDDPDLRLDSR  492


 Score = 68.2 bits (165),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV YGR   EVN+V+WLKMMV  RRSEEVVDPNI +RPST   
Sbjct  372  TGRYPVDYGRPQPEVNMVEWLKMMVQLRRSEEVVDPNIETRPSTSAL  418



>ref|XP_010910397.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X2 [Elaeis guineensis]
Length=459

 Score = 89.4 bits (220),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = -2

Query  544  CVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENYETDKXDNPDS  365
            CVDPD  KRPKMSQVV ML+S+++ IPREDRR R+ +AG+ E E Q+ENY+TDK DNPDS
Sbjct  388  CVDPDSEKRPKMSQVVRMLDSDDH-IPREDRRHRRNKAGSGEIESQKENYDTDKSDNPDS  446

Query  364  T  362
            T
Sbjct  447  T  447


 Score = 76.3 bits (186),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLK MVGSRRSE+VVDPN+ +RPST
Sbjct  332  TGRDPVDYGRPANEVNLVDWLKRMVGSRRSEDVVDPNMGTRPST  375



>ref|XP_004495624.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cicer arietinum]
Length=505

 Score = 83.2 bits (204),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR AQEVNLVDWLKMMVGSRRSEEVVDPNI  +PSTR  
Sbjct  384  TGRDPVDHGRPAQEVNLVDWLKMMVGSRRSEEVVDPNIEVKPSTRAL  430


 Score = 82.4 bits (202),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKM QV  MLESEEYP+PREDRR R+ + G+ E E Q+E+
Sbjct  429  ALKRTLLTALRCVDPDSEKRPKMGQVARMLESEEYPLPREDRRLRRNRGGSTEIESQKES  488

Query  397  YETDKXDNPDSTSDNK  350
             +TD  D   S S+++
Sbjct  489  SDTDGSDIQGSQSESR  504



>ref|XP_009625425.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
tomentosiformis]
 ref|XP_009625426.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana 
tomentosiformis]
Length=500

 Score = 85.9 bits (211),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLT LRC+DPD  KRP MSQVV MLESEEYPIPRE RR+R+ QAGA E+E     
Sbjct  422  ALKRALLTTLRCLDPDSDKRPTMSQVVRMLESEEYPIPREGRRRRRNQAGAEETESHNRK  481

Query  397  YETDKXDNPDST  362
              TD  + P  T
Sbjct  482  SNTDSSEKPILT  493


 Score = 79.0 bits (193),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLKMMVGS+RSEEVVDP I +RPST
Sbjct  377  TGRDPVDYGRPAPEVNLVDWLKMMVGSKRSEEVVDPTIETRPST  420



>ref|NP_001130748.1| LOC100191852 [Zea mays]
 gb|ACF79090.1| unknown [Zea mays]
 gb|ACG25439.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
 gb|ACL53790.1| unknown [Zea mays]
 tpg|DAA54434.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=514

 Score = 85.9 bits (211),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + Q++ 
Sbjct  433  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHHRGGSTEMDSQKDN  491

Query  400  NYETDKXDNPDS  365
            N +T+K DN DS
Sbjct  492  NSDTEKSDNADS  503


 Score = 78.2 bits (191),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  388  TGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  434



>ref|XP_008672049.1| PREDICTED: LOC100191852 isoform X1 [Zea mays]
 gb|ACN31904.1| unknown [Zea mays]
 tpg|DAA54433.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=526

 Score = 85.9 bits (211),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + Q++ 
Sbjct  445  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHHRGGSTEMDSQKDN  503

Query  400  NYETDKXDNPDS  365
            N +T+K DN DS
Sbjct  504  NSDTEKSDNADS  515


 Score = 78.2 bits (191),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  400  TGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  446



>tpg|DAA54435.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=457

 Score = 85.9 bits (211),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KRALLTALRCVDPD  KRPKM QVV MLES++ PIPR DRR +  + G+ E + Q++ 
Sbjct  376  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD-PIPRGDRRSKHHRGGSTEMDSQKDN  434

Query  400  NYETDKXDNPDS  365
            N +T+K DN DS
Sbjct  435  NSDTEKSDNADS  446


 Score = 78.2 bits (191),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMV SRRSEEVVDP I +RPSTR  
Sbjct  331  TGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRAL  377



>ref|XP_010672612.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=281

 Score = 89.0 bits (219),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAES  416
            A KRALLTALRCVDPD  KRPKM QV  MLESEEYP+PREDRR R+ QAG  ES
Sbjct  223  ALKRALLTALRCVDPDSEKRPKMGQVARMLESEEYPVPREDRRHRRSQAGENES  276


 Score = 74.3 bits (181),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLVDWLK MVG+RR+EEVVDPN+ +RPSTR  
Sbjct  178  TGRDPVDYARPQNEVNLVDWLKTMVGNRRAEEVVDPNMDNRPSTRAL  224



>gb|AFK44454.1| unknown [Lotus japonicus]
Length=157

 Score = 82.4 bits (202),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKI-QAGAAESEPQRE  401
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYP+PREDRR R+  Q G+AE E QRE
Sbjct  80   ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPLPREDRRHRRRNQGGSAEIESQRE  139

Query  400  NYETDKXD  377
              +TD+ +
Sbjct  140  FSDTDRSE  147


 Score = 80.9 bits (198),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVGSRRSEEVVDPNI  +PSTR  
Sbjct  35   TGRDPVDYGRPTNEVNLVDWLKMMVGSRRSEEVVDPNIEVKPSTRAL  81



>ref|XP_010672611.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=474

 Score = 89.0 bits (219),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAES  416
            A KRALLTALRCVDPD  KRPKM QV  MLESEEYP+PREDRR R+ QAG  ES
Sbjct  416  ALKRALLTALRCVDPDSEKRPKMGQVARMLESEEYPVPREDRRHRRSQAGENES  469


 Score = 74.3 bits (181),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLVDWLK MVG+RR+EEVVDPN+ +RPSTR  
Sbjct  371  TGRDPVDYARPQNEVNLVDWLKTMVGNRRAEEVVDPNMDNRPSTRAL  417



>ref|XP_004494518.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cicer arietinum]
Length=501

 Score = 82.0 bits (201),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKI-QAGAAESEPQRE  401
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYP+ REDRR R+  Q G+AE E QRE
Sbjct  424  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPLAREDRRHRRRNQGGSAEIESQRE  483

Query  400  NYETDKXD  377
              +TDK +
Sbjct  484  FSDTDKSE  491


 Score = 80.5 bits (197),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDW+KMMVGSRRSEEVVDPNI  +PSTR  
Sbjct  379  TGRDPVDYGRPTNEVNLVDWMKMMVGSRRSEEVVDPNIEVKPSTRAL  425



>ref|XP_003521648.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Glycine max]
 gb|KHN14218.1| Putative receptor-like protein kinase [Glycine soja]
Length=510

 Score = 81.3 bits (199),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +PSTR  
Sbjct  388  TGRDPVDYGRPANEVNLVDWLKMMVGNRRSEEVVDPNIEVKPSTRAL  434


 Score = 80.5 bits (197),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQA-GAAESEPQRE  401
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYP+PREDRR R+    G+ E E Q+E
Sbjct  433  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPLPREDRRHRRRNREGSGEIESQKE  492

Query  400  NYETDKXDNPDSTSDNKG  347
              +TD+ +  DS  + +G
Sbjct  493  YSDTDRSEIQDSREERRG  510



>ref|XP_003626158.1| hypothetical protein MTR_7g111690 [Medicago truncatula]
 gb|AES82376.1| receptor-like kinase plant [Medicago truncatula]
Length=514

 Score = 81.6 bits (200),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKI-QAGAAESEPQRE  401
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYP+ REDRR R+  Q G+AE + QRE
Sbjct  437  ALKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPLAREDRRHRRRNQGGSAEIDSQRE  496

Query  400  NYETDKXDNPDSTSDNKG  347
              +TD+ +   S  +++G
Sbjct  497  FSDTDRSEIQSSREESRG  514


 Score = 80.1 bits (196),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLVDWLKMMVG+RRSEEVVDPNI  +PSTR  
Sbjct  392  TGRDPVDYGRPTNEVNLVDWLKMMVGNRRSEEVVDPNIEVKPSTRAL  438



>ref|XP_009398688.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 83.2 bits (204),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMV SRRSEEVVDPNI +RPSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVDPNIETRPSTRAL  431


 Score = 78.6 bits (192),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKM QVV ML+S+E   PREDRR+R  +AG  E + QRE 
Sbjct  430  ALKRALLTALRCVDPDSEKRPKMGQVVRMLDSDEPI-PREDRRRRPNRAGGMEIDSQREG  488

Query  397  YETDKXDNPDSTSDNKGN  344
             +TDK DNPDS   ++ N
Sbjct  489  SDTDKSDNPDSIYSSRKN  506



>ref|XP_009148240.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
Length=458

 Score = 85.9 bits (211),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPREDRR R+          Q EN
Sbjct  390  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREDRRGRR---------AQEEN  440

Query  397  YETDKXDNPDSTSDNK  350
             +TD+   P S + +K
Sbjct  441  SDTDR-STPASRTQSK  455


 Score = 73.9 bits (180),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG++R EEV+DPNI  +P+TR  
Sbjct  345  TGRDPVDYARPASEVNLVEWLKMMVGTKRLEEVIDPNIAVKPATRAL  391



>emb|CDY64751.1| BnaA06g37910D [Brassica napus]
Length=458

 Score = 85.9 bits (211),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPREDRR R+          Q EN
Sbjct  390  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREDRRGRR---------AQEEN  440

Query  397  YETDKXDNPDSTSDNK  350
             +TD+   P S + +K
Sbjct  441  SDTDR-STPASRTQSK  455


 Score = 73.9 bits (180),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG++R EEV+DPNI  +P+TR  
Sbjct  345  TGRDPVDYARPASEVNLVEWLKMMVGTKRLEEVIDPNIAVKPATRAL  391



>ref|XP_006417572.1| hypothetical protein EUTSA_v10007579mg [Eutrema salsugineum]
 gb|ESQ35925.1| hypothetical protein EUTSA_v10007579mg [Eutrema salsugineum]
Length=462

 Score = 84.0 bits (206),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRK  440
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPREDRR R+
Sbjct  395  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREDRRGRR  440


 Score = 75.9 bits (185),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  350  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  396



>ref|XP_010458229.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Camelina sativa]
Length=467

 Score = 83.2 bits (204),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPRE+RR R+         P+ EN
Sbjct  400  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREERRMRR--------TPE-EN  450

Query  397  YETDKXDNPDSTSDNK  350
             +TD+   P S S +K
Sbjct  451  SDTDR-STPVSRSQSK  465


 Score = 75.9 bits (185),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  355  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  401



>emb|CDX94971.1| BnaC05g07000D [Brassica napus]
Length=461

 Score = 85.1 bits (209),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPREDRR R+          Q EN
Sbjct  393  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREDRRGRR---------AQEEN  443

Query  397  YETDKXDNPDSTSDNK  350
             +TD    P S + +K
Sbjct  444  SDTD-TSTPASRTQSK  458


 Score = 73.9 bits (180),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG++R EEV+DPNI  +P+TR  
Sbjct  348  TGRDPVDYARPASEVNLVEWLKMMVGTKRLEEVIDPNIAVKPATRAL  394



>ref|XP_010475775.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=465

 Score = 83.2 bits (204),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPRE+RR R+         P+ EN
Sbjct  398  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREERRMRR--------TPE-EN  448

Query  397  YETDKXDNPDSTSDNK  350
             +TD+   P S S +K
Sbjct  449  SDTDR-STPVSRSQSK  463


 Score = 75.9 bits (185),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  353  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  399



>ref|XP_010489978.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=464

 Score = 83.2 bits (204),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 10/76 (13%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPRE+RR R+         P+ EN
Sbjct  397  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREERRMRR--------TPE-EN  447

Query  397  YETDKXDNPDSTSDNK  350
             +TD+   P S S +K
Sbjct  448  SDTDR-STPVSRSQSK  462


 Score = 75.9 bits (185),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  352  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  398



>ref|XP_008800690.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Phoenix 
dactylifera]
Length=511

 Score = 83.2 bits (204),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDP+  KRPKM QVV MLE++E P  REDRR R+   G+ E EP +EN
Sbjct  430  ALKRALLVALRCVDPNADKRPKMGQVVRMLEADEVP-HREDRRHRRSHIGSMEIEPLKEN  488

Query  397  YETDKXDNPDSTSDNK  350
              +   +N   TS+ +
Sbjct  489  ANSSDMENGGGTSEGQ  504


 Score = 75.1 bits (183),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A E+NLV+WLKMMVG RR+EEVVDP +  +PSTR  
Sbjct  385  TGRDPVDYGRSANEINLVEWLKMMVGDRRAEEVVDPTLEVKPSTRAL  431



>ref|XP_007163295.1| hypothetical protein PHAVU_001G222700g [Phaseolus vulgaris]
 gb|ESW35289.1| hypothetical protein PHAVU_001G222700g [Phaseolus vulgaris]
Length=510

 Score = 80.1 bits (196),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEV DPNI  +PSTR  
Sbjct  388  TGRDPVDYGRPANEVNLVDWLKMMVGNRRSEEVADPNIEVKPSTRAL  434


 Score = 78.6 bits (192),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYP-IPREDRRQRKIQAGAAESEPQRE  401
            A KRALLTALRCVDPD  KRPKM QVV MLESEEYP +  + R +R+ + G+ E E Q+E
Sbjct  433  ALKRALLTALRCVDPDSEKRPKMGQVVRMLESEEYPLLREDRRHRRRNRGGSGEMESQKE  492

Query  400  NYETDKXDNPDSTSDNKG  347
              +TD+ +  DS  + +G
Sbjct  493  YSDTDRSEIQDSREERRG  510



>emb|CDO98700.1| unnamed protein product [Coffea canephora]
Length=522

 Score = 84.3 bits (207),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP MSQV  MLESEEYP+ R+  R+R+ Q G+     QREN
Sbjct  452  ALKRALLTALRCVDPDAEKRPIMSQVARMLESEEYPVLRKGGRRRRNQPGS-----QREN  506

Query  397  YETDKXDNP  371
             ETD+ +NP
Sbjct  507  DETDRSENP  515


 Score = 73.6 bits (179),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR A EVNLVDWLK+MVGSRR EEVVDP I +RP T
Sbjct  407  TGRDPVDYGRPAPEVNLVDWLKVMVGSRRFEEVVDPTIETRPPT  450



>ref|XP_007048877.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOX93034.1| Kinase superfamily protein [Theobroma cacao]
Length=508

 Score = 78.6 bits (192),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+  RP+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLEVRPTTRAL  431


 Score = 78.6 bits (192),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKMSQVV MLE++EYP  REDRR RK +  + E E  +E+
Sbjct  430  ALKRALLVALRCVDPDADKRPKMSQVVQMLEADEYPF-REDRRNRKSRTASMEIESMKES  488



>ref|XP_004138595.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cucumis sativus]
 ref|XP_004168359.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Cucumis sativus]
Length=481

 Score = 81.6 bits (200),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
             KR LLTALRCVDPD  KRPKMSQV  MLESEEYPI R+DRR RK  A A + EP+++
Sbjct  416  LKRVLLTALRCVDPDADKRPKMSQVSRMLESEEYPIRRQDRRPRKGHATATKKEPEKQ  473


 Score = 75.5 bits (184),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV Y R A EVNLVDWLKMMVGS+RSEEVVDPNI  +PS
Sbjct  370  TGRDPVDYSRPAHEVNLVDWLKMMVGSKRSEEVVDPNIERKPS  412



>gb|KHG07145.1| hypothetical protein F383_33874 [Gossypium arboreum]
Length=508

 Score = 80.1 bits (196),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+ +RP+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLETRPATRAL  431


 Score = 77.4 bits (189),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDPD  KRPKM+QVV MLE++EYP  REDRR RK +  + E E  +E
Sbjct  430  ALKRALLVALRCVDPDANKRPKMTQVVRMLEADEYPF-REDRRNRKSRTASMEIESLKE  487



>gb|KJB28776.1| hypothetical protein B456_005G071600 [Gossypium raimondii]
 gb|KJB28777.1| hypothetical protein B456_005G071600 [Gossypium raimondii]
 gb|KJB28779.1| hypothetical protein B456_005G071600 [Gossypium raimondii]
Length=495

 Score = 89.4 bits (220),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQV  MLE+EEYP+PREDRR+R+ Q+  ++++ QR+N
Sbjct  415  ALKRALLTALRCVDPDADKRPKMSQVARMLEAEEYPLPREDRRRRRNQSVNSDADTQRKN  474

Query  397  YETDKXDNPD  368
             + D+ D+PD
Sbjct  475  SDADRSDDPD  484


 Score = 68.2 bits (165),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR P+ YGR   EVN+V+WLKMMV  RRSEEVVDPNI +RPST   
Sbjct  370  TGRYPIDYGRPQPEVNMVEWLKMMVQLRRSEEVVDPNIETRPSTSAL  416



>gb|KJB75408.1| hypothetical protein B456_012G040400 [Gossypium raimondii]
 gb|KJB75409.1| hypothetical protein B456_012G040400 [Gossypium raimondii]
Length=508

 Score = 80.1 bits (196),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+ +RP+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLETRPATRAL  431


 Score = 77.0 bits (188),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDPD  KRPKM+QVV MLE++EYP  REDRR RK +  + E E  +E
Sbjct  430  ALKRALLVALRCVDPDANKRPKMTQVVRMLEADEYPF-REDRRNRKSRTASMEIESLKE  487



>ref|XP_002300876.1| kinase family protein [Populus trichocarpa]
 gb|EEE80149.1| kinase family protein [Populus trichocarpa]
Length=508

 Score = 79.0 bits (193),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  +RPKM+QVV MLE++EYP+ REDRR RK +  + E E  RE 
Sbjct  429  ALKRALLVALRCVDPDAERRPKMTQVVRMLEADEYPL-REDRRNRKTRTTSMEIESMREE  487

Query  397  YETDKXDNPDSTS  359
                +    DS S
Sbjct  488  STESENKGVDSES  500


 Score = 77.0 bits (188),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNL++WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  384  TGRDPVDYGRPANEVNLLEWLKMMVGTRRAEEVVDPNLEVKPTTRAL  430



>ref|XP_010924307.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Elaeis 
guineensis]
Length=511

 Score = 80.5 bits (197),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDP+  KRPKM QVV MLE+EE P  REDRR R+    + E EP RE+
Sbjct  430  ALKRALLVALRCVDPNADKRPKMGQVVRMLEAEEVP-HREDRRHRRSHMSSMEIEPLRES  488

Query  397  YETDKXDNPDSTSDN  353
              +   +N   TS+ 
Sbjct  489  ANSSDMENNGGTSEG  503


 Score = 75.5 bits (184),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG RR+EEVVDP +  RPSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGDRRAEEVVDPALEVRPSTRAL  431



>ref|XP_011026246.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Populus euphratica]
Length=504

 Score = 79.0 bits (193),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDPD  +RPKM+QVV MLE++EYP+ REDRR RK +  + E E  RE
Sbjct  429  ALKRALLVALRCVDPDAERRPKMTQVVRMLEADEYPL-REDRRNRKTRTTSMEIESMRE  486


 Score = 77.0 bits (188),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNL++WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  384  TGRDPVDYGRPANEVNLLEWLKMMVGTRRAEEVVDPNLEVKPTTRAL  430



>gb|KHN26187.1| Putative receptor-like protein kinase [Glycine soja]
Length=506

 Score = 80.1 bits (196),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVN+VDWLK MVG+RRSEEVVDPNI  +PSTR  
Sbjct  385  TGRDPVDYGRPAQEVNMVDWLKTMVGNRRSEEVVDPNIEVKPSTRAL  431


 Score = 75.5 bits (184),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKM QVV MLESEEYP+ REDRR R+ +   +E E  ++N
Sbjct  430  ALKRVLLTALRCVDPDSEKRPKMGQVVRMLESEEYPLAREDRRHRRNRGVNSEIESHKDN  489

Query  397  YETDKXDNPDSTSDN  353
             +TD  D   S S++
Sbjct  490  SDTDGSDIQGSRSES  504



>ref|XP_006605287.1| PREDICTED: receptor protein kinase isoform X1 [Glycine max]
 ref|XP_006605288.1| PREDICTED: receptor protein kinase isoform X2 [Glycine max]
Length=506

 Score = 80.1 bits (196),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVN+VDWLK MVG+RRSEEVVDPNI  +PSTR  
Sbjct  385  TGRDPVDYGRPAQEVNMVDWLKTMVGNRRSEEVVDPNIEVKPSTRAL  431


 Score = 75.5 bits (184),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKM QVV MLESEEYP+ REDRR R+ +   +E E  ++N
Sbjct  430  ALKRVLLTALRCVDPDSEKRPKMGQVVRMLESEEYPLAREDRRHRRNRGVNSEIESHKDN  489

Query  397  YETDKXDNPDSTSDN  353
             +TD  D   S S++
Sbjct  490  SDTDGSDIQGSRSES  504



>ref|XP_008458290.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Cucumis 
melo]
Length=481

 Score = 79.0 bits (193),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
             KR LLTALRCVDPD  KRPKMSQV  MLESEEYPI R+DRR RK  A A + E +++
Sbjct  416  LKRVLLTALRCVDPDADKRPKMSQVSRMLESEEYPIRRQDRRPRKGHATATKKEAEKQ  473


 Score = 76.3 bits (186),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR   EVNLVDWLKMMVGS+RSEEVVDPNI  +PS
Sbjct  370  TGRDPVDYGRPTHEVNLVDWLKMMVGSKRSEEVVDPNIERKPS  412



>ref|XP_010458230.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Camelina sativa]
Length=448

 Score = 79.3 bits (194),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQR  443
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPRED R +
Sbjct  400  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREDARGK  444


 Score = 75.9 bits (185),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  355  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  401



>ref|XP_006428296.1| hypothetical protein CICLE_v100116733mg, partial [Citrus clementina]
 gb|ESR41536.1| hypothetical protein CICLE_v100116733mg, partial [Citrus clementina]
Length=354

 Score = 82.4 bits (202),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR A EVNLVDWLKMMVGSRRSEEVVDPNI  RPSTR  
Sbjct  270  TGRDPVDHGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVRPSTRAL  316


 Score = 72.8 bits (177),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE  458
            A KR+LLTALRCVDPD  KRPKMSQVV MLESEEYPI RE
Sbjct  315  ALKRSLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIVRE  354



>ref|NP_001238381.1| receptor protein kinase [Glycine max]
 gb|ACM89464.1| receptor protein kinase [Glycine max]
Length=230

 Score = 80.5 bits (197),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR AQEVN+VDWLK MVG+RRSEEVVDPNI  +PSTR  
Sbjct  109  TGRDPVDYGRPAQEVNMVDWLKTMVGNRRSEEVVDPNIEVKPSTRAL  155


 Score = 74.7 bits (182),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKM QVV MLESEEYP+ REDRR R+ +   +E E  ++N
Sbjct  154  ALKRVLLTALRCVDPDSEKRPKMGQVVRMLESEEYPLAREDRRHRRNRGVNSEIESHKDN  213

Query  397  YETDKXDNPDSTSDN  353
             +TD  D   S S++
Sbjct  214  SDTDGSDIQGSRSES  228



>ref|XP_002315464.2| hypothetical protein POPTR_0010s00400g [Populus trichocarpa]
 gb|EEF01635.2| hypothetical protein POPTR_0010s00400g [Populus trichocarpa]
Length=472

 Score = 87.4 bits (215),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAES  416
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPR+DRR+ +  AG  E+
Sbjct  418  ALKRALLTALRCVDPDAEKRPKMSQVVRMLESEEYPIPRQDRRRWRSHAGEGET  471


 Score = 67.4 bits (163),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLV+WLKMMV  RRSEEVVDP I +RP+T   
Sbjct  373  TGRDPVDYDRPENEVNLVEWLKMMVAGRRSEEVVDPMIENRPATSAL  419



>ref|XP_010999309.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Populus 
euphratica]
Length=471

 Score = 87.4 bits (215),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAES  416
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPR+DRR+ +  AG  E+
Sbjct  417  ALKRALLTALRCVDPDAEKRPKMSQVVRMLESEEYPIPRQDRRRWRSHAGEGET  470


 Score = 67.4 bits (163),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLV+WLKMMV  RRSEEVVDP I +RP+T   
Sbjct  372  TGRDPVDYDRPENEVNLVEWLKMMVAGRRSEEVVDPMIENRPATSAL  418



>ref|XP_010549295.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Tarenaya hassleriana]
Length=481

 Score = 78.6 bits (192),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPNI  +P  R  
Sbjct  377  TGRDPVDYGRPAHEVNLVDWLKMMVGSRRSEEVVDPNIEVKPPRRAL  423


 Score = 75.9 bits (185),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE  458
            A KRALLTALRCVDPD  KRP MSQVV MLESEEYPIPRE
Sbjct  422  ALKRALLTALRCVDPDSDKRPNMSQVVRMLESEEYPIPRE  461



>gb|KDO60973.1| hypothetical protein CISIN_1g010519mg [Citrus sinensis]
Length=508

 Score = 77.8 bits (190),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLEVKPATRAL  431


 Score = 76.3 bits (186),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR+LL ALRCVDPD  KRPKMSQVV MLE+++YP  REDRR RK +  + E E  +E+
Sbjct  430  ALKRSLLVALRCVDPDSEKRPKMSQVVRMLEADDYPF-REDRRNRKSRTTSMEIESLKES  488

Query  397  YETD  386
             E +
Sbjct  489  TEIE  492



>ref|XP_006484873.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Citrus sinensis]
Length=508

 Score = 77.8 bits (190),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLEVKPATRAL  431


 Score = 76.3 bits (186),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR+LL ALRCVDPD  KRPKMSQVV MLE+++YP  REDRR RK +  + E E  +E+
Sbjct  430  ALKRSLLVALRCVDPDSEKRPKMSQVVRMLEADDYPF-REDRRNRKSRTTSMEIESLKES  488

Query  397  YETD  386
             E +
Sbjct  489  TEIE  492



>ref|XP_010243707.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Nelumbo 
nucifera]
Length=509

 Score = 82.8 bits (203),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKM QVV MLE++EYP  REDRR RK +  + E E  +EN
Sbjct  428  ALKRALLIALRCVDPDSEKRPKMGQVVRMLEADEYPY-REDRRNRKSRTTSMEIESMKEN  486

Query  397  YETDKXDNPDSTSDN  353
              ++  +N   +SD+
Sbjct  487  SGSNDIENSAGSSDS  501


 Score = 70.9 bits (172),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLV+WLK+MVG+RR+EEVVDPN+  +P+TR  
Sbjct  383  TGRDPVDYSRPENEVNLVEWLKVMVGTRRAEEVVDPNLEVKPTTRAL  429



>gb|AES92068.2| receptor-like kinase plant [Medicago truncatula]
Length=461

 Score = 77.4 bits (189),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+R +EEVVDPNI +RPST   
Sbjct  376  TGRDPVDYNRSAAEVNLVDWLKMMVGNRHAEEVVDPNIETRPSTSAL  422


 Score = 76.3 bits (186),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE  458
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPRE
Sbjct  421  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPRE  460



>ref|XP_008807804.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Phoenix 
dactylifera]
Length=514

 Score = 82.4 bits (202),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = -2

Query  544  CVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENYETDKXDNPDS  365
            CVDPD  KRPKMSQVV MLES+++ IP EDR+ R+ +AG+ E E Q+ NY++DK DNPDS
Sbjct  444  CVDPDSEKRPKMSQVVRMLESDDH-IPHEDRKHRRNKAGSGEIESQK-NYDSDKSDNPDS  501

Query  364  TSDNKGN  344
            TS+   N
Sbjct  502  TSNGTRN  508


 Score = 70.9 bits (172),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGRDPV YGR   EVNLVDWLK MVGSRRSE+VVD N+ +RPST
Sbjct  388  TGRDPVDYGRPPNEVNLVDWLKRMVGSRRSEDVVDLNMATRPST  431



>ref|XP_011044777.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Populus 
euphratica]
 ref|XP_011044778.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Populus 
euphratica]
Length=506

 Score = 77.0 bits (188),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR A EVNLV+WLKMMVG+RRSEEVVDPN+  +P+TR  
Sbjct  383  TGRDPVDHGRPANEVNLVEWLKMMVGTRRSEEVVDPNLEVKPTTRAL  429


 Score = 76.3 bits (186),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP+M+QV  MLE++EYP  REDRR RK +  + E E  +++
Sbjct  428  ALKRALLVALRCVDPDAEKRPRMTQVARMLEADEYP-SREDRRNRKSRTTSMEIESMKDS  486

Query  397  YET-DKXDNPDS  365
             ET +K  +P+S
Sbjct  487  TETENKVVDPES  498



>emb|CDX92604.1| BnaA10g16430D [Brassica napus]
Length=486

 Score = 89.7 bits (221),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAG-AAESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+RK + G  +ES+P R 
Sbjct  410  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRKSENGPTSESDPPRN  469

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  470  STDTDKSEFHD  480


 Score = 63.9 bits (154),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  365  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLNTKPSTSAL  411



>ref|XP_003609871.1| Protein kinase domain containing protein expressed [Medicago 
truncatula]
Length=438

 Score = 77.4 bits (189),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLVDWLKMMVG+R +EEVVDPNI +RPST   
Sbjct  353  TGRDPVDYNRSAAEVNLVDWLKMMVGNRHAEEVVDPNIETRPSTSAL  399


 Score = 75.9 bits (185),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE  458
            A KR LLTALRCVDPD  KRPKMSQVV MLESEEYPIPRE
Sbjct  398  ALKRVLLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPRE  437



>ref|XP_002307552.2| kinase family protein [Populus trichocarpa]
 gb|EEE94548.2| kinase family protein [Populus trichocarpa]
Length=507

 Score = 77.0 bits (188),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR A EVNLV+WLKMMVG+RRSEEVVDPN+  +P+TR  
Sbjct  384  TGRDPVDHGRPANEVNLVEWLKMMVGTRRSEEVVDPNLEVKPTTRAL  430


 Score = 76.3 bits (186),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP+M+QV  MLE++EYP  REDRR RK +  + E E  +++
Sbjct  429  ALKRALLVALRCVDPDAEKRPRMTQVARMLEADEYP-SREDRRNRKSRTTSMEIESMKDS  487

Query  397  YET-DKXDNPDS  365
             ET +K  +P+S
Sbjct  488  TETENKVVDPES  499



>ref|XP_002526652.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35740.1| ATP binding protein, putative [Ricinus communis]
Length=509

 Score = 78.6 bits (192),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKMSQVV MLE++EYP   EDRR RK +  + E E  +E+
Sbjct  429  ALKRALLVALRCVDPDAEKRPKMSQVVRMLEADEYPF-HEDRRNRKSRTTSMEIESMKES  487

Query  397  YETDKXDNPDSTSDNKGNL  341
             + +       ++ N+ NL
Sbjct  488  NDIENKVGDSESTANEINL  506


 Score = 74.3 bits (181),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR+EEVVDPN+   P+TR  
Sbjct  384  TGRDPVDYARPANEVNLVEWLKMMVGTRRAEEVVDPNLEVNPTTRAL  430



>ref|NP_564722.1| protein kinase [Arabidopsis thaliana]
 ref|NP_974041.1| protein kinase [Arabidopsis thaliana]
 ref|NP_001077731.1| protein kinase [Arabidopsis thaliana]
 gb|AAP37681.1| At1g56720 [Arabidopsis thaliana]
 dbj|BAE99985.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE33428.1| protein kinase [Arabidopsis thaliana]
 gb|AEE33429.1| protein kinase [Arabidopsis thaliana]
 gb|AEE33430.1| protein kinase [Arabidopsis thaliana]
Length=492

 Score = 80.1 bits (196),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  376  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  422


 Score = 73.2 bits (178),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  421  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRSRTREGSME  473



>ref|XP_002892506.1| hypothetical protein ARALYDRAFT_311987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68765.1| hypothetical protein ARALYDRAFT_311987 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score = 77.0 bits (188),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQR  443
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYPIPRE   Q+
Sbjct  398  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPIPREKSVQK  442


 Score = 75.9 bits (185),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  353  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  399



>ref|XP_006437163.1| hypothetical protein CICLE_v10031290mg [Citrus clementina]
 gb|ESR50403.1| hypothetical protein CICLE_v10031290mg [Citrus clementina]
Length=508

 Score = 77.4 bits (189),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPNLEVKPATRSL  431


 Score = 75.5 bits (184),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KR+LL ALRCVDPD  KRPKMSQVV MLE+++YP  REDRR RK    + E E  +E+
Sbjct  430  SLKRSLLVALRCVDPDSEKRPKMSQVVRMLEADDYPF-REDRRNRKSHTTSMEIESLKES  488

Query  397  YETD  386
             E +
Sbjct  489  TEIE  492



>gb|AAM65034.1| Putative protein kinase [Arabidopsis thaliana]
Length=492

 Score = 80.1 bits (196),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  376  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  422


 Score = 72.8 bits (177),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  421  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRSRTREGSME  473



>gb|AAG09092.1|AC009323_3 Putative protein kinase [Arabidopsis thaliana]
Length=495

 Score = 80.1 bits (196),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  379  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  425


 Score = 72.8 bits (177),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  424  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRSRTREGSME  476



>ref|XP_009131671.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
Length=489

 Score = 88.6 bits (218),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  413  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRKRRSQNGTTRDSDPPRN  472

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  473  STDTDKSEYHD  483


 Score = 64.3 bits (155),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEVVDPN+ ++PST   
Sbjct  368  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVVDPNLNTKPSTSAL  414



>ref|XP_009394806.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 79.7 bits (195),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE++E P  REDRR R+ QAG+ E E  +E+
Sbjct  431  ALKRTLLVALRCVDPDSDKRPKMGQVVRMLEADELPY-REDRRNRRNQAGSMEIEALKES  489

Query  397  YETDKXDNPDSTSDNK  350
              +   +N     DN+
Sbjct  490  NSSTDLENKVGLGDNR  505


 Score = 73.2 bits (178),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLKMMVG+RR+EEVVDPN+  +P+ R  
Sbjct  386  TGRDPVDYGRPTNEVNLVEWLKMMVGNRRAEEVVDPNLEVKPAMRAL  432



>emb|CDX88934.1| BnaA03g07150D [Brassica napus]
Length=489

 Score = 88.6 bits (218),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  413  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRKRRSQNGTTRDSDPPRN  472

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  473  STDTDKSEYHD  483


 Score = 63.9 bits (154),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEVVDPN+ ++PST   
Sbjct  368  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVVDPNLNTKPSTSAL  414



>gb|AAC33204.1| Putative protein kinase [Arabidopsis thaliana]
Length=482

 Score = 76.6 bits (187),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQR  443
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEYP+PRE   Q+
Sbjct  399  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEYPVPREKSMQK  443


 Score = 75.9 bits (185),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  354  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  400



>emb|CDX70823.1| BnaC03g09070D [Brassica napus]
Length=541

 Score = 88.2 bits (217),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  465  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRKRRSQNGTTRDSDPPRN  524

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  525  STDTDKSEYHD  535


 Score = 64.3 bits (155),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEVVDPN+ ++PST   
Sbjct  420  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVVDPNLNTKPSTSAL  466



>ref|XP_010275616.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Nelumbo 
nucifera]
 ref|XP_010275624.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Nelumbo 
nucifera]
Length=509

 Score = 81.6 bits (200),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKM QVV MLE++E+P  REDRR RK Q  + E E  +EN
Sbjct  428  ALKRALLIALRCVDPDSEKRPKMGQVVRMLETDEHPF-REDRRNRKSQTTSMELESLKEN  486

Query  397  YETDKXDNPDSTSDN  353
              +   +N   TSD+
Sbjct  487  SGSIDMENNVETSDS  501


 Score = 70.5 bits (171),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR+PV +GR   EVNLV+WLKMMVG++R EEVVDPN+  RP+TR  
Sbjct  383  TGREPVDHGRPENEVNLVEWLKMMVGTKRVEEVVDPNLEVRPTTRAL  429



>ref|XP_002519317.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43181.1| conserved hypothetical protein [Ricinus communis]
Length=407

 Score = 99.8 bits (247),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRPKMSQ V MLESE Y IPREDRR+RK Q+   ++E Q+EN
Sbjct  327  ALKRALLTALRCVDPDAEKRPKMSQAVRMLESEAYTIPREDRRRRKNQSAIMDAESQKEN  386

Query  397  YETDKXDNPD-STSDNKGN  344
             + DK D PD  T   +GN
Sbjct  387  SDNDKSDIPDLKTESRRGN  405


 Score = 52.0 bits (123),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  674  EVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            +VNLV+WLKMMV  RRSEEVVDP I +RPST   
Sbjct  295  KVNLVEWLKMMVARRRSEEVVDPMIETRPSTSAL  328



>ref|XP_009120967.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
 ref|XP_009120968.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
Length=486

 Score = 87.8 bits (216),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+RK + G   ES+P R 
Sbjct  413  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRKSENGPTRESDPPRN  472

Query  400  NYETDKXD  377
            + +TDK +
Sbjct  473  STDTDKSE  480


 Score = 63.9 bits (154),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  368  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLNTKPSTSAL  414



>ref|XP_003536030.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Glycine max]
 gb|KHN16029.1| Putative receptor-like protein kinase [Glycine soja]
Length=506

 Score = 79.7 bits (195),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR AQEVN+VDWLK MVG+RRSEEVVDPNI  +PSTR
Sbjct  385  TGRDPVDYGRPAQEVNMVDWLKTMVGNRRSEEVVDPNIEVKPSTR  429


 Score = 72.0 bits (175),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
              KR LLTALRCVDPD  KRPKM QVV +LESEEYP+ REDRR R+ +   +E E  ++N
Sbjct  430  VLKRTLLTALRCVDPDSEKRPKMGQVVRILESEEYPLAREDRRHRRNRGVNSEIESHKDN  489

Query  397  YETDKXDNPDSTSDN  353
             +TD  D   S S++
Sbjct  490  SDTDGSDIQGSRSES  504



>ref|XP_010546937.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Tarenaya 
hassleriana]
 ref|XP_010546938.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Tarenaya 
hassleriana]
 ref|XP_010546939.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Tarenaya 
hassleriana]
Length=484

 Score = 90.9 bits (224),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDP   KRPKMSQV  MLESEEYPIPREDRR+R+ Q G   SEP R +
Sbjct  403  ALKRTLLTALRCVDPMADKRPKMSQVARMLESEEYPIPREDRRRRRNQTGTTYSEPPRNS  462

Query  397  YETDKXDNPDSTSDN  353
             +TDK D  D   DN
Sbjct  463  TDTDKSDCNDQKVDN  477


 Score = 60.8 bits (146),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+D N+ ++PST   
Sbjct  358  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDSNLETKPSTSAL  404



>ref|XP_010558464.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558465.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558466.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558467.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558468.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010558469.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform 
X1 [Tarenaya hassleriana]
Length=477

 Score = 87.4 bits (215),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDP   KRPKMSQV  MLESEEYPIPREDRR+R+ Q G  +S+P R +
Sbjct  404  ALKRTLLTALRCVDPVADKRPKMSQVARMLESEEYPIPREDRRRRRNQTGTRDSDPPRNS  463

Query  397  YETDKXDNPD  368
             +TDK D  D
Sbjct  464  TDTDKSDYHD  473


 Score = 64.3 bits (155),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  359  TGRYPVDYARLPPEVHLVEWLKMMVQQRRSEEVIDPNLETKPSTSAL  405



>emb|CDY63248.1| BnaCnng41740D [Brassica napus]
Length=487

 Score = 87.8 bits (216),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+RK + G   ES+P R 
Sbjct  411  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRKSENGPTRESDPPRN  470

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  471  STDTDKSEFQD  481


 Score = 63.9 bits (154),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  366  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLNTKPSTSAL  412



>ref|XP_006380205.1| hypothetical protein POPTR_0008s22920g [Populus trichocarpa]
 gb|ERP58002.1| hypothetical protein POPTR_0008s22920g [Populus trichocarpa]
Length=487

 Score = 85.9 bits (211),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LLTALRCVDPD  KRPKMS+VV MLESEEYP+PR+DRR R+ +AG  E E Q EN
Sbjct  417  ALKRGLLTALRCVDPDADKRPKMSRVVRMLESEEYPMPRQDRRHRRSRAG--EGESQMEN  474

Query  397  YETDKXDNPDS  365
             +TD+ +NPD+
Sbjct  475  SDTDRNENPDT  485


 Score = 65.5 bits (158),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV +GR   EV+LV+WLK MV  RRSEEVVDP I +RPST   
Sbjct  372  TGRDPVDHGRPENEVHLVEWLKTMVARRRSEEVVDPMIETRPSTSAL  418



>ref|XP_010926408.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Elaeis guineensis]
 ref|XP_010926414.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Elaeis guineensis]
Length=512

 Score = 77.8 bits (190),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE+EE P  REDRR R+   G+ E E  +EN
Sbjct  431  ALKRTLLVALRCVDPDADKRPKMGQVVRMLETEEVP-HREDRRHRRSHMGSMEIESLKEN  489

Query  397  YETDKXDN  374
              +   +N
Sbjct  490  ANSSDMEN  497


 Score = 73.2 bits (178),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR+EEVVDP +  +PSTR  
Sbjct  386  TGRDPVDYARPANEVNLVEWLKMMVGNRRAEEVVDPTLEVKPSTRAL  432



>ref|XP_004303875.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Fragaria 
vesca subsp. vesca]
Length=509

 Score = 75.9 bits (185),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK+MVG+RR+EEVVDPN+ ++PSTR  
Sbjct  383  TGRDPVDYSRPANEVNLVEWLKLMVGARRAEEVVDPNLEAKPSTRSL  429


 Score = 75.1 bits (183),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            + KRALL ALRCVD D   RPKMSQVV MLE++EYP  REDRR RK +  + E E  +EN
Sbjct  428  SLKRALLVALRCVDHDAENRPKMSQVVRMLEADEYPF-REDRRNRKTRTTSMEIESLKEN  486

Query  397  YETDKXDN  374
              +   +N
Sbjct  487  SVSGDTEN  494



>ref|XP_010926424.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Elaeis guineensis]
Length=414

 Score = 77.4 bits (189),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE+EE P  REDRR R+   G+ E E  +EN
Sbjct  333  ALKRTLLVALRCVDPDADKRPKMGQVVRMLETEEVP-HREDRRHRRSHMGSMEIESLKEN  391

Query  397  YETDKXDN  374
              +   +N
Sbjct  392  ANSSDMEN  399


 Score = 73.2 bits (178),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR+EEVVDP +  +PSTR  
Sbjct  288  TGRDPVDYARPANEVNLVEWLKMMVGNRRAEEVVDPTLEVKPSTRAL  334



>ref|XP_010511315.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010511316.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010511317.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010511318.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010511319.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=486

 Score = 80.1 bits (196),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  370  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  416


 Score = 70.5 bits (171),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  415  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRPRTREGSME  467



>ref|XP_002894669.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70928.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score = 80.1 bits (196),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  376  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  422


 Score = 70.5 bits (171),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  421  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRPRTREGSME  473



>ref|XP_010415021.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010415022.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010415023.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=491

 Score = 80.1 bits (196),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  375  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  421


 Score = 70.5 bits (171),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  420  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRPRTREGSME  472



>ref|XP_007216751.1| hypothetical protein PRUPE_ppa024910mg, partial [Prunus persica]
 gb|EMJ17950.1| hypothetical protein PRUPE_ppa024910mg, partial [Prunus persica]
Length=493

 Score = 76.6 bits (187),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RRSE+VVDPN+  +PSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKLMVGARRSEDVVDPNLEVKPSTRAL  431


 Score = 73.6 bits (179),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKMSQVV MLE++EYP  REDRR RK +  + + E  +EN
Sbjct  430  ALKRALLVALRCVDHDAENRPKMSQVVRMLEADEYPF-REDRRNRKSRTTSMDIESVKEN  488



>ref|XP_008342350.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Malus 
domestica]
Length=513

 Score = 77.4 bits (189),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEVVDPN+  +PSTR  
Sbjct  387  TGRDPVDYGRPANEVNLVEWLKLMVGARRAEEVVDPNLEVKPSTRAL  433


 Score = 72.4 bits (176),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKMSQVV MLE++EYP  REDRR RK +  + + E  +E+
Sbjct  432  ALKRALLVALRCVDHDSENRPKMSQVVRMLEADEYPF-REDRRNRKSRTASMDMESMKES  490



>ref|XP_009377357.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Pyrus 
x bretschneideri]
Length=513

 Score = 77.4 bits (189),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEVVDPN+  +PSTR  
Sbjct  387  TGRDPVDYGRPANEVNLVEWLKLMVGARRAEEVVDPNLEVKPSTRAL  433


 Score = 72.4 bits (176),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKMSQVV MLE++EYP  REDRR RK +  + + E  +E+
Sbjct  432  ALKRALLVALRCVDHDSENRPKMSQVVRMLEADEYPF-REDRRNRKSRTSSMDMESMKES  490



>ref|XP_006301386.1| hypothetical protein CARUB_v10021799mg [Capsella rubella]
 gb|EOA34284.1| hypothetical protein CARUB_v10021799mg [Capsella rubella]
Length=491

 Score = 80.1 bits (196),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDPNI  +P TR  
Sbjct  375  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTRSL  421


 Score = 69.7 bits (169),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+ + + G+ E
Sbjct  420  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRPRTREGSME  472



>ref|XP_008229427.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Prunus 
mume]
 ref|XP_008229428.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Prunus 
mume]
Length=513

 Score = 76.3 bits (186),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG RRSE+VVDPN+  +PSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKLMVGGRRSEDVVDPNLEVKPSTRAL  431


 Score = 73.6 bits (179),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKMSQVV MLE++EYP  REDRR RK +  + + E  +EN
Sbjct  430  ALKRALLVALRCVDHDAENRPKMSQVVRMLEADEYPF-REDRRNRKSRTTSMDIESVKEN  488



>ref|XP_008797511.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Phoenix dactylifera]
Length=512

 Score = 75.5 bits (184),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE+EE P  REDRR R+   G+ E E  +E+
Sbjct  431  ALKRTLLVALRCVDPDADKRPKMGQVVRMLEAEEVP-HREDRRHRRSHMGSMEIESLKES  489

Query  397  YETDKXDN  374
              +   +N
Sbjct  490  ANSSDMEN  497


 Score = 73.9 bits (180),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR++EVVDP +  +PSTR  
Sbjct  386  TGRDPVDYGRPANEVNLVEWLKMMVGNRRADEVVDPTLEVKPSTRAL  432



>gb|KDP38903.1| hypothetical protein JCGZ_05288 [Jatropha curcas]
Length=503

 Score = 77.0 bits (188),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDPD  KRPKMSQVV MLE++EYP  REDRR RK +  + E E   E
Sbjct  425  ALKRALLVALRCVDPDAEKRPKMSQVVRMLEADEYPF-REDRRNRKSRTTSMEIESMNE  482


 Score = 72.4 bits (176),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEV+DP++  +P+TR  
Sbjct  380  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVMDPSLEVKPTTRAL  426



>gb|KJB38676.1| hypothetical protein B456_006G266500 [Gossypium raimondii]
 gb|KJB38677.1| hypothetical protein B456_006G266500 [Gossypium raimondii]
Length=498

 Score = 80.9 bits (198),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE  413
            A KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPREDRR+R+ Q   +E+E
Sbjct  417  ALKRALLTALRCVDPDADKRPKMSQVVRMLESEEYPIPREDRRRRRNQTVNSEAE  471


 Score = 68.2 bits (165),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV YGR   EVN+V+WLKMMV  RRSEEVVDPNI +RPST   
Sbjct  372  TGRYPVDYGRPQPEVNMVEWLKMMVQLRRSEEVVDPNIEARPSTSAL  418



>ref|XP_006392400.1| hypothetical protein EUTSA_v10023423mg [Eutrema salsugineum]
 gb|ESQ29686.1| hypothetical protein EUTSA_v10023423mg [Eutrema salsugineum]
Length=496

 Score = 79.0 bits (193),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVG+RRSEEVVDP I  RP TR  
Sbjct  383  TGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPKIEVRPPTRSL  429


 Score = 70.1 bits (170),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE  413
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPI REDRR+ + + G+ +S+
Sbjct  428  SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPILREDRRRSRTREGSMDSD  482



>ref|XP_011082904.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Sesamum 
indicum]
Length=507

 Score = 76.6 bits (187),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  380  TGRDPVDYGRPADEVNLVEWLKMMVGNRRAEEVVDPNLEVKPTTRAL  426


 Score = 71.2 bits (173),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRK  440
            A KRALL ALRCVDPD  KRPKMS VV MLE+++YP  REDRR RK
Sbjct  425  ALKRALLVALRCVDPDSEKRPKMSHVVRMLETDDYPY-REDRRSRK  469



>ref|XP_008797510.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Phoenix dactylifera]
Length=513

 Score = 73.9 bits (180),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR++EVVDP +  +PSTR  
Sbjct  386  TGRDPVDYGRPANEVNLVEWLKMMVGNRRADEVVDPTLEVKPSTRAL  432


 Score = 73.6 bits (179),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE+EE P    DRR R+   G+ E E  +E+
Sbjct  431  ALKRTLLVALRCVDPDADKRPKMGQVVRMLEAEEVPHREVDRRHRRSHMGSMEIESLKES  490

Query  397  YETDKXDN  374
              +   +N
Sbjct  491  ANSSDMEN  498



>ref|XP_010544138.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Tarenaya 
hassleriana]
Length=523

 Score = 89.0 bits (219),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -2

Query  565  ALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRENYETD  386
            +LLTALRCVDP   KRP+MSQVV MLESEEYPIPREDRR+ K    + E E Q+EN +TD
Sbjct  451  SLLTALRCVDPVSDKRPRMSQVVRMLESEEYPIPREDRRRSKTHGDSMEIELQKENSDTD  510

Query  385  KXDNPDSTSDNK  350
               NP S S +K
Sbjct  511  -ASNPASRSQSK  521


 Score = 57.8 bits (138),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSE  621
            TGRDPV YGR   EVNLVDWLKMMVG+RRSE
Sbjct  396  TGRDPVDYGRPPHEVNLVDWLKMMVGNRRSE  426



>ref|XP_002283589.2| PREDICTED: probable receptor-like protein kinase At2g42960 [Vitis 
vinifera]
 ref|XP_010657122.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Vitis 
vinifera]
Length=503

 Score = 75.5 bits (184),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEVVDPN+  +P+TR  
Sbjct  379  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVVDPNLEVKPTTRAL  425


 Score = 71.2 bits (173),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKMSQVV MLE +EYP  REDRR+ +    + + E  +EN
Sbjct  424  ALKRALLVALRCVDPDSEKRPKMSQVVRMLEQDEYPF-REDRRKSRTT--SMDLESMKEN  480

Query  397  YETDKXDN  374
              +   +N
Sbjct  481  SGSGDVEN  488



>emb|CBI22107.3| unnamed protein product [Vitis vinifera]
Length=633

 Score = 75.9 bits (185),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEVVDPN+  +P+TR  
Sbjct  509  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVVDPNLEVKPTTRAL  555


 Score = 71.2 bits (173),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRPKMSQVV MLE +EYP  REDRR+ +    + + E  +EN
Sbjct  554  ALKRALLVALRCVDPDSEKRPKMSQVVRMLEQDEYPF-REDRRKSRTT--SMDLESMKEN  610

Query  397  YETDKXDNPDSTSD  356
              +   +N  + S+
Sbjct  611  SGSGDVENKVNESE  624



>gb|KGN45621.1| hypothetical protein Csa_6G000690 [Cucumis sativus]
Length=443

 Score = 82.0 bits (201),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
             KR LLTALRCVDPD  KRPKMSQV  MLESEEYPI R+DRR RK  A A + EP+++
Sbjct  378  LKRVLLTALRCVDPDADKRPKMSQVSRMLESEEYPIRRQDRRPRKGHATATKKEPEKQ  435


 Score = 64.3 bits (155),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  692  YGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            +GR A EVNLVDWLKMMVGS+RSEEVVDPNI  +PS
Sbjct  339  FGRPAHEVNLVDWLKMMVGSKRSEEVVDPNIERKPS  374



>emb|CAH55606.1| putative protein kinase [Zea mays]
Length=504

 Score = 73.2 bits (178),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+TR  
Sbjct  381  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPATRAL  427


 Score = 73.2 bits (178),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +G A+SE +  +
Sbjct  426  ALKRALLVALRCVDPDSEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSGNADSESKASS  484

Query  397  YE  392
             E
Sbjct  485  SE  486



>ref|XP_008670010.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Zea 
mays]
 emb|CAH39852.1| putative protein kinase [Zea mays]
 gb|ACR38669.1| unknown [Zea mays]
 tpg|DAA39465.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=508

 Score = 73.2 bits (178),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+TR  
Sbjct  385  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPATRAL  431


 Score = 73.2 bits (178),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +G A+SE +  +
Sbjct  430  ALKRALLVALRCVDPDSEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSGNADSESKASS  488

Query  397  YE  392
             E
Sbjct  489  SE  490



>ref|XP_006840316.1| hypothetical protein AMTR_s00045p00079270 [Amborella trichopoda]
 gb|ERN01991.1| hypothetical protein AMTR_s00045p00079270 [Amborella trichopoda]
Length=469

 Score = 84.0 bits (206),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLVDWLKMMVGSRRSEEVVDPN+ +RPSTR  
Sbjct  378  TGRDPVDYGRPANEVNLVDWLKMMVGSRRSEEVVDPNMETRPSTRAL  424


 Score = 62.0 bits (149),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPI  467
            A KRALL ALRCVDP+  KRPKM+QVV MLE+EE+P+
Sbjct  423  ALKRALLVALRCVDPESDKRPKMTQVVRMLEAEEFPL  459



>ref|XP_006287624.1| hypothetical protein CARUB_v10000836mg [Capsella rubella]
 gb|EOA20522.1| hypothetical protein CARUB_v10000836mg [Capsella rubella]
Length=485

 Score = 82.4 bits (202),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q GA  +S+P R 
Sbjct  409  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRRSQNGATRDSDPPRN  468

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  469  STDTDKSEYHD  479


 Score = 63.5 bits (153),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  364  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLETKPSTSAL  410



>ref|XP_010454092.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010454093.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010454094.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010454095.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010454097.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010454098.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=485

 Score = 82.0 bits (201),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +SEP R 
Sbjct  409  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRRSQNGTTRDSEPPRN  468

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  469  STDTDKSEYHD  479


 Score = 63.9 bits (154),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  364  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLETKPSTSAL  410



>ref|XP_009356614.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Pyrus 
x bretschneideri]
Length=511

 Score = 76.3 bits (186),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG++R+EEVVDPN+  +PSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKLMVGAKRAEEVVDPNLEVKPSTRAL  431


 Score = 69.3 bits (168),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKMSQVV MLE++E+P  REDRR RK +  + + E  +E+
Sbjct  430  ALKRALLVALRCVDHDSENRPKMSQVVRMLEADEHPF-REDRRNRKSRTTSMDMESVKES  488



>ref|XP_009410960.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 73.6 bits (179),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  KRPKM QVV MLE++E    REDRR R+ Q G  E E Q+E+
Sbjct  431  ALKRTLLVALRCVDPDADKRPKMGQVVRMLEADEVSY-REDRRNRRNQTGNVEIEAQKES  489

Query  397  YETDKXDN  374
              +   +N
Sbjct  490  NSSSDMEN  497


 Score = 72.0 bits (175),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            T RDPV Y R A EVNLV+WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  386  TSRDPVDYSRPANEVNLVEWLKMMVGNRRAEEVVDPNLEVKPATRAL  432



>ref|XP_010053573.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Eucalyptus 
grandis]
 gb|KCW89730.1| hypothetical protein EUGRSUZ_A01991 [Eucalyptus grandis]
Length=507

 Score = 73.2 bits (178),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEVVDP +  +P+TR  
Sbjct  382  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVVDPTLEVKPATRAL  428


 Score = 72.4 bits (176),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE-  401
            A KR+LL ALRCVDP+  KRPKM+QVV MLE++EYP  REDRR +K +  + + E  +E 
Sbjct  427  ALKRSLLVALRCVDPEADKRPKMTQVVRMLEADEYPF-REDRRNKKSRTASMDIELTKEA  485

Query  400  --NYETDKXDNPDS  365
              + E +   NP+S
Sbjct  486  TGSAEVESQANPES  499



>emb|CDP11896.1| unnamed protein product, partial [Coffea canephora]
Length=149

 Score = 83.2 bits (204),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALLTALRCVDPD  KRP MSQV  MLESEEYP+ R+  R+R+ Q G+     QREN
Sbjct  79   ALKRALLTALRCVDPDAEKRPIMSQVARMLESEEYPVLRKGGRRRRNQPGS-----QREN  133

Query  397  YETDKXDNP  371
             ETD+ +NP
Sbjct  134  DETDRSENP  142


 Score = 62.4 bits (150),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -1

Query  713  TGRDPVXY-GRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y  +   EVNLVDWLK+MVGSRR EEVVDP I +RP T   
Sbjct  33   TGRDPVDYVSKFDIEVNLVDWLKVMVGSRRFEEVVDPTIETRPPTTAL  80



>ref|XP_002459575.1| hypothetical protein SORBIDRAFT_02g006870 [Sorghum bicolor]
 gb|EER96096.1| hypothetical protein SORBIDRAFT_02g006870 [Sorghum bicolor]
Length=521

 Score = 74.3 bits (181),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVGSRR+EEVVDP++  +P+TR  
Sbjct  398  TGRDPVDYGRPANEVHLVEWLKMMVGSRRAEEVVDPDMELKPTTRAL  444


 Score = 70.9 bits (172),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A+SE +  +
Sbjct  443  ALKRALLVALRCVDPDSEKRPTMGQVVRMLEAEDVP-SREDRRSRRAHSSNADSESKASS  501

Query  397  YE  392
             E
Sbjct  502  SE  503



>ref|XP_010688888.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010688889.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Beta 
vulgaris subsp. vulgaris]
Length=512

 Score = 76.3 bits (186),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK+MVG+RRSEEVVDPN+  +P+TRG 
Sbjct  383  TGRDPVDYSRPANEVNLVEWLKVMVGTRRSEEVVDPNLEVKPTTRGL  429


 Score = 68.6 bits (166),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
              KRALL ALRC+DPD  KRPKMSQVV MLE+++ P  REDRR RK +  + E E  +E
Sbjct  428  GLKRALLVALRCIDPDPEKRPKMSQVVRMLEADDVP-NREDRRNRKSRTTSMEFEIAKE  485



>ref|XP_009113370.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
 ref|XP_009113371.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
Length=498

 Score = 79.3 bits (194),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RRSEEVVDPNI  RP TR  
Sbjct  384  TGRDPVDYGRPAHEVNLVEWLKMMVGTRRSEEVVDPNIEVRPPTRSL  430


 Score = 65.5 bits (158),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE  413
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPRE+RR+ + + G+ +S+
Sbjct  429  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREERRRPRTREGSMDSD  483



>emb|CDY66239.1| BnaCnng50120D [Brassica napus]
Length=484

 Score = 79.3 bits (194),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RRSEEVVDPNI  RP TR  
Sbjct  370  TGRDPVDYGRPAHEVNLVEWLKMMVGTRRSEEVVDPNIEVRPPTRSL  416


 Score = 65.5 bits (158),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE  413
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEYPIPRE+RR+ + + G+ +S+
Sbjct  415  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEYPIPREERRRPRTREGSMDSD  469



>ref|XP_010420613.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010420614.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010420615.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010420616.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010492854.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010492856.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010492857.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010492858.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
 ref|XP_010492859.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Camelina 
sativa]
Length=485

 Score = 80.5 bits (197),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  409  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRRSQNGTTRDSDPPRN  468

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  469  STDTDKSEYHD  479


 Score = 63.5 bits (153),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  364  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLETKPSTSAL  410



>emb|CDX95286.1| BnaC09g15840D [Brassica napus]
Length=498

 Score = 79.3 bits (194),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RRSEE+VDPNI  RP TR  
Sbjct  384  TGRDPVDYGRPAHEVNLVEWLKMMVGTRRSEELVDPNIEERPPTRSL  430


 Score = 65.1 bits (157),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEY  473
            + KRALLTALRCVDPD  KRPKMSQVV MLESEEY
Sbjct  429  SLKRALLTALRCVDPDSEKRPKMSQVVRMLESEEY  463



>ref|XP_004139824.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Cucumis sativus]
 ref|XP_004166792.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Cucumis sativus]
 gb|KGN44261.1| hypothetical protein Csa_7G236290 [Cucumis sativus]
Length=509

 Score = 75.5 bits (184),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEV+DP++ ++PSTR  
Sbjct  391  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVIDPSLETKPSTRAL  437


 Score = 68.6 bits (166),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQR  404
            A KRALL ALRCVDP+  KRPKM+QVV MLE+++YP  REDRR +K     +E E  +
Sbjct  436  ALKRALLIALRCVDPEADKRPKMTQVVRMLEADDYP-SREDRRSQKSSTANSEIESSQ  492



>ref|XP_006662656.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Oryza brachyantha]
Length=516

 Score = 72.4 bits (176),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  384  TGRDPIDYDRPPNEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  428


 Score = 71.6 bits (174),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRK-IQAGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+ + + ++E+EP R  
Sbjct  430  LKRALLTALRCIDLNAEKRPRMDQVVRMLDSNE-PIPQEERRQRQNLASNSSETEPLRGK  488

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  489  NSSGKSDAPEN  499



>ref|XP_006644104.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Oryza brachyantha]
Length=516

 Score = 72.4 bits (176),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  384  TGRDPIDYDRPPNEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  428


 Score = 71.6 bits (174),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRK-IQAGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+ + + ++E+EP R  
Sbjct  430  LKRALLTALRCIDLNAEKRPRMDQVVRMLDSNE-PIPQEERRQRQNLASNSSETEPLRGK  488

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  489  NSSGKSDAPEN  499



>ref|XP_008358013.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Malus 
domestica]
Length=511

 Score = 76.3 bits (186),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG++R+EEVVDPN+  +PSTR  
Sbjct  385  TGRDPVDYGRPANEVNLVEWLKLMVGAKRAEEVVDPNLEVKPSTRAL  431


 Score = 67.8 bits (164),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVD D   RPKM QVV MLE++E+P  REDRR RK +  + + E  +E+
Sbjct  430  ALKRALLVALRCVDHDSENRPKMXQVVRMLEADEHPF-REDRRNRKSRTTSMDMESAKES  488



>ref|XP_008447129.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Cucumis 
melo]
 ref|XP_008447130.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Cucumis 
melo]
 ref|XP_008447131.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Cucumis 
melo]
Length=509

 Score = 75.5 bits (184),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLK+MVG+RR+EEV+DP++ ++PSTR  
Sbjct  391  TGRDPVDYGRPANEVNLVEWLKVMVGTRRAEEVIDPSLETKPSTRAL  437


 Score = 68.6 bits (166),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQR  404
            A KRALL ALRCVDP+  KRPKM+QVV MLE+++YP  REDRR +K     +E E  +
Sbjct  436  ALKRALLIALRCVDPEADKRPKMTQVVRMLEADDYP-SREDRRSQKSSTANSEIESSQ  492



>ref|XP_002871819.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48078.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score = 80.1 bits (196),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  408  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRRGQNGTTKDSDPPRN  467

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  468  STDTDKSEYHD  478


 Score = 63.5 bits (153),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  363  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLETKPSTSAL  409



>ref|XP_007141407.1| hypothetical protein PHAVU_008G192900g [Phaseolus vulgaris]
 ref|XP_007141408.1| hypothetical protein PHAVU_008G192900g [Phaseolus vulgaris]
 gb|ESW13401.1| hypothetical protein PHAVU_008G192900g [Phaseolus vulgaris]
 gb|ESW13402.1| hypothetical protein PHAVU_008G192900g [Phaseolus vulgaris]
Length=505

 Score = 75.1 bits (183),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR RK    + E EP ++
Sbjct  430  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPY-REDRRNRKSGTVSMEIEPVKD  487


 Score = 68.9 bits (167),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR+EEVVD N+  +P  R  
Sbjct  385  TGRDPVDYARPANEVNLVEWLKMMVGTRRAEEVVDSNLQVKPPLRAL  431



>ref|XP_004516932.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Cicer arietinum]
Length=506

 Score = 74.3 bits (181),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESE  413
            A KRALL A RCVDPD  KRPKMSQ+V MLE++EYP  REDRR RK +  + E E
Sbjct  426  ALKRALLVAFRCVDPDAEKRPKMSQIVRMLEADEYPF-REDRRNRKSRTASMEIE  479


 Score = 69.3 bits (168),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR EEVVD ++  +PSTR  
Sbjct  381  TGRDPVDYTRPANEVNLVEWLKMMVGTRRVEEVVDSSLEVKPSTRAL  427



>ref|XP_006400399.1| hypothetical protein EUTSA_v10013401mg [Eutrema salsugineum]
 ref|XP_006400400.1| hypothetical protein EUTSA_v10013401mg [Eutrema salsugineum]
 gb|ESQ41852.1| hypothetical protein EUTSA_v10013401mg [Eutrema salsugineum]
 gb|ESQ41853.1| hypothetical protein EUTSA_v10013401mg [Eutrema salsugineum]
Length=484

 Score = 80.1 bits (196),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ Q G   +S+P R 
Sbjct  408  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIPREDRRRRRSQNGTTRDSDPPRN  467

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  468  STDTDKSECHD  478


 Score = 63.5 bits (153),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEV+DPN+ ++PST   
Sbjct  363  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVIDPNLDTKPSTSAL  409



>ref|XP_004491330.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491331.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Cicer arietinum]
Length=497

 Score = 74.3 bits (181),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR+LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR RK  A + E E   +
Sbjct  417  ALKRSLLVALRCIDPDAEKRPKMSQVVRMLEADEYPF-REDRRNRKSVATSMEIETVND  474


 Score = 68.9 bits (167),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R + EVNLV+WLKMMVG+RR+E+VVD NI  +PS R  
Sbjct  372  TGRDPVDYARPSNEVNLVEWLKMMVGARRAEDVVDLNIEVKPSARAL  418



>ref|XP_009396002.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Musa 
acuminata subsp. malaccensis]
Length=511

 Score = 74.3 bits (181),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLKMM+GSRR+EEV+DPN+  +P+TR  
Sbjct  385  TGRDPVDYGRPENEVNLVEWLKMMIGSRRAEEVLDPNLEVKPATRAL  431


 Score = 68.6 bits (166),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KR LL ALRCVDPD  +RPKM QVV MLE++E    REDRR R+ Q G+ E E  +E+
Sbjct  430  ALKRTLLVALRCVDPDSGRRPKMGQVVRMLEADEASY-REDRRNRRSQPGSTEIEALQES  488

Query  397  YETDKXDN  374
                  +N
Sbjct  489  NSVSDLEN  496



>ref|XP_010102143.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB92393.1| putative receptor-like protein kinase [Morus notabilis]
Length=510

 Score = 73.6 bits (179),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDPV YGR A EVNL++WLKMMVG+RR EEVVDPN+  +P+ R
Sbjct  384  TGRDPVDYGRPANEVNLIEWLKMMVGTRRFEEVVDPNLEVKPAMR  428


 Score = 69.7 bits (169),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
              K ALL ALRCVDPD  KRPKMS VV MLE++EY + REDRR RK +  + E E   E
Sbjct  429  VLKHALLVALRCVDPDAEKRPKMSHVVRMLETDEY-LFREDRRNRKSRTTSMEIESMNE  486



>ref|XP_010524108.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X3 [Tarenaya hassleriana]
Length=410

 Score = 73.6 bits (179),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVN+V+WLKMMVG+RR+EEVVD +I ++P+TR  
Sbjct  285  TGRDPVDYGRPANEVNMVEWLKMMVGTRRAEEVVDQSIEAKPTTRAL  331


 Score = 69.3 bits (168),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDP+  KRPKMSQVV MLE++E+P   EDRR+R   A     E + E+
Sbjct  330  ALKRALLVALRCVDPEAEKRPKMSQVVRMLETDEHPF-HEDRRRRSRTASMEIVETEEES  388

Query  397  YETDKX-DNPDSTSDN  353
              T +   + DS + N
Sbjct  389  TGTSRRPAHSDSHTSN  404



>ref|XP_010555340.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010555408.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010555464.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Tarenaya hassleriana]
Length=514

 Score = 78.6 bits (192),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP+I ++PSTR  
Sbjct  388  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPSIETKPSTRAL  434


 Score = 64.3 bits (155),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQR  443
            A KRALL ALRCVDP+  KRPKMSQVV MLE++E+P  ++ R +R
Sbjct  433  ALKRALLVALRCVDPEAEKRPKMSQVVRMLETDEHPFLQDQRSRR  477



>ref|XP_010524107.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Tarenaya hassleriana]
Length=478

 Score = 73.6 bits (179),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVN+V+WLKMMVG+RR+EEVVD +I ++P+TR  
Sbjct  353  TGRDPVDYGRPANEVNMVEWLKMMVGTRRAEEVVDQSIEAKPTTRAL  399


 Score = 68.9 bits (167),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDP+  KRPKMSQVV MLE++E+P   EDRR+R   A     E + E+
Sbjct  398  ALKRALLVALRCVDPEAEKRPKMSQVVRMLETDEHPF-HEDRRRRSRTASMEIVETEEES  456

Query  397  YETDKX-DNPDSTSDN  353
              T +   + DS + N
Sbjct  457  TGTSRRPAHSDSHTSN  472



>ref|XP_010524101.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524102.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524103.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524104.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524105.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010524106.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
Length=515

 Score = 73.6 bits (179),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVN+V+WLKMMVG+RR+EEVVD +I ++P+TR  
Sbjct  390  TGRDPVDYGRPANEVNMVEWLKMMVGTRRAEEVVDQSIEAKPTTRAL  436


 Score = 68.9 bits (167),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDP+  KRPKMSQVV MLE++E+P   EDRR+R   A     E + E+
Sbjct  435  ALKRALLVALRCVDPEAEKRPKMSQVVRMLETDEHPF-HEDRRRRSRTASMEIVETEEES  493

Query  397  YETDKX-DNPDSTSDN  353
              T +   + DS + N
Sbjct  494  TGTSRRPAHSDSHTSN  509



>ref|XP_009126257.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
 ref|XP_009126258.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Brassica 
rapa]
Length=477

 Score = 79.0 bits (193),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ + G A +S+P R 
Sbjct  409  ALKRTLLTALRCVDPLYEKRPRMSQVARMLESEEYPIPREDRRRRRSENGTARDSDPPRN  468

Query  400  NYETDK  383
            + +TD+
Sbjct  469  STDTDR  474


 Score = 63.5 bits (153),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+W+KMMV  RRSEEV+DPN+ ++PST   
Sbjct  364  TGRYPVDYARPPPEVHLVEWMKMMVQQRRSEEVIDPNLNTKPSTSAL  410



>emb|CDY58111.1| BnaA02g35130D [Brassica napus]
Length=477

 Score = 79.0 bits (193),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
              KR LLTALRCVDP   KRP+MSQV  MLESEEYPIPREDRR+R+ + G A +S+P R 
Sbjct  409  VLKRTLLTALRCVDPLYEKRPRMSQVARMLESEEYPIPREDRRRRRSENGTARDSDPPRN  468

Query  400  NYETDK  383
            + +TDK
Sbjct  469  STDTDK  474


 Score = 63.5 bits (153),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPST  582
            TGR PV Y R   EV+LV+W+KMMV  RRSEEVVDPN+ ++PST
Sbjct  364  TGRYPVDYARPPPEVHLVEWMKMMVQQRRSEEVVDPNLNTKPST  407



>ref|XP_010555265.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X1 [Tarenaya hassleriana]
Length=679

 Score = 78.6 bits (192),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP+I ++PSTR  
Sbjct  553  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPSIETKPSTRAL  599


 Score = 63.5 bits (153),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQR  443
            A KRALL ALRCVDP+  KRPKMSQVV MLE++E+P  ++ R +R
Sbjct  598  ALKRALLVALRCVDPEAEKRPKMSQVVRMLETDEHPFLQDQRSRR  642



>gb|EEC67522.1| hypothetical protein OsI_34817 [Oryza sativa Indica Group]
 gb|EEE51503.1| hypothetical protein OsJ_32664 [Oryza sativa Japonica Group]
Length=667

 Score = 72.8 bits (177),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV  RRSEEVVDPN+  RPST+
Sbjct  537  TGRDPIDYDRPTDEVNLVDWLKMMVAHRRSEEVVDPNLERRPSTK  581


 Score = 68.9 bits (167),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQ-AGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+   +  +E+EP R  
Sbjct  583  LKRALLTALRCIDLNAEKRPRMDQVVRMLDSNE-PIPQEERRQRQNHISNNSETEPLRGK  641

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  642  SSSGKSDAPEN  652



>ref|NP_197351.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 ref|NP_001031898.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q8LEB6.1|Y5185_ARATH RecName: Full=Probable receptor-like protein kinase At5g18500 
[Arabidopsis thaliana]
 gb|AAM62741.1| Ser Thr specific protein kinase-like protein [Arabidopsis thaliana]
 gb|ABJ17100.1| At5g18500 [Arabidopsis thaliana]
 gb|AED92571.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 gb|AED92572.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=484

 Score = 77.8 bits (190),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAA-ESEPQRE  401
            A KR LLTALRCVDP   KRP+MSQV  MLESEEYPI REDRR+R+ Q G   +S+P R 
Sbjct  408  ALKRTLLTALRCVDPMSEKRPRMSQVARMLESEEYPIAREDRRRRRSQNGTTRDSDPPRN  467

Query  400  NYETDKXDNPD  368
            + +TDK +  D
Sbjct  468  STDTDKSEYHD  478


 Score = 63.9 bits (154),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR PV Y R   EV+LV+WLKMMV  RRSEEVVDPN+ ++PST   
Sbjct  363  TGRYPVDYARPPPEVHLVEWLKMMVQQRRSEEVVDPNLETKPSTSAL  409



>ref|XP_003599843.1| hypothetical protein MTR_3g047890 [Medicago truncatula]
 gb|AES70094.1| receptor-like kinase plant [Medicago truncatula]
Length=505

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRK  440
            A KRALL A RCVDPD  KRPKMSQVV MLE++EYP  REDRR RK
Sbjct  423  ALKRALLVAFRCVDPDSEKRPKMSQVVRMLEADEYPF-REDRRYRK  467


 Score = 68.9 bits (167),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGSRR+EEVVD ++  +P TR  
Sbjct  378  TGRDPVDYTRPANEVNLVEWLKMMVGSRRTEEVVDSSLEVKPPTRAL  424



>gb|EEC68703.1| hypothetical protein OsI_37182 [Oryza sativa Indica Group]
Length=845

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  715  TGRDPIDYDRPPDEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  759


 Score = 68.9 bits (167),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQ-AGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+   +  +E+EP R  
Sbjct  761  LKRALLTALRCIDLNSEKRPRMDQVVRMLDSNE-PIPQEERRQRQNHISNNSETEPLRGK  819

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  820  SSSGKSDAPEN  830



>ref|XP_002440368.1| hypothetical protein SORBIDRAFT_09g030440 [Sorghum bicolor]
 gb|EES18798.1| hypothetical protein SORBIDRAFT_09g030440 [Sorghum bicolor]
Length=519

 Score = 71.2 bits (173),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  396  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPAIRAL  442


 Score = 70.1 bits (170),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A+SE +  +
Sbjct  441  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSNNADSESKASS  499

Query  397  YE  392
             E
Sbjct  500  SE  501



>gb|EEE52619.1| hypothetical protein OsJ_34956 [Oryza sativa Japonica Group]
Length=845

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  715  TGRDPIDYDRPPDEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  759


 Score = 68.9 bits (167),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQ-AGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+   +  +E+EP R  
Sbjct  761  LKRALLTALRCIDLNSEKRPRMDQVVRMLDSNE-PIPQEERRQRQNHISNNSETEPLRGK  819

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  820  SSSGKSDAPEN  830



>gb|ABA91125.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=512

 Score = 72.4 bits (176),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV  RRSEEVVDPN+  RPST+
Sbjct  382  TGRDPIDYDRPTDEVNLVDWLKMMVAHRRSEEVVDPNLERRPSTK  426


 Score = 68.9 bits (167),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQ-AGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+   +  +E+EP R  
Sbjct  428  LKRALLTALRCIDLNAEKRPRMDQVVRMLDSNE-PIPQEERRQRQNHISNNSETEPLRGK  486

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  487  SSSGKSDAPEN  497



>ref|XP_003617422.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AET00381.1| receptor-like kinase plant [Medicago truncatula]
Length=507

 Score = 74.3 bits (181),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR+LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR RK    + E E  ++
Sbjct  425  ALKRSLLVALRCIDPDAEKRPKMSQVVRMLEADEYPF-REDRRNRKSSTTSLEIETVKD  482


 Score = 67.0 bits (162),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R + EVNLV+WLKMMVG+RR+EEVVD  +  +PS R  
Sbjct  380  TGRDPVDYARPSNEVNLVEWLKMMVGARRAEEVVDSRLEVKPSARAL  426



>ref|XP_003551921.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Glycine max]
 ref|XP_006602250.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Glycine max]
Length=510

 Score = 74.3 bits (181),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDP+  KRPKMSQVV MLE++EYP  REDRR RK +  + E E  ++
Sbjct  430  ALKRALLVALRCVDPEAEKRPKMSQVVRMLEADEYPF-REDRRNRKSRTASMEIESLKD  487


 Score = 67.0 bits (162),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TG+DPV Y R A EVNLV+WLKMMVG+RR+EEVVD  +  +PS R  
Sbjct  385  TGKDPVDYSRPANEVNLVEWLKMMVGTRRAEEVVDSRLEVKPSIRAL  431



>gb|KHN18088.1| Putative receptor-like protein kinase [Glycine soja]
Length=511

 Score = 74.3 bits (181),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDP+  KRPKMSQVV MLE++EYP  REDRR RK +  + E E  ++
Sbjct  430  ALKRALLVALRCVDPEAEKRPKMSQVVRMLEADEYPF-REDRRNRKSRTASMEIESLKD  487


 Score = 67.0 bits (162),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TG+DPV Y R A EVNLV+WLKMMVG+RR+EEVVD  +  +PS R  
Sbjct  385  TGKDPVDYSRPANEVNLVEWLKMMVGTRRAEEVVDSRLEVKPSIRAL  431



>ref|NP_001065949.1| Os12g0108100 [Oryza sativa Japonica Group]
 gb|ABA96186.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28968.1| Os12g0108100 [Oryza sativa Japonica Group]
Length=513

 Score = 72.0 bits (175),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  383  TGRDPIDYDRPPDEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  427


 Score = 69.3 bits (168),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQ-AGAAESEPQREN  398
             KRALLTALRC+D +  KRP+M QVV ML+S E PIP+E+RRQR+   +  +E+EP R  
Sbjct  429  LKRALLTALRCIDLNSEKRPRMDQVVRMLDSNE-PIPQEERRQRQNHISNNSETEPLRGK  487

Query  397  YETDKXDNPDS  365
              + K D P++
Sbjct  488  SSSGKSDAPEN  498



>ref|XP_010035923.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Eucalyptus 
grandis]
 ref|XP_010035924.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Eucalyptus 
grandis]
 gb|KCW47425.1| hypothetical protein EUGRSUZ_K01221 [Eucalyptus grandis]
 gb|KCW47426.1| hypothetical protein EUGRSUZ_K01221 [Eucalyptus grandis]
Length=505

 Score = 72.4 bits (176),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLK+MVG+RR+EEVV+PN+  +P+TR  
Sbjct  385  TGRDPVDYGRPTNEVNLVEWLKLMVGTRRAEEVVEPNLNIKPTTRAL  431


 Score = 68.6 bits (166),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDP+  KRPKM+QVV MLE++EY   RE RR ++    + E EP +E
Sbjct  430  ALKRALLVALRCVDPESNKRPKMTQVVRMLEADEYS-SREGRRNQRSHTTSKEIEPAKE  487



>ref|XP_006661911.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Oryza brachyantha]
Length=508

 Score = 70.9 bits (172),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  385  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMEVKPTIRAL  431


 Score = 70.1 bits (170),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M  VV MLE+E+ P  REDRR R+   G A++E +  +
Sbjct  430  ALKRALLVALRCVDPDSEKRPTMGHVVRMLEAEDVP-SREDRRSRRGHTGNADTESKTSS  488

Query  397  YE  392
             E
Sbjct  489  SE  490



>ref|NP_172415.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE28443.1| protein kinase family protein [Arabidopsis thaliana]
Length=466

 Score = 75.9 bits (185),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVGS+R EEV+DPNI  RP+TR  
Sbjct  354  TGRDPVDYARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRAL  400


 Score = 65.1 bits (157),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEY  473
            A KR LLTALRC+DPD  KRPKMSQVV MLESEEY
Sbjct  399  ALKRVLLTALRCIDPDSEKRPKMSQVVRMLESEEY  433



>ref|XP_009411599.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009411600.1| PREDICTED: probable receptor-like protein kinase At5g18500 [Musa 
acuminata subsp. malaccensis]
Length=505

 Score = 70.5 bits (171),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R   EVNLVDWLK M+G+RRSEEVVDP I +RPST+  
Sbjct  382  TGRDPVDYRRPPDEVNLVDWLKWMIGNRRSEEVVDPGIVTRPSTKAL  428


 Score = 70.1 bits (170),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A K+ALLTALRCVDPD  KRP M +VV MLE +  P P +D++ R  +AG  E E QR+N
Sbjct  427  ALKKALLTALRCVDPDSEKRPTMGRVVQMLEPDN-PRPHQDQKHRHERAGEIEVELQRKN  485

Query  397  YETDKXDNPDSTSD-NKGN  344
              +D    PD  S+  KGN
Sbjct  486  --SDTKTKPDFKSNRKKGN  502



>gb|KJB28778.1| hypothetical protein B456_005G071600 [Gossypium raimondii]
Length=455

 Score = 72.4 bits (176),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPRE  458
            A KRALLTALRCVDPD  KRPKMSQV  MLE+EEYP+PRE
Sbjct  415  ALKRALLTALRCVDPDADKRPKMSQVARMLEAEEYPLPRE  454


 Score = 68.2 bits (165),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGR P+ YGR   EVN+V+WLKMMV  RRSEEVVDPNI +RPST   
Sbjct  370  TGRYPIDYGRPQPEVNMVEWLKMMVQLRRSEEVVDPNIETRPSTSAL  416



>gb|AFW79385.1| putative protein kinase superfamily protein [Zea mays]
Length=294

 Score = 71.2 bits (173),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  171  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPAIRAL  217


 Score = 68.9 bits (167),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A++E +  +
Sbjct  216  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSHADNESKASS  274

Query  397  YE  392
             E
Sbjct  275  SE  276



>gb|ACR36632.1| unknown [Zea mays]
 gb|ACR37594.1| unknown [Zea mays]
Length=513

 Score = 71.2 bits (173),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  390  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPAIRAL  436


 Score = 68.9 bits (167),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A++E +  +
Sbjct  435  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSHADNESKASS  493

Query  397  YE  392
             E
Sbjct  494  SE  495



>emb|CAH39851.1| putative protein kinase [Zea mays]
Length=513

 Score = 71.2 bits (173),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  390  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPAIRAL  436


 Score = 68.9 bits (167),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A++E +  +
Sbjct  435  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSNADNESKASS  493

Query  397  YE  392
             E
Sbjct  494  SE  495



>ref|XP_004955836.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Setaria italica]
 ref|XP_004955837.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Setaria italica]
Length=511

 Score = 70.1 bits (170),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A+SE +  +
Sbjct  433  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSNADSESKASS  491

Query  397  YE  392
             E
Sbjct  492  SE  493


 Score = 69.7 bits (169),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EV+LV+WLKMMVG+RR+EE VDP++  +P+TR  
Sbjct  388  TGRDPVDYARPANEVHLVEWLKMMVGTRRAEEAVDPDMELKPATRAL  434



>ref|NP_001105820.1| putative protein kinase [Zea mays]
 emb|CAH39850.1| putative protein kinase [Zea mays]
Length=513

 Score = 70.9 bits (172),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RR+EEVVDP++  +P+ R  
Sbjct  390  TGRDPVDYGRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPAIRAL  436


 Score = 68.9 bits (167),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A++E +  +
Sbjct  435  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSNADNESKASS  493

Query  397  YE  392
             E
Sbjct  494  SE  495



>ref|XP_011026247.1| PREDICTED: probable receptor-like protein kinase At2g42960 isoform 
X2 [Populus euphratica]
Length=470

 Score = 76.6 bits (187),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EVNL++WLKMMVG+RR+EEVVDPN+  +P+TR  
Sbjct  384  TGRDPVDYGRPANEVNLLEWLKMMVGTRRAEEVVDPNLEVKPTTRAL  430


 Score = 63.2 bits (152),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPI  467
            A KRALL ALRCVDPD  +RPKM+QVV MLE++EYP+
Sbjct  429  ALKRALLVALRCVDPDAERRPKMTQVVRMLEADEYPL  465



>ref|XP_004961033.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Setaria italica]
Length=509

 Score = 70.5 bits (171),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EV+LV+WLKMMVG+RR+EEVVDP++  +P+TR  
Sbjct  386  TGRDPVDYSRPANEVHLVEWLKMMVGTRRAEEVVDPDMELKPATRAL  432


 Score = 68.9 bits (167),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M QVV MLE+E+ P  REDRR R+  +  A++E +  +
Sbjct  431  ALKRALLVALRCVDPDAEKRPTMGQVVRMLEAEDVP-SREDRRSRRGHSSNADNESKASS  489

Query  397  YE  392
             E
Sbjct  490  SE  491



>ref|XP_007146341.1| hypothetical protein PHAVU_006G032300g [Phaseolus vulgaris]
 gb|ESW18335.1| hypothetical protein PHAVU_006G032300g [Phaseolus vulgaris]
Length=510

 Score = 70.1 bits (170),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR+LL ALRCVDP+  KRPKMSQVV MLE++EY   REDRR RK +  + E E  ++
Sbjct  430  ALKRSLLVALRCVDPEAEKRPKMSQVVRMLEADEYSF-REDRRNRKSRTASMEIESLKD  487


 Score = 68.9 bits (167),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR++EVVD  +  +PSTR  
Sbjct  385  TGRDPVDYSRPANEVNLVEWLKMMVGTRRADEVVDSRLEVKPSTRAL  431



>ref|XP_006595756.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Glycine max]
 ref|XP_003545199.2| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Glycine max]
 ref|XP_006595757.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X3 [Glycine max]
 ref|XP_006595758.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X4 [Glycine max]
Length=516

 Score = 74.7 bits (182),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP+ REDRR+RK    + E E  ++
Sbjct  440  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPL-REDRRKRKSGTASMEIETVKD  497


 Score = 64.3 bits (155),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK MVG+RR+EEVVD ++  +P  R  
Sbjct  395  TGRDPVDYARPANEVNLVEWLKTMVGTRRAEEVVDSSLQVKPPLRAL  441



>ref|NP_001064960.1| Os10g0497600 [Oryza sativa Japonica Group]
 gb|ABB47827.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26874.1| Os10g0497600 [Oryza sativa Japonica Group]
 dbj|BAG95829.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score = 72.0 bits (175),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR A EV+LV+WLKMMVG+RRSEEVVDP++  +P+ R  
Sbjct  386  TGRDPVDYGRPANEVHLVEWLKMMVGTRRSEEVVDPDMEVKPTIRAL  432


 Score = 67.0 bits (162),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL ALRCVDPD  KRP M  VV MLE+E+ P  REDRR R+     A++E +  +
Sbjct  431  ALKRALLVALRCVDPDSEKRPTMGHVVRMLEAEDVP-SREDRRSRRGNTANADTESKTSS  489

Query  397  YE  392
             E
Sbjct  490  SE  491



>gb|KHN11969.1| Putative receptor-like protein kinase [Glycine soja]
Length=506

 Score = 74.7 bits (182),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP+ REDRR+RK    + E E  ++
Sbjct  430  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPL-REDRRKRKSGTASMEIETVKD  487


 Score = 64.3 bits (155),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK MVG+RR+EEVVD ++  +P  R  
Sbjct  385  TGRDPVDYARPANEVNLVEWLKTMVGTRRAEEVVDSSLQVKPPLRAL  431



>gb|EPS72812.1| hypothetical protein M569_01940 [Genlisea aurea]
Length=500

 Score = 75.9 bits (185),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLKMMVG+RR+EEVVDPN+  +PSTR  
Sbjct  379  TGRDPVDYGRPTNEVNLVEWLKMMVGNRRAEEVVDPNLGVKPSTRAL  425


 Score = 62.8 bits (151),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KRALL ALRCVDPD  KRP+MSQVV M+E++E+P  REDRR R+ +  + +++  +E
Sbjct  424  ALKRALLVALRCVDPDSEKRPRMSQVVRMMETDEFPY-REDRRSRRSRPASLDTDSMKE  481



>ref|NP_191470.1| protein kinase family protein [Arabidopsis thaliana]
 emb|CAB86939.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE79879.1| protein kinase family protein [Arabidopsis thaliana]
Length=512

 Score = 71.2 bits (173),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE-SEPQRE  401
            A KRALL ALRCVDP+  KRPKMSQVV MLES+E+P  RE+RR RK +  + E  E   E
Sbjct  432  ALKRALLVALRCVDPEAQKRPKMSQVVRMLESDEHPF-REERRNRKSRTASMEIVETTEE  490

Query  400  NYETDK  383
            + +T K
Sbjct  491  SADTSK  496


 Score = 67.0 bits (162),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLKMMVG+RR+EEVVD  I   P+TR  
Sbjct  387  TGRDPVDYERPANEVNLVEWLKMMVGTRRAEEVVDSRIEPPPATRAL  433



>ref|XP_009142894.1| PREDICTED: probable receptor-like protein kinase At2g42960 [Brassica 
rapa]
Length=496

 Score = 72.4 bits (176),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP +  RPS
Sbjct  379  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPRPS  421


 Score = 65.9 bits (159),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  586  QQGAFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
             + A KRALL +LRCVDP+  KRP+MSQVV MLESEE+P  +E RR RK +  + E
Sbjct  421  SKSALKRALLVSLRCVDPEAEKRPRMSQVVRMLESEEHPFGQE-RRNRKSRTASIE  475



>emb|CDY53651.1| BnaC04g52850D [Brassica napus]
Length=496

 Score = 72.4 bits (176),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP +  RPS
Sbjct  379  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPRPS  421


 Score = 65.9 bits (159),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
            A KRALL +LRCVDP+  KRP+MSQVV MLESEE+P  +E RR RK +  + E
Sbjct  424  ALKRALLVSLRCVDPEAEKRPRMSQVVRMLESEEHPFGQE-RRNRKSRTASIE  475



>gb|KHN38324.1| Putative receptor-like protein kinase [Glycine soja]
Length=507

 Score = 73.9 bits (180),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR+RK    + E E  ++
Sbjct  430  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPF-REDRRKRKSGTASMEIETVKD  487


 Score = 64.3 bits (155),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK MVG+RR+EEVVD ++  +P  R  
Sbjct  385  TGRDPVDYARPANEVNLVEWLKTMVGTRRAEEVVDSSLEVKPPLRAL  431



>ref|XP_006575654.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X2 [Glycine max]
 ref|XP_006575655.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X3 [Glycine max]
 ref|XP_006575656.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X4 [Glycine max]
 ref|XP_006575657.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X5 [Glycine max]
 ref|XP_006575658.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X6 [Glycine max]
 ref|XP_003519546.2| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X1 [Glycine max]
Length=517

 Score = 73.9 bits (180),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR+RK    + E E  ++
Sbjct  440  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPF-REDRRKRKSGTASMEIETVKD  497


 Score = 64.3 bits (155),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK MVG+RR+EEVVD ++  +P  R  
Sbjct  395  TGRDPVDYARPANEVNLVEWLKTMVGTRRAEEVVDSSLEVKPPLRAL  441



>emb|CDX79837.1| BnaA05g03190D [Brassica napus]
Length=495

 Score = 72.4 bits (176),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP +  RPS
Sbjct  378  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPRPS  420


 Score = 65.5 bits (158),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  586  QQGAFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAE  419
             + A KRALL +LRCVDP+  KRP+MSQVV MLESEE+P  +E RR RK +  + E
Sbjct  420  SKSALKRALLVSLRCVDPEAEKRPRMSQVVRMLESEEHPFGQE-RRNRKSRTASIE  474



>ref|XP_006575659.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
isoform X7 [Glycine max]
Length=409

 Score = 73.9 bits (180),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A KR LL ALRC+DPD  KRPKMSQVV MLE++EYP  REDRR+RK    + E E  ++
Sbjct  332  ALKRTLLVALRCIDPDADKRPKMSQVVRMLEADEYPF-REDRRKRKSGTASMEIETVKD  389


 Score = 63.9 bits (154),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R A EVNLV+WLK MVG+RR+EEVVD ++  +P  R  
Sbjct  287  TGRDPVDYARPANEVNLVEWLKTMVGTRRAEEVVDSSLEVKPPLRAL  333



>gb|EPS65102.1| hypothetical protein M569_09677, partial [Genlisea aurea]
Length=482

 Score = 73.9 bits (180),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV YGR   EVNLV+WLK MVG+RR+EEVVDPN+  +PSTR  
Sbjct  381  TGRDPVDYGRPTNEVNLVEWLKAMVGNRRAEEVVDPNLEIKPSTRAL  427


 Score = 63.9 bits (154),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQR  404
            A KRALL ALRCVDPD  KRPKMSQVV M+E++++P  REDRR R+ ++ + ++E  +
Sbjct  426  ALKRALLVALRCVDPDSEKRPKMSQVVRMMETDDFPY-REDRRSRRSRSASMDTESMK  482



>ref|XP_002440788.1| hypothetical protein SORBIDRAFT_09g006610 [Sorghum bicolor]
 gb|EES19218.1| hypothetical protein SORBIDRAFT_09g006610 [Sorghum bicolor]
Length=515

 Score = 72.8 bits (177),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTR  579
            TGRDP+ Y R   EVNLVDWLKMMV +RRSEEVVDPN+  RPST+
Sbjct  385  TGRDPIDYDRPTNEVNLVDWLKMMVANRRSEEVVDPNLERRPSTK  429


 Score = 64.3 bits (155),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -2

Query  574  FKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQA-GAAESEPQREN  398
             KRALLTALRC+D +  KRP M QVV ML+S E PIP+E+RR R+ +   ++E+EP R  
Sbjct  431  LKRALLTALRCIDLNAEKRPSMDQVVRMLDSNE-PIPQEERRHRQNRIPESSETEPLRGK  489

Query  397  YETDKXDNPD  368
              + + D P+
Sbjct  490  NNSGRSDAPE  499



>ref|NP_181825.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9SJG2.1|Y2296_ARATH RecName: Full=Probable receptor-like protein kinase At2g42960 
[Arabidopsis thaliana]
 gb|AAD21713.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15294.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC10192.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=494

 Score = 72.4 bits (176),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPS  585
            TGRDPV YGR A EVNLV+WLKMMVG+RR+EEVVDP +  RPS
Sbjct  380  TGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPRPS  422


 Score = 65.1 bits (157),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQREN  398
            A KRALL +LRCVDP+  KRP+MSQV  MLES+E+P  +E R +R   AG    E + E+
Sbjct  425  ALKRALLVSLRCVDPEAEKRPRMSQVARMLESDEHPFHKERRNKRSKTAGMEIVETKDES  484



>ref|XP_006586072.1| PREDICTED: probable receptor-like protein kinase At2g42960-like 
[Glycine max]
Length=508

 Score = 70.5 bits (171),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  577  AFKRALLTALRCVDPDXXKRPKMSQVVXMLESEEYPIPREDRRQRKIQAGAAESEPQRE  401
            A K ALL ALRCVDP+  KRPKMSQVV MLE++EYP  REDRR RK +  + E E  ++
Sbjct  430  ALKCALLVALRCVDPEAEKRPKMSQVVRMLEADEYPF-REDRRNRKSRTASMEIESLKD  487


 Score = 66.6 bits (161),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  713  TGRDPVXYGRXAQEVNLVDWLKMMVGSRRSEEVVDPNIXSRPSTRGF  573
            TGRDPV Y R + EVNLV+WLKMMVG+RR+EEVVD  +  +PS R  
Sbjct  385  TGRDPVDYSRPSNEVNLVEWLKMMVGTRRTEEVVDSRLEVKPSIRAL  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380