BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032M13

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792571.1|  PREDICTED: serine/arginine-rich splicing fac...  86.7    3e-17   Nicotiana sylvestris
ref|XP_006601788.1|  PREDICTED: uncharacterized protein LOC100776...  84.3    1e-16   Glycine max [soybeans]
ref|XP_006601786.1|  PREDICTED: uncharacterized protein LOC100776...  84.3    2e-16   Glycine max [soybeans]
ref|NP_001242436.1|  uncharacterized protein LOC100776329             84.3    2e-16   Glycine max [soybeans]
ref|XP_006601785.1|  PREDICTED: uncharacterized protein LOC100776...  84.3    2e-16   Glycine max [soybeans]
gb|KHN10603.1|  Serine/arginine-rich splicing factor 7                84.3    2e-16   Glycine soja [wild soybean]
ref|XP_003532014.1|  PREDICTED: serine/arginine-rich splicing fac...  84.0    2e-16   Glycine max [soybeans]
ref|XP_009606700.1|  PREDICTED: serine/arginine-rich splicing fac...  83.2    4e-16   Nicotiana tomentosiformis
ref|XP_009606695.1|  PREDICTED: serine/arginine-rich splicing fac...  83.6    4e-16   Nicotiana tomentosiformis
ref|XP_009606697.1|  PREDICTED: serine/arginine-rich splicing fac...  83.6    4e-16   Nicotiana tomentosiformis
ref|XP_009606699.1|  PREDICTED: serine/arginine-rich splicing fac...  83.2    4e-16   Nicotiana tomentosiformis
ref|XP_008793862.1|  PREDICTED: serine/arginine-rich splicing fac...  82.8    6e-16   Phoenix dactylifera
ref|XP_008793863.1|  PREDICTED: serine/arginine-rich splicing fac...  82.8    6e-16   Phoenix dactylifera
ref|XP_008793864.1|  PREDICTED: serine/arginine-rich splicing fac...  82.8    7e-16   Phoenix dactylifera
ref|XP_008793865.1|  PREDICTED: serine/arginine-rich splicing fac...  82.4    7e-16   Phoenix dactylifera
ref|XP_010928600.1|  PREDICTED: serine/arginine-rich splicing fac...  82.0    1e-15   Elaeis guineensis
ref|XP_010271961.1|  PREDICTED: serine/arginine-rich splicing fac...  81.3    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006371254.1|  hypothetical protein POPTR_0019s07730g           81.3    3e-15   
ref|XP_010914080.1|  PREDICTED: serine/arginine-rich splicing fac...  80.9    3e-15   Elaeis guineensis
ref|XP_010914079.1|  PREDICTED: serine/arginine-rich splicing fac...  80.9    4e-15   
ref|XP_006371251.1|  hypothetical protein POPTR_0019s07730g           79.0    4e-15   
ref|XP_008779620.1|  PREDICTED: serine/arginine-rich splicing fac...  80.5    4e-15   
ref|XP_010929222.1|  PREDICTED: serine/arginine-rich splicing fac...  80.5    4e-15   Elaeis guineensis
ref|XP_006371252.1|  hypothetical protein POPTR_0019s07730g           79.7    5e-15   
ref|XP_011013272.1|  PREDICTED: serine/arginine-rich splicing fac...  79.7    5e-15   Populus euphratica
ref|XP_006371253.1|  hypothetical protein POPTR_0019s07730g           79.7    6e-15   
ref|XP_011013271.1|  PREDICTED: serine/arginine-rich splicing fac...  79.7    6e-15   Populus euphratica
gb|KJB31255.1|  hypothetical protein B456_005G183600                  80.5    6e-15   Gossypium raimondii
ref|XP_011013270.1|  PREDICTED: serine/arginine-rich splicing fac...  79.7    7e-15   Populus euphratica
ref|XP_008794412.1|  PREDICTED: serine/arginine-rich splicing fac...  79.7    7e-15   Phoenix dactylifera
ref|XP_006438430.1|  hypothetical protein CICLE_v10032693mg           80.5    7e-15   
ref|XP_010023818.1|  PREDICTED: serine/arginine-rich splicing fac...  79.7    8e-15   
ref|XP_010929220.1|  PREDICTED: serine/arginine-rich splicing fac...  80.1    9e-15   Elaeis guineensis
ref|XP_008340015.1|  PREDICTED: serine/arginine-rich splicing fac...  79.3    1e-14   Malus domestica [apple tree]
ref|XP_008340014.1|  PREDICTED: serine/arginine-rich splicing fac...  79.0    1e-14   Malus domestica [apple tree]
ref|XP_010551557.1|  PREDICTED: serine/arginine-rich splicing fac...  79.0    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010251307.1|  PREDICTED: serine/arginine-rich splicing fac...  79.0    1e-14   
ref|XP_010100489.1|  Serine/arginine-rich splicing factor 7           79.7    1e-14   
ref|XP_010551560.1|  PREDICTED: serine/arginine-rich splicing fac...  79.0    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_006836638.1|  hypothetical protein AMTR_s00088p00022360        77.4    2e-14   
gb|KHG11979.1|  Serine/arginine-rich splicing factor 7                78.2    2e-14   Gossypium arboreum [tree cotton]
gb|KJB31251.1|  hypothetical protein B456_005G183600                  78.2    3e-14   Gossypium raimondii
emb|CDY59084.1|  BnaA09g54590D                                        77.0    3e-14   Brassica napus [oilseed rape]
gb|KJB31256.1|  hypothetical protein B456_005G183600                  77.8    3e-14   Gossypium raimondii
ref|XP_006438427.1|  hypothetical protein CICLE_v10032693mg           77.8    3e-14   
gb|KJB31257.1|  hypothetical protein B456_005G183600                  77.0    3e-14   Gossypium raimondii
ref|XP_006438428.1|  hypothetical protein CICLE_v10032693mg           77.8    3e-14   Citrus clementina [clementine]
ref|XP_006416049.1|  hypothetical protein EUTSA_v10008869mg           77.8    3e-14   Eutrema salsugineum [saltwater cress]
emb|CDY47646.1|  BnaC05g19020D                                        77.8    4e-14   Brassica napus [oilseed rape]
ref|XP_009115492.1|  PREDICTED: serine/arginine-rich splicing fac...  77.8    4e-14   Brassica rapa
ref|XP_009115493.1|  PREDICTED: serine/arginine-rich splicing fac...  77.4    5e-14   Brassica rapa
emb|CDP00182.1|  unnamed protein product                              77.4    6e-14   Coffea canephora [robusta coffee]
ref|XP_008446226.1|  PREDICTED: serine/arginine-rich splicing fac...  77.0    7e-14   Cucumis melo [Oriental melon]
ref|XP_004509838.1|  PREDICTED: serine/arginine-rich splicing fac...  77.0    7e-14   Cicer arietinum [garbanzo]
ref|XP_004155352.1|  PREDICTED: serine/arginine-rich splicing fac...  76.6    9e-14   
ref|XP_002534324.1|  arginine/serine-rich splicing factor, putative   76.6    1e-13   Ricinus communis
gb|KDP26562.1|  hypothetical protein JCGZ_17720                       76.3    1e-13   Jatropha curcas
ref|XP_010682582.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008389624.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    1e-13   Malus domestica [apple tree]
ref|XP_009363527.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_008389623.1|  PREDICTED: serine/arginine-rich splicing fac...  75.9    1e-13   Malus domestica [apple tree]
ref|XP_009363525.1|  PREDICTED: serine/arginine-rich splicing fac...  75.9    1e-13   Pyrus x bretschneideri [bai li]
gb|KJB15225.1|  hypothetical protein B456_002G165700                  76.3    2e-13   Gossypium raimondii
ref|XP_007044557.1|  RS-containing zinc finger protein 21 isoform 1   75.9    2e-13   
ref|XP_006655864.1|  PREDICTED: serine/arginine-rich splicing fac...  75.9    2e-13   
ref|XP_008221783.1|  PREDICTED: serine/arginine-rich splicing fac...  75.5    2e-13   Prunus mume [ume]
ref|XP_008221782.1|  PREDICTED: serine/arginine-rich splicing fac...  75.5    2e-13   Prunus mume [ume]
gb|AFK40774.1|  unknown                                               75.5    2e-13   Lotus japonicus
ref|NP_001057018.1|  Os06g0187900                                     75.5    2e-13   
ref|XP_006845500.1|  hypothetical protein AMTR_s00019p00154210        76.3    3e-13   
ref|XP_003544651.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    3e-13   Glycine max [soybeans]
ref|XP_006596163.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    3e-13   Glycine max [soybeans]
ref|XP_002436620.1|  hypothetical protein SORBIDRAFT_10g005960        75.1    3e-13   Sorghum bicolor [broomcorn]
ref|XP_006596162.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    3e-13   Glycine max [soybeans]
ref|NP_001241113.1|  uncharacterized protein LOC100790689             75.1    3e-13   Glycine max [soybeans]
ref|XP_006600176.1|  PREDICTED: uncharacterized protein LOC100790...  74.7    3e-13   Glycine max [soybeans]
ref|XP_007161330.1|  hypothetical protein PHAVU_001G060500g           74.7    4e-13   Phaseolus vulgaris [French bean]
ref|NP_001149338.1|  LOC100282961                                     74.7    4e-13   
ref|XP_011463379.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    4e-13   Fragaria vesca subsp. vesca
ref|XP_004964637.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    5e-13   
gb|AFW85524.1|  hypothetical protein ZEAMMB73_327204                  73.6    5e-13   
ref|XP_007161329.1|  hypothetical protein PHAVU_001G060500g           74.3    5e-13   Phaseolus vulgaris [French bean]
gb|ACG35084.1|  splicing factor, arginine/serine-rich 7               74.7    5e-13   Zea mays [maize]
ref|XP_009415507.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    5e-13   
gb|EEC80152.1|  hypothetical protein OsI_21961                        75.5    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004297645.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    5e-13   Fragaria vesca subsp. vesca
ref|XP_002264105.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    5e-13   Vitis vinifera
ref|XP_007223543.1|  hypothetical protein PRUPE_ppa012111mg           74.3    5e-13   
gb|EEE65232.1|  hypothetical protein OsJ_20394                        75.5    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395828.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010653311.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    5e-13   Vitis vinifera
ref|XP_011077513.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    6e-13   
ref|XP_011077592.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    7e-13   
ref|XP_011082043.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    7e-13   Sesamum indicum [beniseed]
ref|XP_010942196.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    7e-13   Elaeis guineensis
emb|CAN74578.1|  hypothetical protein VITISV_009111                   75.5    7e-13   Vitis vinifera
ref|XP_010942202.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    7e-13   Elaeis guineensis
ref|XP_010942200.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    7e-13   Elaeis guineensis
ref|XP_010942199.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    8e-13   Elaeis guineensis
ref|XP_004964636.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    8e-13   
ref|XP_010942194.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    8e-13   Elaeis guineensis
ref|XP_010942197.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    9e-13   Elaeis guineensis
ref|XP_010942201.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    9e-13   Elaeis guineensis
ref|XP_004964635.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    9e-13   
ref|XP_010942211.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    9e-13   Elaeis guineensis
ref|XP_010942204.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    9e-13   Elaeis guineensis
ref|XP_010942198.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    9e-13   Elaeis guineensis
ref|XP_010942207.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   Elaeis guineensis
ref|XP_010942203.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_010942208.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   Elaeis guineensis
ref|XP_010942205.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   Elaeis guineensis
ref|XP_009386654.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS45589.1|  Serine/arginine-rich splicing factor 7                73.6    1e-12   Triticum urartu
ref|XP_010942209.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    1e-12   Elaeis guineensis
ref|XP_010648839.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    1e-12   Vitis vinifera
ref|XP_002272657.2|  PREDICTED: serine/arginine-rich splicing fac...  73.2    1e-12   Vitis vinifera
ref|XP_010942206.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    1e-12   Elaeis guineensis
emb|CDP12463.1|  unnamed protein product                              73.2    1e-12   Coffea canephora [robusta coffee]
ref|XP_003603553.1|  Splicing factor arginine/serine-rich             73.2    1e-12   
ref|XP_003564174.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_009765884.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   Nicotiana sylvestris
gb|KJB53760.1|  hypothetical protein B456_009G066600                  71.6    2e-12   Gossypium raimondii
ref|XP_006647492.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    3e-12   
ref|XP_006647491.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   Oryza brachyantha
gb|AAY84872.1|  pre-mRNA processing factor                            72.0    3e-12   Triticum aestivum [Canadian hard winter wheat]
gb|EMT27182.1|  Splicing factor, arginine/serine-rich 7               72.4    3e-12   
ref|XP_006647490.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   Oryza brachyantha
ref|XP_010278048.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    3e-12   Nelumbo nucifera [Indian lotus]
gb|KJB53756.1|  hypothetical protein B456_009G066600                  72.4    3e-12   Gossypium raimondii
gb|KJB53759.1|  hypothetical protein B456_009G066600                  72.0    3e-12   Gossypium raimondii
gb|KJB53763.1|  hypothetical protein B456_009G066600                  72.0    3e-12   Gossypium raimondii
dbj|BAJ94659.1|  predicted protein                                    72.0    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO67328.1|  hypothetical protein CISIN_1g046599mg                 70.9    4e-12   Citrus sinensis [apfelsine]
ref|XP_004498562.1|  PREDICTED: serine/arginine-rich splicing fac...  71.6    5e-12   Cicer arietinum [garbanzo]
ref|XP_002454683.1|  hypothetical protein SORBIDRAFT_04g035540        71.2    6e-12   Sorghum bicolor [broomcorn]
ref|NP_001047400.1|  Os02g0610600                                     71.6    6e-12   
ref|XP_004954180.1|  PREDICTED: serine/arginine-rich splicing fac...  71.2    6e-12   Setaria italica
ref|XP_009363631.1|  PREDICTED: serine/arginine-rich splicing fac...  71.2    6e-12   Pyrus x bretschneideri [bai li]
gb|EEE57352.1|  hypothetical protein OsJ_07486                        71.6    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003588649.1|  RNA-binding protein Rsf1                         71.2    7e-12   
gb|ACX54788.2|  putative arginine/serine-rich splicing factor         71.2    7e-12   Arachis diogoi
ref|XP_006450201.1|  hypothetical protein CICLE_v10009655mg           71.2    7e-12   
ref|NP_001132794.1|  hypothetical protein                             70.9    7e-12   
gb|AGE46109.1|  arginine/serine-rich splicing factor RSZ19 transc...  70.9    8e-12   Sorghum bicolor [broomcorn]
ref|XP_006305671.1|  hypothetical protein CARUB_v10010388mg           70.9    9e-12   Capsella rubella
gb|KDP33463.1|  hypothetical protein JCGZ_07034                       70.5    1e-11   Jatropha curcas
ref|XP_010268362.1|  PREDICTED: serine/arginine-rich splicing fac...  72.0    1e-11   
ref|XP_009396254.1|  PREDICTED: serine/arginine-rich splicing fac...  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS72339.1|  hypothetical protein M569_02421                       70.5    1e-11   Genlisea aurea
ref|XP_009396262.1|  PREDICTED: serine/arginine-rich splicing fac...  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893311.1|  hypothetical protein ARALYDRAFT_472646           70.1    1e-11   
ref|XP_006357055.1|  PREDICTED: serine/arginine-rich splicing fac...  70.1    1e-11   Solanum tuberosum [potatoes]
ref|XP_011459026.1|  PREDICTED: serine/arginine-rich splicing fac...  70.1    2e-11   Fragaria vesca subsp. vesca
ref|XP_004291288.1|  PREDICTED: serine/arginine-rich splicing fac...  70.1    2e-11   Fragaria vesca subsp. vesca
ref|XP_007225929.1|  hypothetical protein PRUPE_ppa012147mg           70.1    2e-11   Prunus persica
emb|CDX72313.1|  BnaC07g43350D                                        70.1    2e-11   
ref|XP_004244489.1|  PREDICTED: serine/arginine-rich splicing fac...  69.7    2e-11   Solanum lycopersicum
ref|XP_009614738.1|  PREDICTED: serine/arginine-rich splicing fac...  69.3    3e-11   Nicotiana tomentosiformis
ref|XP_009614737.1|  PREDICTED: serine/arginine-rich splicing fac...  69.3    3e-11   Nicotiana tomentosiformis
ref|XP_009614739.1|  PREDICTED: serine/arginine-rich splicing fac...  69.3    3e-11   Nicotiana tomentosiformis
ref|XP_010692998.1|  PREDICTED: serine/arginine-rich splicing fac...  69.3    3e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|AGE46163.1|  arginine/serine-rich splicing factor RSZ23 transc...  69.3    4e-11   Physcomitrella patens
ref|XP_007011623.1|  Serine/arginine-rich 22 isoform 1                68.9    4e-11   
ref|XP_001776556.1|  predicted protein                                68.9    4e-11   
gb|AGE46162.1|  arginine/serine-rich splicing factor RSZ23 transc...  68.2    4e-11   Physcomitrella patens
gb|AGE46161.1|  arginine/serine-rich splicing factor RSZ23 transc...  69.3    4e-11   Physcomitrella patens
ref|NP_001140388.1|  uncharacterized protein LOC100272442             68.2    4e-11   
ref|XP_011031384.1|  PREDICTED: serine/arginine-rich splicing fac...  68.9    4e-11   Populus euphratica
ref|XP_006382133.1|  splicing factor RSZp22 family protein            68.9    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010325195.1|  PREDICTED: serine/arginine-rich splicing fac...  68.6    5e-11   Solanum lycopersicum
gb|AGC79943.1|  arginine/serine-rich splicing factor RSZ28VI          68.6    5e-11   Zea mays [maize]
ref|XP_004245307.1|  PREDICTED: serine/arginine-rich splicing fac...  68.6    6e-11   Solanum lycopersicum
ref|XP_001782492.1|  predicted protein                                68.9    6e-11   
ref|NP_001141411.1|  uncharacterized protein LOC100273521             68.9    6e-11   
ref|XP_010112118.1|  Serine/arginine-rich splicing factor 7           68.6    6e-11   Morus notabilis
gb|ABK24519.1|  unknown                                               68.2    6e-11   Picea sitchensis
gb|KJB68434.1|  hypothetical protein B456_010G245400                  69.3    6e-11   Gossypium raimondii
gb|KJB68433.1|  hypothetical protein B456_010G245400                  68.6    6e-11   Gossypium raimondii
ref|NP_001117342.1|  serine/arginine-rich splicing factor RSZ21       68.2    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676820.1|  PREDICTED: uncharacterized protein LOC100273...  69.7    6e-11   
ref|XP_004953059.1|  PREDICTED: serine/arginine-rich splicing fac...  68.9    7e-11   Setaria italica
ref|XP_010526263.1|  PREDICTED: serine/arginine-rich splicing fac...  68.2    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_008681365.1|  PREDICTED: uncharacterized protein LOC100272...  68.9    7e-11   Zea mays [maize]
ref|NP_001185074.1|  serine/arginine-rich splicing factor RSZ21       68.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564208.1|  serine/arginine-rich splicing factor RSZ21          68.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05351.1|  RSZp21 protein                                       68.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAF87159.1|AC002423_24  T23E23.2                                   68.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008681360.1|  PREDICTED: uncharacterized protein LOC100272...  68.9    8e-11   
gb|ACG44253.1|  splicing factor, arginine/serine-rich 7               68.9    9e-11   Zea mays [maize]
ref|XP_008681364.1|  PREDICTED: uncharacterized protein LOC100272...  68.6    9e-11   
gb|KHG09265.1|  Serine/arginine-rich splicing factor 7                67.8    9e-11   Gossypium arboreum [tree cotton]
ref|XP_009353338.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_009353337.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_006284575.1|  hypothetical protein CARUB_v10005800mg           67.8    1e-10   Capsella rubella
ref|XP_008466294.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   Cucumis melo [Oriental melon]
ref|XP_004136307.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   Cucumis sativus [cucumbers]
ref|XP_010498894.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   
ref|XP_009353309.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010498892.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   
gb|AFW64196.1|  hypothetical protein ZEAMMB73_035767                  66.6    1e-10   
ref|XP_009630986.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    1e-10   Nicotiana tomentosiformis
ref|XP_009630985.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   
ref|XP_010432845.1|  PREDICTED: serine/arginine-rich splicing fac...  67.8    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006355194.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    1e-10   Solanum tuberosum [potatoes]
ref|XP_006355197.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    1e-10   Solanum tuberosum [potatoes]
ref|XP_010447518.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001147002.1|  LOC100280612                                     67.0    1e-10   Zea mays [maize]
ref|XP_010438021.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009138024.1|  PREDICTED: serine/arginine-rich splicing fac...  67.4    2e-10   Brassica rapa
ref|XP_006648032.1|  PREDICTED: serine/arginine-rich splicing fac...  67.0    2e-10   Oryza brachyantha
ref|XP_010460161.1|  PREDICTED: serine/arginine-rich splicing fac...  67.0    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010460162.1|  PREDICTED: serine/arginine-rich splicing fac...  67.0    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006648031.1|  PREDICTED: serine/arginine-rich splicing fac...  67.0    2e-10   Oryza brachyantha
gb|AGE46101.1|  arginine/serine-rich splicing factor RSZ28 transc...  67.8    2e-10   Sorghum bicolor [broomcorn]
gb|EYU29179.1|  hypothetical protein MIMGU_mgv1a014305mg              67.0    2e-10   Erythranthe guttata [common monkey flower]
gb|AFW64191.1|  hypothetical protein ZEAMMB73_035767                  67.0    2e-10   
ref|XP_009779999.1|  PREDICTED: serine/arginine-rich splicing fac...  67.0    2e-10   Nicotiana sylvestris
ref|XP_009780000.1|  PREDICTED: serine/arginine-rich splicing fac...  66.6    2e-10   Nicotiana sylvestris
ref|NP_001048352.1|  Os02g0789400                                     66.6    3e-10   
gb|KJB65743.1|  hypothetical protein B456_010G121100                  66.2    3e-10   Gossypium raimondii
gb|KJB65745.1|  hypothetical protein B456_010G121100                  66.2    3e-10   Gossypium raimondii
gb|KJB65740.1|  hypothetical protein B456_010G121100                  66.2    3e-10   Gossypium raimondii
ref|XP_010477687.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010235900.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    4e-10   
emb|CDY68847.1|  BnaAnng28560D                                        66.2    4e-10   Brassica napus [oilseed rape]
ref|XP_010477689.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008357431.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  66.2    4e-10   
gb|AFW64195.1|  hypothetical protein ZEAMMB73_035767                  65.9    4e-10   
ref|XP_006412579.1|  hypothetical protein EUTSA_v10026315mg           65.9    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_009140565.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    4e-10   Brassica rapa
ref|XP_011044978.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    6e-10   Populus euphratica
emb|CDY13444.1|  BnaA03g51620D                                        65.1    9e-10   Brassica napus [oilseed rape]
gb|EMT04120.1|  Splicing factor, arginine/serine-rich 7               65.1    1e-09   
ref|XP_010235684.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_003575333.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   Brachypodium distachyon [annual false brome]
gb|EMT10866.1|  Splicing factor, arginine/serine-rich 7               65.1    2e-09   
gb|EMS62939.1|  Serine/arginine-rich splicing factor 7                65.1    2e-09   Triticum urartu
gb|AAY84871.1|  pre-mRNA processing factor                            63.9    3e-09   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ98217.1|  predicted protein                                    63.9    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX76804.1|  BnaC08g33900D                                        66.6    3e-09   
gb|EMS58509.1|  Serine/arginine-rich splicing factor 7                65.9    3e-09   Triticum urartu
gb|EPS60072.1|  hypothetical protein M569_14729                       63.5    4e-09   Genlisea aurea
ref|XP_010429442.1|  PREDICTED: serine/arginine-rich splicing fac...  63.5    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010417215.1|  PREDICTED: serine/arginine-rich splicing fac...  63.5    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009117114.1|  PREDICTED: serine/arginine-rich splicing fac...  63.2    5e-09   
ref|NP_194886.1|  protein serine/arginine-rich 22                     63.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295037.1|  hypothetical protein CARUB_v10024105mg           62.0    7e-09   
ref|XP_006295038.1|  hypothetical protein CARUB_v10024105mg           62.4    1e-08   
ref|NP_180035.1|  serine/arginine-rich splicing factor RSZ22A         62.0    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878770.1|  hypothetical protein ARALYDRAFT_481315           62.0    1e-08   
gb|EEC73573.1|  hypothetical protein OsI_08026                        62.4    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002869320.1|  hypothetical protein ARALYDRAFT_491582           61.6    2e-08   
ref|XP_006404997.1|  hypothetical protein EUTSA_v10000328mg           61.6    2e-08   
gb|KJB53757.1|  hypothetical protein B456_009G066600                  61.2    2e-08   Gossypium raimondii
emb|CAA05352.1|  RSZp22 protein                                       60.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515364.1|  arginine/serine-rich splicing factor, putative   60.1    4e-08   
ref|XP_002324943.1|  splicing factor RSZp22 family protein            60.1    7e-08   
ref|XP_002963848.1|  hypothetical protein SELMODRAFT_68846            58.2    2e-07   
ref|XP_010041973.1|  PREDICTED: serine/arginine-rich splicing fac...  57.0    3e-07   
gb|KCW60187.1|  hypothetical protein EUGRSUZ_H02907                   57.4    3e-07   Eucalyptus grandis [rose gum]
ref|XP_002971799.1|  hypothetical protein SELMODRAFT_172361           58.2    5e-07   
gb|KCW80633.1|  hypothetical protein EUGRSUZ_C02009                   55.1    1e-06   Eucalyptus grandis [rose gum]
ref|XP_010048380.1|  PREDICTED: serine/arginine-rich splicing fac...  54.7    2e-06   
ref|XP_004135236.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  54.3    4e-06   
ref|XP_008393934.1|  PREDICTED: serine/arginine-rich splicing fac...  52.4    2e-05   
gb|KGN51817.1|  hypothetical protein Csa_5G602160                     52.4    9e-05   Cucumis sativus [cucumbers]
gb|KFM73334.1|  Serine/arginine-rich splicing factor 7                49.7    3e-04   Stegodyphus mimosarum
ref|XP_002954355.1|  hypothetical protein VOLCADRAFT_121301           50.4    4e-04   Volvox carteri f. nagariensis



>ref|XP_009792571.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nicotiana 
sylvestris]
Length=200

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDGKNGWRVELSHNSSG  GGR   GGDD+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIRELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCYECGEPGHFAREC  102



>ref|XP_006601788.1| PREDICTED: uncharacterized protein LOC100776329 isoform X4 [Glycine 
max]
Length=161

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_006601786.1| PREDICTED: uncharacterized protein LOC100776329 isoform X2 [Glycine 
max]
 ref|XP_006601787.1| PREDICTED: uncharacterized protein LOC100776329 isoform X3 [Glycine 
max]
Length=173

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|NP_001242436.1| uncharacterized protein LOC100776329 [Glycine max]
 gb|ACU20711.1| unknown [Glycine max]
Length=177

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_006601785.1| PREDICTED: uncharacterized protein LOC100776329 isoform X1 [Glycine 
max]
Length=177

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>gb|KHN10603.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=186

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_003532014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Glycine max]
 ref|XP_006585955.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Glycine max]
Length=176

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_009606700.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Nicotiana tomentosiformis]
Length=172

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  46   DDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  102



>ref|XP_009606695.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009606696.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Nicotiana tomentosiformis]
Length=204

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  50   DDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  106



>ref|XP_009606697.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009606698.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
Length=200

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  46   DDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  102



>ref|XP_009606699.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=177

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  23   DDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  79



>ref|XP_008793862.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Phoenix dactylifera]
Length=182

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  49   DDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  107



>ref|XP_008793863.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Phoenix dactylifera]
Length=179

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  104



>ref|XP_008793864.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X3 [Phoenix dactylifera]
Length=179

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  49   DDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  107



>ref|XP_008793865.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X4 [Phoenix dactylifera]
Length=176

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  104



>ref|XP_010928600.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Elaeis 
guineensis]
Length=182

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 51/62 (82%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA+RGLDGKNGWRVELSHNS      GG  G  RGGGDD KCYECGEPGHFAR
Sbjct  46   DDRRDALDAIRGLDGKNGWRVELSHNSKGGGGGGGGRGGRRGGGDDMKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010271961.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Nelumbo 
nucifera]
Length=184

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDA+RGLDGKNGWRVELSHNS     G  GGR RGGG+D KCYECGEPGHFARE
Sbjct  46   DDRRDALDAIRGLDGKNGWRVELSHNSKGGGGGRGGGRGRGGGEDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_006371254.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49051.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=193

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  24   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  83

Query  515  C  513
            C
Sbjct  84   C  84



>ref|XP_010914080.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Elaeis guineensis]
Length=183

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_010914079.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Elaeis guineensis]
Length=197

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  60   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  116



>ref|XP_006371251.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49048.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=118

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  24   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  83

Query  515  C  513
            C
Sbjct  84   C  84



>ref|XP_008779620.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Phoenix 
dactylifera]
Length=183

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_010929222.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=183

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_006371252.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49049.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=154

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  24   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  83

Query  515  C  513
            C
Sbjct  84   C  84



>ref|XP_011013272.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X3 [Populus euphratica]
Length=153

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  19   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  78

Query  515  C  513
            C
Sbjct  79   C  79



>ref|XP_006371253.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49050.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=158

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  24   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  83

Query  515  C  513
            C
Sbjct  84   C  84



>ref|XP_011013271.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Populus euphratica]
Length=176

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  46   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>gb|KJB31255.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=209

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_011013270.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Populus euphratica]
Length=180

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFARE
Sbjct  46   DDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_008794412.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Phoenix 
dactylifera]
Length=183

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRHGGSDMKCYECGEPGHFAREC  102



>ref|XP_006438430.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51670.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|KDO82501.1| hypothetical protein CISIN_1g041602mg [Citrus sinensis]
Length=223

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>ref|XP_010023818.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023819.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023820.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 gb|KCW60183.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60184.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60185.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60186.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
Length=188

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs-----sggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA+R LDGKNGWRVE+SHN       GGRGGR  GGG+DSKCYECGEPGHFAR
Sbjct  46   DDRRDALDAIRSLDGKNGWRVEVSHNKGGGGRGGGRGGRGFGGGEDSKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010929220.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010929221.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=202

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_008340015.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=181

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 51/60 (85%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDAV+ LDGKNGWRVELSHNS    G  GGR RGGGDD KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAVQALDGKNGWRVELSHNSKGSGGRGGGRGRGGGDDLKCYECGEPGHFAREC  105



>ref|XP_008340014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=182

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 51/60 (85%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDAV+ LDGKNGWRVELSHNS    G  GGR RGGGDD KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAVQALDGKNGWRVELSHNSKGSGGRGGGRGRGGGDDLKCYECGEPGHFAREC  105



>ref|XP_010551557.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551558.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551559.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
Length=184

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA+DA+R LDGKNGWRVELSHN+  G  GG  RGGGDD KCYECGEPGHFAREC
Sbjct  46   DDERDAMDAIRALDGKNGWRVELSHNNKGGRGGGGRRGGGDDMKCYECGEPGHFAREC  103



>ref|XP_010251307.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
 ref|XP_010251308.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
Length=184

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 51/62 (82%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA+R LDGKNGWRVELSHNS       G GGR RGGG+D KCYECGEPGHFAR
Sbjct  46   DDRRDALDAIRALDGKNGWRVELSHNSKGGGGGRGGGGRGRGGGEDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010100489.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXB82623.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=244

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDA++ LDGKNGWRVELSHNS      G GGR RGGGDD KCYECGEPGHFARE
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGGRGGGGRGRGGGDDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_010551560.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Tarenaya hassleriana]
Length=183

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA+DA+R LDGKNGWRVELSHN+  G  GG  RGGGDD KCYECGEPGHFAREC
Sbjct  46   DDERDAMDAIRALDGKNGWRVELSHNNKGGRGGGGRRGGGDDMKCYECGEPGHFAREC  103



>ref|XP_006836638.1| hypothetical protein AMTR_s00088p00022360 [Amborella trichopoda]
 gb|ERM99491.1| hypothetical protein AMTR_s00088p00022360 [Amborella trichopoda]
Length=129

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 50/60 (83%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+RGLDGKNGWRVELSHNS    G  G R RGGGDD KCYECGEPGHFA EC
Sbjct  40   DDRRDAVDAIRGLDGKNGWRVELSHNSKGGGGRGGSRGRGGGDDMKCYECGEPGHFALEC  99



>gb|KHG11979.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=177

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>gb|KJB31251.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31252.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31253.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31254.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=175

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>emb|CDY59084.1| BnaA09g54590D [Brassica napus]
Length=130

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  46   DDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>gb|KJB31256.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=172

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_006438427.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483824.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Citrus sinensis]
 gb|ESR51667.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=176

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>gb|KJB31257.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=137

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_006438428.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006438429.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483823.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Citrus sinensis]
 gb|ESR51668.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51669.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=180

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>ref|XP_006416049.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 ref|XP_006416050.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34402.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34403.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
Length=187

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LDGKNGWRVELSH +  G  G   RGG +DSKCYECGEPGHFAREC
Sbjct  46   DDERDALDAIRALDGKNGWRVELSHKDKGGRGGVGRRGGIEDSKCYECGEPGHFAREC  103



>emb|CDY47646.1| BnaC05g19020D [Brassica napus]
Length=185

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  46   DDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_009115492.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Brassica rapa]
Length=186

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  46   DDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_009115493.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Brassica rapa]
Length=185

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  46   DDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>emb|CDP00182.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHNS   GG  G    GGDD KCYECGEPGHFAREC
Sbjct  46   DDRRDAEDAIRALDGKNGWRVELSHNSKGGGGGRGGRGRGGDDLKCYECGEPGHFAREC  104



>ref|XP_008446226.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
 ref|XP_008446227.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
Length=187

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 48/66 (73%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---------ggrggrsrggGDDSKCYECGEPG  531
            DDRRDALDA++ LDGKNGWRVELSHNS          G   G   GGGDD KCYECGEPG
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGGGGGRRGRGAGGGGGGGDDLKCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|XP_004509838.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Cicer arietinum]
Length=181

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+  LDGKNGWRVELSHNS    G  GGR   G  D KCYECGEPGHFAREC
Sbjct  46   DDRRDALDAIHALDGKNGWRVELSHNSKDGGGRGGGRGGRGSSDLKCYECGEPGHFAREC  105



>ref|XP_004155352.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
Length=188

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 49/67 (73%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----------ggrggrsrggGDDSKCYECGEP  534
            DDRRDALDA++ LDGKNGWRVELSHNS            G GG   GGGDD KCYECGEP
Sbjct  46   DDRRDALDAIQALDGKNGWRVELSHNSKGGGGGGGRRGRGGGGGGGGGGDDLKCYECGEP  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>ref|XP_002534324.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
 gb|EEF28060.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
Length=184

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-------ggrggrsrggGDDSKCYECGEPGHF  525
            DDRRDA+DA+R LDGKNGWRVELSHNS        G  GG    GG+D KCYECGEPGHF
Sbjct  46   DDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGGSGGGGRGRGGEDMKCYECGEPGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>gb|KDP26562.1| hypothetical protein JCGZ_17720 [Jatropha curcas]
Length=184

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 49/65 (75%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGH  528
            DDRRDA+DA+R LDGKNGWRVELSHNS         GG GG    GG+D KCYECGEPGH
Sbjct  46   DDRRDAMDAIRALDGKNGWRVELSHNSKGGGGRGGGGGGGGGRGRGGEDLKCYECGEPGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>ref|XP_010682582.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682583.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682584.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDALDA+  LDG+NGWRVELSHN+  GG  G    GG+D KCYECGEPGHFAREC
Sbjct  46   DDKRDALDAIHALDGRNGWRVELSHNAKGGGGRGGRGRGGEDMKCYECGEPGHFAREC  103



>ref|XP_008389624.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=182

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR RGGG+D KCYECGEPGHFARE
Sbjct  46   DDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGRGGGEDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_009363527.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Pyrus x bretschneideri]
Length=182

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR  GGG+D KCYECGEPGHFARE
Sbjct  46   DDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGHGGGEDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_008389623.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=183

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR RGGG+D KCYECGEPGHFARE
Sbjct  46   DDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGRGGGEDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_009363525.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009363526.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
Length=183

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR  GGG+D KCYECGEPGHFARE
Sbjct  46   DDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGHGGGEDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>gb|KJB15225.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
 gb|KJB15226.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
Length=204

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGKNGWRVELSHNS   G  G  RGGG+D KCYECGEPGHF REC
Sbjct  73   DDRRDAMDAIRELDGKNGWRVELSHNSKGVGGRGGRRGGGEDLKCYECGEPGHFVREC  130



>ref|XP_007044557.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 ref|XP_007044558.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00389.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00390.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
Length=177

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA+DA+R LDGK+GWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  46   DDRRDAIDAIRELDGKSGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_006655864.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Oryza 
brachyantha]
Length=185

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA D++R LDGKNGWRVELS N+S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAQDSIRDLDGKNGWRVELSRNASSGRGGRDRYGGSESKCYECGETGHFAREC  102



>ref|XP_008221783.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Prunus mume]
Length=183

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RGGG+D KCYECGEPGHFAR
Sbjct  46   DDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_008221782.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Prunus mume]
Length=184

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RGGG+D KCYECGEPGHFAR
Sbjct  46   DDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>gb|AFK40774.1| unknown [Lotus japonicus]
Length=181

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDALDA+  LDGKNGWRVELSHNS    GGRGG    GG+D KCYECGEPGHFAREC
Sbjct  46   DDKRDALDAIHALDGKNGWRVELSHNSKGGGGGRGGGRGRGGEDLKCYECGEPGHFAREC  105



>ref|NP_001057018.1| Os06g0187900 [Oryza sativa Japonica Group]
 sp|Q69KL9.1|RZ21A_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21A; AltName: 
Full=RS-containing zinc finger protein 21A; Short=Os-RSZ21a; 
Short=Os-RSZp21a [Oryza sativa Japonica Group]
 dbj|BAD36521.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD72462.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF18932.1| Os06g0187900 [Oryza sativa Japonica Group]
 dbj|BAG88899.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92681.1| unnamed protein product [Oryza sativa Japonica Group]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  102



>ref|XP_006845500.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
 gb|ERN07175.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
Length=262

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DDRRDA+DA+R LDGKNGWRVELSHN         GG G    G G D KCYECGEPGHF
Sbjct  105  DDRRDAIDAIRELDGKNGWRVELSHNSRGGGGGRGGGGGRSRSGSGSDMKCYECGEPGHF  164

Query  524  AREC  513
            AREC
Sbjct  165  AREC  168



>ref|XP_003544651.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Glycine max]
 gb|KHN14571.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_006596163.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Glycine max]
Length=175

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_002436620.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|EER87987.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|AGE46105.1| arginine/serine-rich splicing factor RSZ21 transcript I [Sorghum 
bicolor]
 gb|AGE46107.1| arginine/serine-rich splicing factor RSZ21 transcript III [Sorghum 
bicolor]
Length=186

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N+S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVELSRNASSGRGGRDRYGGSESKCYECGETGHFAREC  102



>ref|XP_006596162.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Glycine max]
Length=177

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|NP_001241113.1| uncharacterized protein LOC100790689 [Glycine max]
 gb|ACU13222.1| unknown [Glycine max]
 gb|ACU18210.1| unknown [Glycine max]
 gb|KHN30783.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_006600176.1| PREDICTED: uncharacterized protein LOC100790689 isoform X1 [Glycine 
max]
Length=175

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_007161330.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33324.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=179

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN    GG  G   GGG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGGSDLKCYECGEPGHFAREC  104



>ref|NP_001149338.1| LOC100282961 [Zea mays]
 ref|XP_008658629.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 ref|XP_008658630.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 gb|ACG25623.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG27710.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACN25174.1| unknown [Zea mays]
 gb|ACN27371.1| unknown [Zea mays]
 gb|AFW85525.1| Splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW85526.1| Splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW85527.1| Splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW85528.1| Splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AGE46036.1| arginine/serine-rich splicing factor RSZ21 transcript I [Zea 
mays]
 gb|AGE46037.1| arginine/serine-rich splicing factor RSZ21 transcript II [Zea 
mays]
Length=184

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_011463379.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=186

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDALDA++ LDGKNGWRVELSHNS     GG G   RGGGDD KCYECGEPGHFARE
Sbjct  46   DDHRDALDAIQRLDGKNGWRVELSHNSKGGGGGGGGRGGRGGGDDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_004964637.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Setaria italica]
Length=186

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>gb|AFW85524.1| hypothetical protein ZEAMMB73_327204 [Zea mays]
Length=138

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_007161329.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33323.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=176

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELSHN    GG  G   GGG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGGSDLKCYECGEPGHFAREC  104



>gb|ACG35084.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=184

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_009415507.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=182

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGK+GWRVELSHNSS  RG    GG  D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKHGWRVELSHNSSSSRGRDRHGGS-DMKCYECGEPGHFAREC  101



>gb|EEC80152.1| hypothetical protein OsI_21961 [Oryza sativa Indica Group]
Length=264

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  125  DDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  181



>ref|XP_004297645.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDALDA++ LDGKNGWRVELSHNS     GG G   RGGGDD KCYECGEPGHFARE
Sbjct  46   DDHRDALDAIQRLDGKNGWRVELSHNSKGGGGGGGGRGGRGGGDDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_002264105.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Vitis vinifera]
 emb|CBI32129.3| unnamed protein product [Vitis vinifera]
Length=182

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 8/64 (13%)
 Frame = -2

Query  680  DRRDALDAVRGLDGKNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHF  525
            DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R RGGG+D KCYECGEPGHF
Sbjct  47   DRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHF  106

Query  524  AREC  513
            AREC
Sbjct  107  AREC  110



>ref|XP_007223543.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
 gb|EMJ24742.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
Length=183

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RGGG+D +CYECGEPGHFAR
Sbjct  46   DDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLRCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>gb|EEE65232.1| hypothetical protein OsJ_20394 [Oryza sativa Japonica Group]
Length=264

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  125  DDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  181



>ref|XP_009395828.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395829.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395830.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395831.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=180

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGK+GWRVELSHN S    GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKHGWRVELSHN-SSSSRGRDRHGGSDMKCYECGEPGHFAREC  101



>ref|XP_010653311.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Vitis vinifera]
Length=179

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 8/64 (13%)
 Frame = -2

Query  680  DRRDALDAVRGLDGKNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHF  525
            DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R RGGG+D KCYECGEPGHF
Sbjct  47   DRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHF  106

Query  524  AREC  513
            AREC
Sbjct  107  AREC  110



>ref|XP_011077513.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Sesamum indicum]
Length=180

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA DA+R LDGKNGWRVELSHN      GGRGG     G D KCYECGEPGHFARE
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_011077592.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Sesamum indicum]
Length=177

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA DA+R LDGKNGWRVELSHN      GGRGG     G D KCYECGEPGHFARE
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_011082043.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Sesamum 
indicum]
Length=181

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DDRRDA DA+R LDGKNGWRVELSHN      GGRGG     G D KCYECGEPGHFARE
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_010942196.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=247

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>emb|CAN74578.1| hypothetical protein VITISV_009111 [Vitis vinifera]
Length=318

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 8/64 (13%)
 Frame = -2

Query  680  DRRDALDAVRGLDGKNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHF  525
            DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R RGGG+D KCYECGEPGHF
Sbjct  162  DRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHF  221

Query  524  AREC  513
            AREC
Sbjct  222  AREC  225



>ref|XP_010942202.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X8 [Elaeis guineensis]
Length=235

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942200.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X6 [Elaeis guineensis]
Length=239

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942199.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X5 [Elaeis guineensis]
Length=241

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_004964636.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Setaria italica]
Length=193

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>ref|XP_010942194.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=250

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942197.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Elaeis guineensis]
Length=245

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942201.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X7 [Elaeis guineensis]
Length=238

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_004964635.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Setaria italica]
Length=209

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>ref|XP_010942211.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X16 [Elaeis guineensis]
Length=196

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942204.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X10 [Elaeis guineensis]
Length=208

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942198.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Elaeis guineensis]
Length=242

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942207.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X13 [Elaeis guineensis]
Length=202

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942203.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X9 [Elaeis guineensis]
Length=211

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942208.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X14 [Elaeis guineensis]
Length=200

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942205.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X11 [Elaeis guineensis]
Length=206

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_009386654.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=216

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDGK+GWRVELSHNS   GG  G    GG D  CYECGEPGHFAREC
Sbjct  46   DDRRDALDAIRDLDGKHGWRVELSHNSKGGGGGRGGYGRGGGDMNCYECGEPGHFAREC  104



>gb|EMS45589.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=191

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>ref|XP_010942209.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X15 [Elaeis guineensis]
Length=199

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010648839.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
 ref|XP_010648840.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
Length=182

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA+R LDGKNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_002272657.2| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 ref|XP_010648841.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 emb|CBI24003.3| unnamed protein product [Vitis vinifera]
Length=181

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA+R LDGKNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010942206.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X12 [Elaeis guineensis]
Length=203

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  513
            DDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  46   DDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>emb|CDP12463.1| unnamed protein product [Coffea canephora]
Length=182

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA+R LDGKNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_003603553.1| Splicing factor arginine/serine-rich [Medicago truncatula]
Length=199

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 49/70 (70%), Gaps = 13/70 (19%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssg-------------grggrsrggGDDSKCYEC  543
            DDRRDALDA+R LDGKNGWRVELSHNS               G  GRS GGG D KCYEC
Sbjct  46   DDRRDALDAIRELDGKNGWRVELSHNSKTGGGGGGRGGGGGGGGRGRSGGGGSDLKCYEC  105

Query  542  GEPGHFAREC  513
            GEPGHFAREC
Sbjct  106  GEPGHFAREC  115



>ref|XP_003564174.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Brachypodium 
distachyon]
Length=185

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R +DGKNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>ref|XP_009765884.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Nicotiana 
sylvestris]
Length=229

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD+RDA DA+R LDGKNGWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  95   DDKRDAQDAIRELDGKNGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFARE  154

Query  515  C  513
            C
Sbjct  155  C  155



>gb|KJB53760.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=131

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  46   EDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>ref|XP_006647492.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X3 [Oryza brachyantha]
Length=189

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D KCYECGEPGHFAREC
Sbjct  29   DDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDMKCYECGEPGHFAREC  84



>ref|XP_006647491.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Oryza brachyantha]
Length=203

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDMKCYECGEPGHFAREC  101



>gb|AAY84872.1| pre-mRNA processing factor [Triticum aestivum]
Length=167

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|EMT27182.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=187

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>ref|XP_006647490.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Oryza brachyantha]
Length=206

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDMKCYECGEPGHFAREC  101



>ref|XP_010278048.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278049.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278050.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
Length=182

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS----KCYECGEPGHFARE  516
            DDRRDA DA+R LDGKNGWRVELSHNS G  GGR    G       KCYECGEPGHFARE
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRGRGGGRGGDRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>gb|KJB53756.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53758.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53761.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53762.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=180

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  46   EDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>gb|KJB53759.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=177

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  46   EDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>gb|KJB53763.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=169

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  46   EDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>dbj|BAJ94659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|KDO67328.1| hypothetical protein CISIN_1g046599mg [Citrus sinensis]
Length=131

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGKNGWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_004498562.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cicer 
arietinum]
Length=188

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 45/67 (67%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DDRRDA DA+R LDGKNGWRVELSHN            G   G   GGG D KCYECGEP
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSHNSRSGGGGGGGGGGRGRGGGGGGGSDLKCYECGEP  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>ref|XP_002454683.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|EES07659.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|AGE46110.1| arginine/serine-rich splicing factor RSZ19 transcript II [Sorghum 
bicolor]
Length=163

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|NP_001047400.1| Os02g0610600 [Oryza sativa Japonica Group]
 sp|Q6K9C3.1|RZP23_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ23; AltName: 
Full=RS-containing zinc finger protein 23; Short=Os-RSZ23; 
Short=Os-RSZp23 [Oryza sativa Japonica Group]
 dbj|BAD19227.1| putative splicing factor RSZp22 (RSZP22) [Oryza sativa Japonica 
Group]
 dbj|BAF09314.1| Os02g0610600 [Oryza sativa Japonica Group]
 dbj|BAG94201.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96908.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS   +G   GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELS-TKAGSGRGRDRSGGSDMKCYECGEPGHFAREC  101



>ref|XP_004954180.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Setaria italica]
Length=169

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|XP_009363631.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
 ref|XP_009367985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
Length=186

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD RDA DA+RGLDGKN WRVELSHN        G GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDIRDAEDAIRGLDGKNNWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>gb|EEE57352.1| hypothetical protein OsJ_07486 [Oryza sativa Japonica Group]
Length=203

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS   +G   GR R GG D KCYECGEPGHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELS-TKAGSGRGRDRSGGSDMKCYECGEPGHFAREC  101



>ref|XP_003588649.1| RNA-binding protein Rsf1 [Medicago truncatula]
Length=190

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 45/67 (67%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DDRRDA DA+R LDGKNGWRVELSHN            G   G   GGG D KCYECGEP
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELSHNSRSGGGGGGGGGGRGRGGGGGGGSDLKCYECGEP  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>gb|ACX54788.2| putative arginine/serine-rich splicing factor [Arachis diogoi]
 gb|AET50931.1| SR-protein [Arachis diogoi]
 gb|AFW97328.1| SR protein [Arachis diogoi]
Length=181

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGKNGWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDSRDARDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_006450201.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450202.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450203.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006483489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Citrus sinensis]
 gb|ESR63441.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63442.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63443.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
Length=180

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGKNGWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|NP_001132794.1| hypothetical protein [Zea mays]
 ref|XP_008681240.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81790.1| unknown [Zea mays]
 gb|ACN36863.1| unknown [Zea mays]
 gb|AFW73822.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73823.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73824.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AGE46038.1| arginine/serine-rich splicing factor RSZ20 transcript I [Zea 
mays]
 gb|AGE46039.1| arginine/serine-rich splicing factor RSZ20 transcript II [Zea 
mays]
 gb|AGE46040.1| arginine/serine-rich splicing factor RSZ20 transcript III [Zea 
mays]
 gb|AGE46041.1| arginine/serine-rich splicing factor RSZ20 transcript IV [Zea 
mays]
Length=173

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>gb|AGE46109.1| arginine/serine-rich splicing factor RSZ19 transcript I [Sorghum 
bicolor]
Length=163

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|XP_006305671.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
 gb|EOA38569.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
Length=186

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LD KNGWRVELSH +  G   G  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAIRTLDRKNGWRVELSHKDKGGRGAGGRRGGIEDSKCYECGELGHFAREC  103



>gb|KDP33463.1| hypothetical protein JCGZ_07034 [Jatropha curcas]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs---sggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+  LDGKNGWRVELSHNS    G  GGR R GG D KCYECGEPGHFAREC
Sbjct  46   DDKRDAEDAIHELDGKNGWRVELSHNSRGGGGRGGGRGRFGGSDLKCYECGEPGHFAREC  105



>ref|XP_010268362.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
 ref|XP_010268363.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
Length=289

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-----DSKCYECGEPGHFAR  519
            +DRRDA DA+  LDGKNGWRVELSHNS G  GG   G        D KCYECGEPGHFAR
Sbjct  46   EDRRDAQDAIHELDGKNGWRVELSHNSRGRGGGGRGGDRGRSGGYDMKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_009396254.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=222

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 46/66 (70%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssg---------grggrsrggGDDSKCYECGEPG  531
            DDRRDALDA+R +DGK+GWRVELSHNS             GG   GGG D  CYECGEPG
Sbjct  46   DDRRDALDAIRDIDGKHGWRVELSHNSKAGGGGRGGRGRGGGGGGGGGGDMNCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>gb|EPS72339.1| hypothetical protein M569_02421, partial [Genlisea aurea]
Length=181

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDG+ GWRVELSH  S  G G      G D KCYECGEPGHFAREC
Sbjct  46   DDRRDAQDAIRELDGRRGWRVELSHGGSGRGGGRGGGRSGSDLKCYECGEPGHFAREC  103



>ref|XP_009396262.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=221

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 46/66 (70%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssg---------grggrsrggGDDSKCYECGEPG  531
            DDRRDALDA+R +DGK+GWRVELSHNS             GG   GGG D  CYECGEPG
Sbjct  46   DDRRDALDAIRDIDGKHGWRVELSHNSKAGGGGRGGRGRGGGGGGGGGGDMNCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|XP_002893311.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69570.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+R LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAIRALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_006357055.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Solanum tuberosum]
Length=183

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA+R LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELSHNSRGERGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_011459026.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=177

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R LDGKNGWRVELSHN         G GGR R GG D KCYECGEPGHFA
Sbjct  46   DDSRDAEDAIRELDGKNGWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_004291288.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R LDGKNGWRVELSHN         G GGR R GG D KCYECGEPGHFA
Sbjct  46   DDSRDAEDAIRELDGKNGWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_007225929.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
 ref|XP_008219954.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Prunus 
mume]
 gb|EMJ27128.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
Length=182

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD RDA DA+R +DGKNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDSRDAEDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>emb|CDX72313.1| BnaC07g43350D [Brassica napus]
Length=197

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            +D RDA DA+RGLDGKNGWRVE SHN        G       GG D KCYECGEPGHFAR
Sbjct  49   EDPRDARDAIRGLDGKNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAR  108

Query  518  EC  513
            EC
Sbjct  109  EC  110



>ref|XP_004244489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Solanum 
lycopersicum]
Length=183

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA+R LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELSHNSRGERGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_009614738.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Nicotiana tomentosiformis]
Length=180

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGK GWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_009614737.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Nicotiana tomentosiformis]
Length=181

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGK GWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_009614739.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=179

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            DD RDA DA+R LDGK GWRVELSHN      G  GGR R GG D KCYECGEPGHFARE
Sbjct  46   DDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFARE  105

Query  515  C  513
            C
Sbjct  106  C  106



>ref|XP_010692998.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 45/65 (69%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs--------sggrggrsrggGDDSKCYECGEPGH  528
            DD RDA DA+  LDGKNGWRVELSHNS         GG GG    GG D KCYECGEPGH
Sbjct  46   DDTRDAKDAIHALDGKNGWRVELSHNSRGGGGGRGGGGGGGGRGRGGSDLKCYECGEPGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>gb|AGE46163.1| arginine/serine-rich splicing factor RSZ23 transcript III [Physcomitrella 
patens]
Length=209

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R L+GKNGWRVELS +S GG G R RGG DD KCYECGEPGHFAREC
Sbjct  46   EDRRDADDAIRALNGKNGWRVELSRSSGGGGGPRGRGG-DDMKCYECGEPGHFAREC  101



>ref|XP_007011623.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 ref|XP_007011624.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29242.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29243.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
Length=181

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD RDA DA+R +DGKNGWRVELSHN       GG GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDHRDAEDAIREVDGKNGWRVELSHNSRGRGGRGGGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_001776556.1| predicted protein [Physcomitrella patens]
 gb|EDQ58689.1| predicted protein [Physcomitrella patens]
Length=174

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R L+GKNGWRVELS +S GG G R RGG DD KCYECGEPGHFAREC
Sbjct  46   EDRRDADDAIRALNGKNGWRVELSRSSGGGGGPRGRGG-DDMKCYECGEPGHFAREC  101



>gb|AGE46162.1| arginine/serine-rich splicing factor RSZ23 transcript II [Physcomitrella 
patens]
Length=137

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R L+GKNGWRVELS +S GG G R RGG DD KCYECGEPGHFAREC
Sbjct  46   EDRRDADDAIRALNGKNGWRVELSRSSGGGGGPRGRGG-DDMKCYECGEPGHFAREC  101



>gb|AGE46161.1| arginine/serine-rich splicing factor RSZ23 transcript I [Physcomitrella 
patens]
Length=210

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R L+GKNGWRVELS +S GG G R RGG DD KCYECGEPGHFAREC
Sbjct  46   EDRRDADDAIRALNGKNGWRVELSRSSGGGGGPRGRGG-DDMKCYECGEPGHFAREC  101



>ref|NP_001140388.1| uncharacterized protein LOC100272442 [Zea mays]
 gb|ACF83722.1| unknown [Zea mays]
 gb|AFW72279.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79941.1| arginine/serine-rich splicing factor RSZ28IV [Zea mays]
Length=141

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_011031384.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Populus 
euphratica]
Length=188

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 46/65 (71%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGH  528
            DD+RDA DA+  LDGKNGWRVELSHN          G  GGR R GG D KCYECGEPGH
Sbjct  46   DDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEPGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>ref|XP_006382133.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 ref|XP_006382134.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
 gb|ERP59930.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 gb|ERP59931.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
Length=187

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 46/65 (71%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGH  528
            DD+RDA DA+  LDGKNGWRVELSHN          G  GGR R GG D KCYECGEPGH
Sbjct  46   DDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEPGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>ref|XP_010325195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
 ref|XP_010325196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
Length=184

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA++ LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDRRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>gb|AGC79943.1| arginine/serine-rich splicing factor RSZ28VI [Zea mays]
Length=185

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_004245307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
 ref|XP_010325197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
Length=183

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DDRRDA DA++ LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDRRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_001782492.1| predicted protein [Physcomitrella patens]
 gb|EDQ52711.1| predicted protein [Physcomitrella patens]
Length=224

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DA+R L+GKNGWRVELS +S GG G R RGG DD KCYECGEPGHFAREC
Sbjct  46   EDRRDADDAIRALNGKNGWRVELSRSSGGGGGPRGRGG-DDMKCYECGEPGHFAREC  101



>ref|NP_001141411.1| uncharacterized protein LOC100273521 [Zea mays]
 gb|ACF86335.1| unknown [Zea mays]
Length=222

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELSTK--DGGGRGRDRNGSDMKCYECGEVGHFAREC  100



>ref|XP_010112118.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXC32743.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=187

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 46/67 (69%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD RDA DA+R LDGKNGWRVELSHN            G  GGR R GG D KCYECGEP
Sbjct  46   DDARDAEDAIRELDGKNGWRVELSHNSRGGGGGGGGGGGRGGGRGRSGGSDLKCYECGEP  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>gb|ABK24519.1| unknown [Picea sitchensis]
Length=169

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +DRRDA DAVR L+GKN WRVELS NS GG  G    GGDD  CY+CGE GHFAREC
Sbjct  46   EDRRDAGDAVRALNGKNDWRVELSRNSGGGGRGGRGRGGDDMSCYKCGESGHFAREC  102



>gb|KJB68434.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
 gb|KJB68435.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=240

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 47/67 (70%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD RDA DA+R LDGKNGWRVELSHN            GG GGR R GG D KCYECGEP
Sbjct  100  DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGGGRGRSGGSDLKCYECGEP  159

Query  533  GHFAREC  513
            GHFAREC
Sbjct  160  GHFAREC  166



>gb|KJB68433.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=185

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 47/67 (70%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD RDA DA+R LDGKNGWRVELSHN            GG GGR R GG D KCYECGEP
Sbjct  46   DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGGGRGRSGGSDLKCYECGEP  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>ref|NP_001117342.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30442.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=164

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+  LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_008676820.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 ref|XP_008676821.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 gb|ACG37174.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW62914.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=277

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS  +  G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRDLDGKNGWRVELS--TKDGGGRGRDRNGSDMKCYECGEVGHFAREC  100



>ref|XP_004953059.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like [Setaria 
italica]
Length=237

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--AGGGRGRDRNGSDMKCYECGETGHFAREC  100



>ref|XP_010526263.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Tarenaya 
hassleriana]
Length=181

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R LDGKNGWRVE SHN        GG GG    GG D KCYECGEPGHFA
Sbjct  46   DDPRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGGGGGGRGRGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_008681365.1| PREDICTED: uncharacterized protein LOC100272442 isoform X3 [Zea 
mays]
 gb|ACL54220.1| unknown [Zea mays]
 gb|AFW72285.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79942.1| arginine/serine-rich splicing factor RSZ28V [Zea mays]
Length=231

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|NP_001185074.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30443.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=183

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+  LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|NP_564208.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 ref|NP_973901.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 sp|O81127.1|RSZ21_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=At-RSZ21; 
Short=At-RSZp21; Short=AtRSZ21 [Arabidopsis thaliana]
 gb|AAD12770.1| SRZ21 [Arabidopsis thaliana]
 dbj|BAH20240.1| AT1G23860 [Arabidopsis thaliana]
 gb|AEE30440.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
 gb|AEE30441.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=187

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+  LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>emb|CAA05351.1| RSZp21 protein [Arabidopsis thaliana]
Length=184

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+  LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>gb|AAF87159.1|AC002423_24 T23E23.2 [Arabidopsis thaliana]
Length=183

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDALDA+  LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_008681360.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681361.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681362.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681363.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 gb|ACF78238.1| unknown [Zea mays]
 gb|ACF84789.1| unknown [Zea mays]
 gb|ACL53509.1| unknown [Zea mays]
 gb|ACN25660.1| unknown [Zea mays]
 gb|ACN33377.1| unknown [Zea mays]
 gb|ACR36653.1| unknown [Zea mays]
 gb|AFW72280.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW72281.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW72282.1| splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW72283.1| splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AFW72284.1| splicing factor, arginine/serine-rich 7 isoform 5 [Zea mays]
 gb|AGC79938.1| arginine/serine-rich splicing factor RSZ28I [Zea mays]
 gb|AGC79939.1| arginine/serine-rich splicing factor RSZ28II [Zea mays]
 gb|AGC79940.1| arginine/serine-rich splicing factor RSZ28III [Zea mays]
Length=253

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>gb|ACG44253.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=255

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_008681364.1| PREDICTED: uncharacterized protein LOC100272442 isoform X2 [Zea 
mays]
Length=243

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>gb|KHG09265.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
 gb|KHG19345.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=187

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 47/68 (69%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            DD RDA DA+R LDGKNGWRVELSHN             GG GGR R GG D KCYECGE
Sbjct  46   DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGGGGRGRSGGSDLKCYECGE  105

Query  536  PGHFAREC  513
            PGHFAREC
Sbjct  106  PGHFAREC  113



>ref|XP_009353338.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Pyrus x bretschneideri]
Length=187

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R +DGKN WRVELSHN         G GGR R GG D KCYECGEPGHFA
Sbjct  46   DDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_009353337.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Pyrus x bretschneideri]
Length=188

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R +DGKN WRVELSHN         G GGR R GG D KCYECGEPGHFA
Sbjct  46   DDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_006284575.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
 gb|EOA17473.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
Length=193

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            +D RDA DA+R LDGKNGWRVE SHN         G       GG D KCYECGEPGHFA
Sbjct  46   EDPRDARDAIRALDGKNGWRVEQSHNRGERGGGGRGGDRGGGRGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_008466294.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
 ref|XP_008466295.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
Length=186

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD RDA DA+  LDGKNGWRVELSHN        G GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDPRDARDAIHELDGKNGWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_004136307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 ref|XP_004164814.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 gb|KGN60178.1| hypothetical protein Csa_3G881900 [Cucumis sativus]
Length=192

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD RDA DA+  LDGKNGWRVELSHN        G GGR R GG D KCYECGEPGHFAR
Sbjct  46   DDPRDARDAIHELDGKNGWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010498894.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Camelina sativa]
Length=186

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_009353309.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Pyrus 
x bretschneideri]
Length=192

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFA  522
            DD RDA DA+R +DGKN WRVELSHN         G GGR R GG D KCYECGEPGHFA
Sbjct  46   DDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFA  105

Query  521  REC  513
            REC
Sbjct  106  REC  108



>ref|XP_010498892.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
 ref|XP_010498893.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYECGELGHFAREC  104



>gb|AFW64196.1| hypothetical protein ZEAMMB73_035767 [Zea mays]
Length=136

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SKCYECGE GHFAREC
Sbjct  19   DDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESKCYECGETGHFAREC  74



>ref|XP_009630986.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Nicotiana tomentosiformis]
Length=181

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD+RDA DA+R +DGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_009630985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Nicotiana tomentosiformis]
Length=196

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD+RDA DA+R +DGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  61   DDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAR  120

Query  518  EC  513
            EC
Sbjct  121  EC  122



>ref|XP_010432845.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=196

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 42/66 (64%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPG  531
            +D RDA DA+RG+DGKNGWRVE SHN              G     GG D KCYECGEPG
Sbjct  46   EDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGDCGGRGGSDLKCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|XP_006355194.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006355195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006355196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Solanum tuberosum]
Length=184

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD+RDA DA++ LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDQRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_006355197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X4 [Solanum tuberosum]
Length=183

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            DD+RDA DA++ LDGKNGWRVELSHN       G  GGR R GG D KCYECGE GHFAR
Sbjct  46   DDQRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_010447518.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=199

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 43/66 (65%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPG  531
            +D RDA DA+RG+DGKNGWRVE SHN              G R   GG D KCYECGEPG
Sbjct  46   EDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGDRGGRGGSDLKCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|NP_001147002.1| LOC100280612 [Zea mays]
 ref|XP_008677172.1| PREDICTED: LOC100280612 isoform X1 [Zea mays]
 gb|ACG25020.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG29912.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW64193.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW64194.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
Length=163

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SKCYECGE GHFAREC
Sbjct  46   DDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESKCYECGETGHFAREC  101



>ref|XP_010438021.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Camelina 
sativa]
Length=196

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 42/66 (64%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPG  531
            +D RDA DA+RG+DGKNGWRVE SHN              G     GG D KCYECGEPG
Sbjct  46   EDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGDCGGRGGSDLKCYECGEPG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|XP_009138024.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Brassica 
rapa]
Length=194

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            +D RDA DA+R LDGKNGWRVE SHN        G       GG D KCYECGEPGHFAR
Sbjct  46   EDPRDASDAIRDLDGKNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAR  105

Query  518  EC  513
            EC
Sbjct  106  EC  107



>ref|XP_006648032.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Oryza brachyantha]
Length=186

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N + GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRN-TSGRGGRDRHGGSEMKCYECGETGHFAREC  101



>ref|XP_010460161.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=188

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G  GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGGRRGGIEDSKCYECGELGHFAREC  105



>ref|XP_010460162.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G  GG  RGG +DSKCYECGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGGRRGGIEDSKCYECGELGHFAREC  105



>ref|XP_006648031.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Oryza brachyantha]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N + GRGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRN-TSGRGGRDRHGGSEMKCYECGETGHFAREC  101



>gb|AGE46101.1| arginine/serine-rich splicing factor RSZ28 transcript I [Sorghum 
bicolor]
 gb|AGE46102.1| arginine/serine-rich splicing factor RSZ28 transcript II [Sorghum 
bicolor]
 gb|AGE46103.1| arginine/serine-rich splicing factor RSZ28 transcript III [Sorghum 
bicolor]
 gb|AGE46104.1| arginine/serine-rich splicing factor RSZ28 transcript IV [Sorghum 
bicolor]
Length=246

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGW+VELS     G G      G D KCYECGE GHFAREC
Sbjct  46   DDRRDAQDAIRELDGKNGWKVELSTK--AGGGRGRDRNGSDMKCYECGESGHFAREC  100



>gb|EYU29179.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
 gb|EYU29180.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
Length=194

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 45/68 (66%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            DDRRDA DA+R +DGKNGWRVELSHN             GG GGR    G D KCYECGE
Sbjct  46   DDRRDAQDAIRDIDGKNGWRVELSHNSRGGSGGGGGGRGGGGGGRGGRSGSDLKCYECGE  105

Query  536  PGHFAREC  513
             GHFAREC
Sbjct  106  AGHFAREC  113



>gb|AFW64191.1| hypothetical protein ZEAMMB73_035767, partial [Zea mays]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SKCYECGE GHFAREC
Sbjct  74   DDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESKCYECGETGHFAREC  129



>ref|XP_009779999.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Nicotiana sylvestris]
Length=198

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD+RDA DA+R +DGKNGWRVELSHN         G  GGR R GG D KCYECGE GHF
Sbjct  61   DDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHF  120

Query  524  AREC  513
            AREC
Sbjct  121  AREC  124



>ref|XP_009780000.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Nicotiana sylvestris]
Length=183

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD+RDA DA+R +DGKNGWRVELSHN         G  GGR R GG D KCYECGE GHF
Sbjct  46   DDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>ref|NP_001048352.1| Os02g0789400 [Oryza sativa Japonica Group]
 sp|Q6K4N0.1|RSZ21_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=Os-RSZ21; 
Short=Os-RSZp21 [Oryza sativa Japonica Group]
 dbj|BAD19103.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19873.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF10266.1| Os02g0789400 [Oryza sativa Japonica Group]
 dbj|BAG93345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93415.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74149.1| hypothetical protein OsI_09229 [Oryza sativa Indica Group]
 gb|EEE57947.1| hypothetical protein OsJ_08668 [Oryza sativa Japonica Group]
Length=185

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD+RDA DA+R LDGKNGWRVELS N S  RGGR R GG + KCYECGE GHFAREC
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRN-SSSRGGRDRHGGSEMKCYECGETGHFAREC  101



>gb|KJB65743.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=172

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD RDA DA+R LDGKNGWRVELSHN         GG GGR R GG D KCYECGE GHF
Sbjct  46   DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>gb|KJB65745.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=182

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD RDA DA+R LDGKNGWRVELSHN         GG GGR R GG D KCYECGE GHF
Sbjct  46   DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>gb|KJB65740.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65741.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65742.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65744.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65746.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65747.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=183

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 46/64 (72%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD RDA DA+R LDGKNGWRVELSHN         GG GGR R GG D KCYECGE GHF
Sbjct  46   DDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>ref|XP_010477687.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
 ref|XP_010477688.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=179

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G GG  RGG +DSKCY+CGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYDCGELGHFAREC  104



>ref|XP_010235900.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Brachypodium 
distachyon]
Length=194

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNss-------ggrggrsrggGDDSKCYECGEPGHF  525
            DD+RDA DA+R LDGKNGWRVELS NSS       GG GGR R GG +SKCYECGE GHF
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>emb|CDY68847.1| BnaAnng28560D [Brassica napus]
Length=194

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  513
            +D RDA DA+R LDGKNGWRVE SHN   G   G    GG D KCYECGE GHFAREC
Sbjct  46   EDSRDARDAIRDLDGKNGWRVEQSHNRGGGRGDGGRGRGGSDLKCYECGESGHFAREC  103



>ref|XP_010477689.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=178

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSH--NssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DD RDA DA+R LD KNGWRVELSH      G GG  RGG +DSKCY+CGE GHFAREC
Sbjct  46   DDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYDCGELGHFAREC  104



>ref|XP_008357431.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RSZ22A-like [Malus domestica]
Length=194

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 46/69 (67%), Gaps = 12/69 (17%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------------ssggrggrsrggGDDSKCYECG  540
            DD RDA DA+R LDGKN WRVELSHN              GG GGR R GG D KCYECG
Sbjct  46   DDSRDAEDAIRELDGKNNWRVELSHNXRGGGGGGGGGGGGGGGGGRGRSGGSDLKCYECG  105

Query  539  EPGHFAREC  513
            EPGHFAREC
Sbjct  106  EPGHFAREC  114



>gb|AFW64195.1| hypothetical protein ZEAMMB73_035767 [Zea mays]
Length=178

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  513
            DDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SKCYECGE GHFAREC
Sbjct  61   DDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESKCYECGETGHFAREC  116



>ref|XP_006412579.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
 gb|ESQ54032.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
Length=192

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 42/64 (66%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            +D RDA DA+R LDGKNGWRVE SHN            G R   GG D KCYECGEPGHF
Sbjct  46   EDPRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGDRGGDRGGRGGSDLKCYECGEPGHF  105

Query  524  AREC  513
            AREC
Sbjct  106  AREC  109



>ref|XP_009140565.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Brassica 
rapa]
 emb|CDY45585.1| BnaA04g14520D [Brassica napus]
 emb|CDY20328.1| BnaC04g36280D [Brassica napus]
Length=196

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGH  528
            +D RDA DA+R LDGKNGWRVE SHN          GG  G    GG D KCYECGEPGH
Sbjct  46   EDSRDARDAIRDLDGKNGWRVEESHNRGGGGGRGGRGGGDGGRGRGGSDLKCYECGEPGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>ref|XP_011044978.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Populus euphratica]
Length=189

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 45/65 (69%), Gaps = 8/65 (12%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGH  528
            DD+RDA DA+  LDGKNGWRVELSHN          G  GGR R GG D KCYECGE GH
Sbjct  46   DDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEAGH  105

Query  527  FAREC  513
            FAREC
Sbjct  106  FAREC  110



>emb|CDY13444.1| BnaA03g51620D [Brassica napus]
Length=199

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAR  519
            +D RDA DA+R LDG NGWRVE SHN        G       GG D KCYECGEPGHFAR
Sbjct  51   EDPRDASDAIRDLDGNNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAR  110

Query  518  EC  513
            EC
Sbjct  111  EC  112



>gb|EMT04120.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=224

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 45/67 (67%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD+RDA DA+R LDGKNGWRVELS N           +GG GG    GG D KCYECGE 
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGAGGGGGGRDRGGSDMKCYECGES  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>ref|XP_010235684.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010235685.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
Length=234

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs-sggrggrsrggGDDSKCYECGEPGHFAREC  513
            D+ RDA DA+R LDGKNGWRVELS  S SG    R R GG D KCYECGE GHFAREC
Sbjct  46   DESRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERPGGSDMKCYECGESGHFAREC  103



>ref|XP_003575333.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
 ref|XP_010235686.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
Length=231

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs-sggrggrsrggGDDSKCYECGEPGHFAREC  513
            D+ RDA DA+R LDGKNGWRVELS  S SG    R R GG D KCYECGE GHFAREC
Sbjct  46   DESRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERPGGSDMKCYECGESGHFAREC  103



>gb|EMT10866.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=249

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs-sggrggrsrggGDDSKCYECGEPGHFAREC  513
            D+ RDA DA+R LDGKNGWRVELS  S SG    R R GG D KCYECGE GHFAREC
Sbjct  46   DETRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERSGGSDMKCYECGESGHFAREC  103



>gb|EMS62939.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=250

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHNs-sggrggrsrggGDDSKCYECGEPGHFAREC  513
            D+ RDA DA+R LDGKNGWRVELS  S SG    R R GG D KCYECGE GHFAREC
Sbjct  46   DETRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERSGGSDMKCYECGESGHFAREC  103



>gb|AAY84871.1| pre-mRNA processing factor [Triticum aestivum]
Length=194

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 44/67 (66%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD+RDA DA+R LDGKNGWRVELS N            GG GG    GG D KCYECGE 
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGGGGRGRGGSDMKCYECGES  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>dbj|BAJ98217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 44/67 (66%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEP  534
            DD+RDA DA+R LDGKNGWRVELS N            GG GG    GG D KCYECGE 
Sbjct  46   DDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGGGGRDRGGSDMKCYECGES  105

Query  533  GHFAREC  513
            GHFAREC
Sbjct  106  GHFAREC  112



>emb|CDX76804.1| BnaC08g33900D [Brassica napus]
Length=813

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFARE  516
            +D RDA DA+R LDGKNGWRVE SHN      G   G    GG D KCYECGE GHFARE
Sbjct  662  EDSRDARDAIRDLDGKNGWRVEQSHNRGGGGGGRGDGGRGRGGSDLKCYECGESGHFARE  721

Query  515  C  513
            C
Sbjct  722  C  722



>gb|EMS58509.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=375

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 7/64 (11%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHF  525
            DD+RDA DA+R LDGKNGWRVELS N         GG GG    GG D KCYECGE GHF
Sbjct  139  DDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGRDRGGSDMKCYECGESGHF  198

Query  524  AREC  513
            AREC
Sbjct  199  AREC  202



>gb|EPS60072.1| hypothetical protein M569_14729, partial [Genlisea aurea]
Length=197

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 45/67 (67%), Gaps = 10/67 (15%)
 Frame = -2

Query  683  DDRRDALDAVRGLDG---------KNGWRVELSHNssggrggrsrggGD-DSKCYECGEP  534
            DDRRDA DA+R LDG         K+GWRVELSH  SG  GGR  G    D KCYECGEP
Sbjct  48   DDRRDAQDAIRELDGCIISFSLTGKHGWRVELSHGGSGRGGGRGGGRSGSDLKCYECGEP  107

Query  533  GHFAREC  513
            GHFAREC
Sbjct  108  GHFAREC  114



>ref|XP_010429442.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Camelina 
sativa]
Length=197

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            +D RDA DA+R LDGKNGWRVE SHN              G  G    GG D KCYECGE
Sbjct  46   EDSRDARDAIRALDGKNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGE  105

Query  536  PGHFAREC  513
             GHFAREC
Sbjct  106  SGHFAREC  113



>ref|XP_010417215.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
 ref|XP_010472468.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
Length=197

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            +D RDA DA+R LDGKNGWRVE SHN              G  G    GG D KCYECGE
Sbjct  46   EDSRDARDAIRALDGKNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGE  105

Query  536  PGHFAREC  513
             GHFAREC
Sbjct  106  SGHFAREC  113



>ref|XP_009117114.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
 ref|XP_009117115.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
Length=205

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 41/66 (62%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPG  531
            +D RDA DA+R LDGKNGWRVE SHN           G   G    GG D KCYECGE G
Sbjct  46   EDSRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGGGGRGDGGRGRGGSDLKCYECGESG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|NP_194886.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 ref|NP_001078474.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 sp|O81126.1|RSZ22_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22; AltName: 
Full=RS-containing zinc finger protein 22; Short=At-RSZ22; 
Short=At-RSZp22; Short=AtRSZ22 [Arabidopsis thaliana]
 emb|CAA19765.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAD12769.1| 9G8-like SR protein [Arabidopsis thaliana]
 emb|CAB79876.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAL38828.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM51281.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM63524.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AEE85931.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 gb|AEE85932.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
Length=200

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 44/69 (64%), Gaps = 12/69 (17%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------------ssggrggrsrggGDDSKCYECG  540
            +D RDA DA+R LDGKNGWRVE SHN              GG GGR   GG D KCYECG
Sbjct  46   EDPRDARDAIRALDGKNGWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECG  105

Query  539  EPGHFAREC  513
            E GHFAREC
Sbjct  106  ETGHFAREC  114



>ref|XP_006295037.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27935.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=155

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            +D RDA DA+R LDGKNGWRVE SHN              G  G    GG D KCYECGE
Sbjct  46   EDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGE  105

Query  536  PGHFAREC  513
             GHFAREC
Sbjct  106  SGHFAREC  113



>ref|XP_006295038.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27936.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=196

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGE  537
            +D RDA DA+R LDGKNGWRVE SHN              G  G    GG D KCYECGE
Sbjct  46   EDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGE  105

Query  536  PGHFAREC  513
             GHFAREC
Sbjct  106  SGHFAREC  113



>ref|NP_180035.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
 sp|Q9SJA6.1|RZ22A_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22A; AltName: 
Full=RS-containing zinc finger protein 22A; Short=At-RSZ22a; 
Short=At-RSZp22a; Short=AtRSZ22a [Arabidopsis thaliana]
 gb|AAD23894.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 dbj|BAC42523.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAO63280.1| At2g24590 [Arabidopsis thaliana]
 gb|AEC07595.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
Length=196

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 42/66 (64%), Gaps = 9/66 (14%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPG  531
            +D RDA DA+R +DGKNGWRVE SHN           GG  G    GG D KCYECGE G
Sbjct  46   EDSRDARDAIREVDGKNGWRVEQSHNRGGGGGRGGGRGGGDGGRGRGGSDLKCYECGESG  105

Query  530  HFAREC  513
            HFAREC
Sbjct  106  HFAREC  111



>ref|XP_002878770.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55029.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 42/69 (61%), Gaps = 12/69 (17%)
 Frame = -2

Query  683  DDRRDALDAVRGLDGKNGWRVELSHN------------ssggrggrsrggGDDSKCYECG  540
            +D RDA DA+R LDGKNGWRVE SHN              GG  G    GG D KCYECG
Sbjct  46   EDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGGGDGGRGRGGSDLKCYECG  105

Query  539  EPGHFAREC  513
            E GHFAREC
Sbjct  106  ESGHFAREC  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880