BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032J17

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               303   2e-99   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          302   5e-99   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               300   3e-98   Nicotiana sylvestris
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               290   2e-95   
gb|KHG24129.1|  Reticulon-like protein B3                               287   2e-93   Gossypium arboreum [tree cotton]
ref|XP_002509881.1|  conserved hypothetical protein                     287   2e-93   Ricinus communis
emb|CDP12094.1|  unnamed protein product                                286   7e-93   Coffea canephora [robusta coffee]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               284   4e-92   Nelumbo nucifera [Indian lotus]
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               283   9e-92   Vitis vinifera
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               283   1e-91   Nicotiana tomentosiformis
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         280   9e-91   Jatropha curcas
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          281   1e-90   Solanum tuberosum [potatoes]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               280   1e-90   Nicotiana sylvestris
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               279   3e-90   Phoenix dactylifera
gb|AFK41983.1|  unknown                                                 278   5e-90   Medicago truncatula
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               279   5e-90   
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               278   8e-90   Vitis vinifera
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               278   8e-90   Phoenix dactylifera
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               278   9e-90   Elaeis guineensis
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    278   9e-90   Nicotiana sylvestris
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             277   2e-89   Phaseolus vulgaris [French bean]
gb|ACJ84486.1|  unknown                                                 276   3e-89   Medicago truncatula
ref|NP_001239711.1|  uncharacterized protein LOC100811024               276   3e-89   Glycine max [soybeans]
gb|ACU23452.1|  unknown                                                 276   4e-89   Glycine max [soybeans]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    276   5e-89   Glycine max [soybeans]
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             276   5e-89   Citrus clementina [clementine]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               276   5e-89   Eucalyptus grandis [rose gum]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    275   6e-89   
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               276   6e-89   Populus euphratica
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     276   7e-89   Eucalyptus grandis [rose gum]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          275   1e-88   Citrus sinensis [apfelsine]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     276   1e-88   Eucalyptus grandis [rose gum]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               275   1e-88   Elaeis guineensis
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    274   3e-88   Nicotiana tomentosiformis
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               273   5e-88   Elaeis guineensis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               273   5e-88   Nicotiana sylvestris
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               272   1e-87   Phoenix dactylifera
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               272   3e-87   Nicotiana tomentosiformis
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    272   3e-87   Nicotiana sylvestris
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               270   8e-87   Sesamum indicum [beniseed]
ref|XP_002299504.1|  reticulon family protein                           269   2e-86   Populus trichocarpa [western balsam poplar]
gb|KJB52210.1|  hypothetical protein B456_008G250900                    269   3e-86   Gossypium raimondii
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          269   3e-86   Cicer arietinum [garbanzo]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 268   4e-86   Elaeis guineensis
ref|XP_007038874.1|  VIRB2-interacting protein 2                        268   6e-86   Theobroma cacao [chocolate]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               267   1e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               267   1e-85   Eucalyptus grandis [rose gum]
gb|KHG04885.1|  Reticulon-like protein B5                               267   2e-85   Gossypium arboreum [tree cotton]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          266   3e-85   Solanum tuberosum [potatoes]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               266   4e-85   Solanum lycopersicum
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                265   8e-85   Erythranthe guttata [common monkey flower]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    265   8e-85   Gossypium raimondii
gb|KJB06451.1|  hypothetical protein B456_001G157900                    265   1e-84   Gossypium raimondii
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               266   1e-84   Elaeis guineensis
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    265   1e-84   Solanum tuberosum [potatoes]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               265   2e-84   Solanum lycopersicum
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          266   2e-84   Glycine max [soybeans]
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               264   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          263   4e-84   Oryza brachyantha
gb|KJB19087.1|  hypothetical protein B456_003G084400                    263   7e-84   Gossypium raimondii
ref|XP_007051689.1|  Reticulon family protein                           263   7e-84   
gb|KHG29253.1|  Reticulon-like protein B5                               262   1e-83   Gossypium arboreum [tree cotton]
ref|NP_001149653.1|  LOC100283279                                       262   1e-83   Zea mays [maize]
ref|NP_001150474.1|  seed maturation protein                            263   2e-83   
gb|EAY73097.1|  hypothetical protein OsI_00974                          262   2e-83   Oryza sativa Indica Group [Indian rice]
gb|KHG15548.1|  Reticulon-like protein B3                               261   2e-83   Gossypium arboreum [tree cotton]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               261   3e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               261   3e-83   Tarenaya hassleriana [spider flower]
tpg|DAA52789.1|  TPA: seed maturation protein                           262   3e-83   
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               261   3e-83   Populus euphratica
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               262   3e-83   Brachypodium distachyon [annual false brome]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   261   4e-83   Citrus sinensis [apfelsine]
ref|XP_002511930.1|  conserved hypothetical protein                     261   5e-83   Ricinus communis
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             261   5e-83   Citrus clementina [clementine]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             261   5e-83   Capsella rubella
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               261   6e-83   Tarenaya hassleriana [spider flower]
ref|XP_002303615.1|  reticulon family protein                           260   7e-83   Populus trichocarpa [western balsam poplar]
gb|KHG09260.1|  Reticulon-like protein B3                               259   1e-82   Gossypium arboreum [tree cotton]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               259   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP08746.1|  unnamed protein product                                260   1e-82   Coffea canephora [robusta coffee]
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         259   1e-82   Jatropha curcas
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    265   1e-82   
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               259   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               259   2e-82   Cucumis melo [Oriental melon]
dbj|BAB32723.1|  unknown protein                                        260   2e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    259   3e-82   
ref|NP_001056102.1|  Os05g0526400                                       258   3e-82   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               259   3e-82   
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               258   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          258   4e-82   Setaria italica
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               258   4e-82   Nelumbo nucifera [Indian lotus]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               258   4e-82   Prunus mume [ume]
gb|KHG20258.1|  Reticulon-like protein B3                               258   5e-82   Gossypium arboreum [tree cotton]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          258   7e-82   Setaria italica
ref|XP_002874678.1|  VIRB2-interacting protein 2                        258   7e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          257   1e-81   Solanum tuberosum [potatoes]
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                257   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          257   1e-81   Cucumis sativus [cucumbers]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    256   2e-81   Sesamum indicum [beniseed]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               257   2e-81   Nicotiana sylvestris
gb|EMS62606.1|  Reticulon-like protein B1                               256   2e-81   Triticum urartu
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          258   2e-81   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             256   3e-81   
ref|XP_010092876.1|  Reticulon-like protein                             256   4e-81   Morus notabilis
gb|EMT19773.1|  Reticulon-like protein B1                               257   4e-81   
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               255   4e-81   Solanum lycopersicum
emb|CDP05124.1|  unnamed protein product                                255   5e-81   Coffea canephora [robusta coffee]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             256   5e-81   Prunus persica
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             256   5e-81   
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               256   6e-81   Malus domestica [apple tree]
emb|CDJ26559.1|  unnamed protein product                                256   7e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               256   7e-81   Brassica rapa
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               255   7e-81   Prunus mume [ume]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    255   7e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               255   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               254   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               255   2e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY75742.1|  hypothetical protein OsI_03655                          254   2e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               254   3e-80   Camelina sativa [gold-of-pleasure]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               253   3e-80   Glycine max [soybeans]
gb|KHN15986.1|  Reticulon-like protein B5                               253   3e-80   Glycine soja [wild soybean]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               253   3e-80   Tarenaya hassleriana [spider flower]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          253   6e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               253   7e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               253   7e-80   Camelina sativa [gold-of-pleasure]
ref|NP_001044177.1|  Os01g0736900                                       252   9e-80   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               252   1e-79   Brachypodium distachyon [annual false brome]
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               252   1e-79   
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               252   1e-79   Sesamum indicum [beniseed]
gb|EAY98759.1|  hypothetical protein OsI_20691                          251   2e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               251   2e-79   Sesamum indicum [beniseed]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          251   2e-79   Oryza brachyantha
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               251   3e-79   Populus euphratica
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               251   4e-79   Malus domestica [apple tree]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             253   4e-79   
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               251   4e-79   Pyrus x bretschneideri [bai li]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                250   5e-79   Erythranthe guttata [common monkey flower]
ref|NP_192861.1|  reticulon-like protein B2                             251   5e-79   Arabidopsis thaliana [mouse-ear cress]
gb|ACF87936.1|  unknown                                                 248   6e-79   Zea mays [maize]
dbj|BAJ89699.1|  predicted protein                                      250   6e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002320163.1|  reticulon family protein                           250   6e-79   Populus trichocarpa [western balsam poplar]
gb|ABK94480.1|  unknown                                                 250   6e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    249   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001130478.1|  Seed maturation protein                            249   1e-78   Zea mays [maize]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          249   1e-78   Oryza brachyantha
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               249   1e-78   Eucalyptus grandis [rose gum]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                249   2e-78   Erythranthe guttata [common monkey flower]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   248   2e-78   Citrus sinensis [apfelsine]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    248   3e-78   Gossypium raimondii
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          248   4e-78   Cucumis sativus [cucumbers]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    248   4e-78   Arabis alpina [alpine rockcress]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    249   5e-78   Gossypium raimondii
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             247   8e-78   Citrus clementina [clementine]
ref|NP_194094.1|  VIRB2-interacting protein 1                           247   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|EMT18983.1|  Reticulon-like protein B1                               245   2e-77   
gb|ABR17571.1|  unknown                                                 245   5e-77   Picea sitchensis
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               246   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        246   6e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               245   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    245   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010112604.1|  Reticulon-like protein                             244   2e-76   Morus notabilis
gb|ACN40158.1|  unknown                                                 244   2e-76   Picea sitchensis
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             244   2e-76   
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               243   2e-76   Malus domestica [apple tree]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        243   4e-76   
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             244   4e-76   
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   244   5e-76   Citrus sinensis [apfelsine]
emb|CDY57657.1|  BnaC01g15350D                                          243   5e-76   Brassica napus [oilseed rape]
gb|EMS62854.1|  Reticulon-like protein B1                               242   5e-76   Triticum urartu
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               243   5e-76   Pyrus x bretschneideri [bai li]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               242   8e-76   Pyrus x bretschneideri [bai li]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         242   8e-76   Jatropha curcas
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             243   8e-76   Eutrema salsugineum [saltwater cress]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               242   9e-76   
emb|CDY10954.1|  BnaA03g46130D                                          242   1e-75   Brassica napus [oilseed rape]
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               242   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               241   2e-75   Pyrus x bretschneideri [bai li]
dbj|BAJ98297.1|  predicted protein                                      241   2e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY44123.1|  BnaA01g13310D                                          242   2e-75   Brassica napus [oilseed rape]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               242   2e-75   Brassica rapa
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               241   3e-75   Brassica rapa
gb|KHN29299.1|  Reticulon-like protein B5                               240   3e-75   Glycine soja [wild soybean]
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               240   4e-75   Fragaria vesca subsp. vesca
ref|NP_198975.1|  reticulon-like protein B4                             240   5e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               239   6e-75   Fragaria vesca subsp. vesca
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             240   7e-75   Eutrema salsugineum [saltwater cress]
emb|CDY05135.1|  BnaC03g29330D                                          241   9e-75   
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    239   9e-75   Arabis alpina [alpine rockcress]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               239   1e-74   Glycine max [soybeans]
gb|KHN40449.1|  Reticulon-like protein B5                               239   1e-74   Glycine soja [wild soybean]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               239   1e-74   Brachypodium distachyon [annual false brome]
gb|KJB24288.1|  hypothetical protein B456_004G137000                    238   2e-74   Gossypium raimondii
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               239   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               239   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               239   2e-74   Populus euphratica
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               239   2e-74   Camelina sativa [gold-of-pleasure]
dbj|BAJ33905.1|  unnamed protein product                                239   2e-74   Eutrema halophilum
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             238   3e-74   Phaseolus vulgaris [French bean]
emb|CDX90792.1|  BnaA03g24720D                                          239   3e-74   
emb|CDY25557.1|  BnaC09g11820D                                          238   3e-74   Brassica napus [oilseed rape]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             238   4e-74   Capsella rubella
emb|CDY24806.1|  BnaA08g15040D                                          238   4e-74   Brassica napus [oilseed rape]
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      238   4e-74   
emb|CDY41666.1|  BnaC03g62180D                                          238   4e-74   Brassica napus [oilseed rape]
ref|NP_001239653.1|  uncharacterized protein LOC100793862               238   5e-74   Glycine max [soybeans]
dbj|BAH57206.1|  AT1G64090                                              237   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             237   6e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             237   6e-74   Eutrema salsugineum [saltwater cress]
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      238   8e-74   
ref|NP_176592.1|  reticulon-like protein B3                             237   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               237   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               237   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    237   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               237   1e-73   Malus domestica [apple tree]
ref|NP_001042463.1|  Os01g0226300                                       234   1e-73   
emb|CDM81762.1|  unnamed protein product                                236   1e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          236   1e-73   Setaria italica
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               236   1e-73   Brassica rapa
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             236   2e-73   Populus trichocarpa [western balsam poplar]
gb|AFK42059.1|  unknown                                                 236   2e-73   Lotus japonicus
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               236   3e-73   Malus domestica [apple tree]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             235   3e-73   Prunus persica
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               235   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               235   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_002887921.1|  reticulon family protein                           235   4e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               235   5e-73   Pyrus x bretschneideri [bai li]
emb|CDY42012.1|  BnaC04g00900D                                          234   8e-73   Brassica napus [oilseed rape]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               234   9e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34396.1|  BnaA09g11380D                                          234   1e-72   Brassica napus [oilseed rape]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             234   1e-72   Capsella rubella
ref|XP_002880222.1|  reticulon family protein                           234   1e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               234   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          234   2e-72   Oryza brachyantha
emb|CDY38194.1|  BnaA09g11950D                                          233   3e-72   Brassica napus [oilseed rape]
emb|CDY52012.1|  BnaC06g42920D                                          233   3e-72   Brassica napus [oilseed rape]
gb|ACG32549.1|  seed maturation protein                                 233   3e-72   Zea mays [maize]
ref|NP_001046501.1|  Os02g0265900                                       232   4e-72   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               233   4e-72   Fragaria vesca subsp. vesca
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               233   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               233   5e-72   Camelina sativa [gold-of-pleasure]
ref|NP_001057713.1|  Os06g0503400                                       233   6e-72   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          232   6e-72   Sorghum bicolor [broomcorn]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    232   7e-72   Arabis alpina [alpine rockcress]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               232   7e-72   Brassica rapa
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               232   8e-72   Brassica rapa
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             232   8e-72   Capsella rubella
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             231   1e-71   Phaseolus vulgaris [French bean]
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               231   1e-71   Populus euphratica
ref|NP_566065.1|  reticulon-like protein B5                             231   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71452.1|  hypothetical protein M569_03311                         231   1e-71   Genlisea aurea
gb|ABB51093.1|  reticulon                                               229   1e-71   Hordeum vulgare [barley]
gb|EAY85291.1|  hypothetical protein OsI_06662                          230   2e-71   Oryza sativa Indica Group [Indian rice]
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    231   2e-71   Arabis alpina [alpine rockcress]
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          230   2e-71   Oryza brachyantha
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          230   4e-71   Cucumis sativus [cucumbers]
gb|AFK34557.1|  unknown                                                 230   5e-71   Medicago truncatula
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          230   5e-71   Sorghum bicolor [broomcorn]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               229   8e-71   Zea mays [maize]
ref|NP_001130603.1|  uncharacterized protein LOC100191702               228   8e-71   Zea mays [maize]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             229   9e-71   Eutrema salsugineum [saltwater cress]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               229   9e-71   Cucumis melo [Oriental melon]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               229   1e-70   Brassica rapa
gb|ACG36034.1|  reticulon                                               229   1e-70   Zea mays [maize]
emb|CDY08353.1|  BnaC09g12430D                                          229   1e-70   Brassica napus [oilseed rape]
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               228   1e-70   Populus euphratica
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          229   2e-70   Cicer arietinum [garbanzo]
dbj|BAJ94514.1|  predicted protein                                      229   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     227   2e-70   Eucalyptus grandis [rose gum]
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               228   4e-70   Brassica rapa
gb|EPS73616.1|  hypothetical protein M569_01145                         228   5e-70   Genlisea aurea
ref|NP_001185307.1|  reticulon-like protein B3                          228   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06999.1|  Reticulon-like protein B1                               226   1e-69   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          226   1e-69   Setaria italica
ref|NP_001130091.1|  uncharacterized protein LOC100191184               226   2e-69   Zea mays [maize]
ref|XP_010105716.1|  Reticulon-like protein                             226   2e-69   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             225   3e-69   Capsella rubella
gb|ABK22748.1|  unknown                                                 225   4e-69   Picea sitchensis
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               225   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               224   7e-69   Cucumis melo [Oriental melon]
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               224   1e-68   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               223   1e-68   
ref|NP_191715.2|  reticulon-like protein B6                             223   3e-68   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               223   3e-68   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          223   3e-68   
gb|EMT25698.1|  Reticulon-like protein B2                               222   5e-68   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      222   1e-67   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               221   1e-67   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               220   2e-67   
ref|XP_002876621.1|  reticulon family protein                           220   3e-67   
ref|XP_003592173.1|  Reticulon family protein                           220   4e-67   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               219   5e-67   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          219   5e-67   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               219   7e-67   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               218   1e-66   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             217   3e-66   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          218   3e-66   
gb|EMS50148.1|  Reticulon-like protein B2                               216   4e-66   
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    216   6e-66   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               216   6e-66   
gb|KJB52679.1|  hypothetical protein B456_008G272900                    216   1e-65   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          214   5e-65   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               214   6e-65   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               214   7e-65   
gb|KHN21799.1|  Reticulon-like protein B1                               212   3e-64   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          212   3e-64   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               211   7e-64   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    211   9e-64   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          224   1e-63   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               211   1e-63   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             209   5e-63   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          209   8e-63   
gb|KHN12926.1|  Reticulon-like protein B1                               209   9e-63   
gb|ABK23818.1|  unknown                                                 205   1e-62   
gb|EMS49910.1|  Reticulon-like protein B3                               210   2e-62   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               207   3e-62   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               206   5e-62   
gb|ABK26525.1|  unknown                                                 205   1e-61   
gb|EPS64109.1|  hypothetical protein M569_10676                         205   2e-61   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               204   6e-61   
gb|EPS69502.1|  hypothetical protein M569_05265                         203   6e-61   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               203   8e-61   
gb|EEC80692.1|  hypothetical protein OsI_23118                          215   2e-60   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               202   2e-60   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               201   1e-59   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          200   1e-59   
gb|EAY97489.1|  hypothetical protein OsI_19418                          199   6e-59   
ref|NP_001055164.1|  Os05g0312500                                       197   2e-58   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               197   2e-58   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          197   2e-58   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               196   4e-58   
ref|NP_001149072.1|  LOC100282693                                       196   6e-58   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 196   8e-58   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    195   9e-58   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    195   9e-58   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               195   1e-57   
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     192   1e-57   
dbj|BAK06264.1|  predicted protein                                      195   1e-57   
gb|EPS67049.1|  hypothetical protein M569_07727                         194   2e-57   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    194   5e-57   
ref|NP_001150935.1|  seed maturation protein                            193   6e-57   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                193   6e-57   
dbj|BAH20346.1|  AT4G11220                                              189   2e-56   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          192   3e-56   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               191   4e-56   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               191   8e-56   
ref|XP_002521590.1|  conserved hypothetical protein                     190   1e-55   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          190   1e-55   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    189   2e-55   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    189   2e-55   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          190   3e-55   
gb|EMS52545.1|  Reticulon-like protein B1                               189   4e-55   
ref|XP_002302126.2|  reticulon family protein                           189   5e-55   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    188   5e-55   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          189   6e-55   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               188   6e-55   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     189   6e-55   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             188   7e-55   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    188   1e-54   
ref|XP_007048924.1|  Reticulon family protein                           187   1e-54   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    187   2e-54   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               186   3e-54   
gb|ABC69764.1|  unknown                                                 184   7e-54   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         186   7e-54   
ref|NP_566371.1|  reticulon-like protein B8                             185   1e-53   
ref|XP_002306759.1|  reticulon family protein                           185   1e-53   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    185   1e-53   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               183   1e-53   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     184   2e-53   
ref|NP_850552.1|  reticulon-like protein B8                             184   3e-53   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               184   3e-53   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               184   3e-53   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             184   3e-53   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    184   3e-53   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    184   4e-53   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               183   4e-53   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     182   5e-53   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    183   6e-53   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               182   1e-52   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               182   1e-52   
emb|CDY41331.1|  BnaA01g31880D                                          182   1e-52   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             182   2e-52   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    182   2e-52   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               180   3e-52   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               181   3e-52   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              181   5e-52   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               180   8e-52   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   179   1e-51   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               179   1e-51   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          179   2e-51   
gb|ABK26009.1|  unknown                                                 179   2e-51   
emb|CDP18758.1|  unnamed protein product                                179   2e-51   
gb|KHN11998.1|  Reticulon-like protein B8                               179   3e-51   
ref|NP_001051461.1|  Os03g0781700                                       179   3e-51   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    178   4e-51   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               178   4e-51   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               178   5e-51   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          177   6e-51   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               177   6e-51   
gb|EAY92056.1|  hypothetical protein OsI_13754                          179   6e-51   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    178   6e-51   
emb|CDY56712.1|  BnaC01g38700D                                          181   7e-51   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    177   7e-51   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               177   1e-50   
emb|CDY00916.1|  BnaC05g42840D                                          177   1e-50   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    177   1e-50   
gb|EMT10142.1|  Reticulon-like protein B1                               178   1e-50   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               177   1e-50   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    177   1e-50   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               177   2e-50   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          177   2e-50   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               176   2e-50   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    176   3e-50   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          178   4e-50   
gb|KHG28741.1|  Reticulon-like protein B8                               176   4e-50   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               176   5e-50   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    176   5e-50   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    175   5e-50   
gb|ACG31942.1|  seed maturation protein                                 176   5e-50   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    176   6e-50   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         174   6e-50   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             175   6e-50   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          175   7e-50   
emb|CDY07184.1|  BnaCnng01990D                                          175   7e-50   
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          174   7e-50   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    175   8e-50   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             175   9e-50   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               175   9e-50   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               175   1e-49   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               174   1e-49   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                174   1e-49   
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               173   2e-49   
tpg|DAA51729.1|  TPA: seed maturation protein                           174   2e-49   
gb|ACG26944.1|  seed maturation protein                                 174   2e-49   
gb|EAY98925.1|  hypothetical protein OsI_20880                          173   3e-49   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    174   3e-49   
ref|NP_001137021.1|  seed maturation protein isoform 1                  174   3e-49   
ref|XP_010926506.1|  PREDICTED: reticulon-like protein B2               173   3e-49   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    173   3e-49   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    173   3e-49   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               172   4e-49   
ref|NP_001150885.1|  seed maturation protein                            172   4e-49   
gb|AFK34561.1|  unknown                                                 173   5e-49   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    173   6e-49   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    172   7e-49   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               172   1e-48   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               172   1e-48   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               172   1e-48   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               172   1e-48   
emb|CDP04019.1|  unnamed protein product                                171   4e-48   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               170   4e-48   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             171   4e-48   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    172   5e-48   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          169   5e-48   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    170   6e-48   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    170   6e-48   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580          169   6e-48   
ref|XP_006855801.1|  hypothetical protein AMTR_s00044p00221140          169   7e-48   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    170   8e-48   
dbj|BAK05980.1|  predicted protein                                      169   9e-48   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               169   9e-48   
gb|KDP35031.1|  hypothetical protein JCGZ_09319                         169   1e-47   
ref|XP_002884786.1|  reticulon family protein                           169   2e-47   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    170   2e-47   
ref|XP_010093192.1|  Reticulon-like protein                             169   2e-47   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             168   3e-47   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             167   3e-47   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               168   3e-47   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               168   4e-47   
ref|XP_009385406.1|  PREDICTED: reticulon-like protein B2 isoform X1    167   4e-47   
emb|CDY13240.1|  BnaC09g24160D                                          165   5e-47   
ref|NP_001058867.1|  Os07g0142000                                       167   6e-47   
gb|KHN28537.1|  Reticulon-like protein B8                               167   1e-46   
ref|NP_192032.1|  reticulon-like protein B7                             166   2e-46   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               166   2e-46   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    166   2e-46   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    167   2e-46   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     166   2e-46   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    166   3e-46   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             166   3e-46   
ref|XP_008240229.1|  PREDICTED: reticulon-like protein B9               165   3e-46   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    167   3e-46   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    165   4e-46   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                165   5e-46   
gb|KEH33647.1|  reticulon-like protein B2                               165   6e-46   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    164   1e-45   
ref|XP_010036908.1|  PREDICTED: reticulon-like protein B9               163   1e-45   
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             163   1e-45   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    166   1e-45   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    164   1e-45   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4               163   1e-45   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    166   1e-45   
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             163   2e-45   
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1    163   3e-45   
ref|XP_002872901.1|  reticulon family protein                           162   4e-45   
ref|XP_008374784.1|  PREDICTED: reticulon-like protein B9               162   4e-45   
emb|CDP00665.1|  unnamed protein product                                161   7e-45   
emb|CDM83893.1|  unnamed protein product                                161   8e-45   
ref|XP_001754332.1|  predicted protein                                  161   8e-45   
ref|XP_001783072.1|  predicted protein                                  162   9e-45   
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...    162   9e-45   



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNA
Sbjct  79   FGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIALAGLFLWSNA  138

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KSAPHIPEVHIPE+PVL+FASALRN++N  LAVLR+IASGRDLKMFL+VI GLW+
Sbjct  139  STFIHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMFLLVIGGLWL  198

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAV DAKVLSK
Sbjct  199  ASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVLDAKVLSK  258

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  259  IPRGPLKDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNA
Sbjct  79   FGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLFLWSNA  138

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KSAPHIPEVHIPE+PVL FASALRN++N  LAVLR+IASGRDLK FL+VI GLW+
Sbjct  139  STFIHKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVIGGLWL  198

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAVFDAKVLSK
Sbjct  199  ASILGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDAKVLSK  258

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  259  IPRGPLKDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CHGLI+ALA LFLWSNA
Sbjct  77   FGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLIVALAGLFLWSNA  136

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLK FLMVI GLWI
Sbjct  137  SAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKTFLMVIGGLWI  196

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA+HELKKQYAVFDAKVLSK
Sbjct  197  LSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKKQYAVFDAKVLSK  256

Query  210  IPRGPLKDKKLA  175
            IPRGPL+DKK A
Sbjct  257  IPRGPLRDKKKA  268



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            L GG  ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CH LI+ALA LFLWSNA
Sbjct  6    LFGGAAADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLWSNA  65

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLKMFLMVI GLWI
Sbjct  66   SAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGGLWI  125

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA HELKKQYAVFDAKVLSK
Sbjct  126  LSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKVLSK  185

Query  210  IPRGPLKDKKLA  175
            IPRGPL+DKK A
Sbjct  186  IPRGPLRDKKKA  197



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALAVLFLWSNA
Sbjct  59   LGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IP++PV++FA ALR ++N   AVLRDIASGR+LK FL VI GLW+
Sbjct  119  ATFINKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWV  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSK
Sbjct  179  LSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  239  IPRGPLKEKK  248



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA+LFLWSNA
Sbjct  69   LGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIPEVHIPEEPVLQ A+ALR ++N+  A+LRDIASGRDLK FL VI GLW+
Sbjct  129  STFINKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFLSVIAGLWV  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA  E+KKQYAVFDAKVLSK
Sbjct  189  LSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAVFDAKVLSK  248

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK A
Sbjct  249  IPRGPLKDKKKA  260



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNA
Sbjct  61   LGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV +PE+PVLQFAS  R  +N   A+LRD+ASGR+LK FL VI GLWI
Sbjct  121  STFINKSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWI  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GSCCDFLTL YI+ VLLHTVPV+Y+KYED+VD+FAEKA+ ELKKQYAVFD KVLSK
Sbjct  181  FSILGSCCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKVLSK  240

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  241  IPRGPLKDKK  250



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT VCH LI++LAVLFL+SNA
Sbjct  63   FGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTLVCHCLIVSLAVLFLYSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +F+ K+ P IPEV+IPE+PVLQFASALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  123  IAFMHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDIASGRDLKKFLAVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYIA VLLHTVPVLYEKYED+VD+FAEKAM E+KKQY +FDAKVLSK
Sbjct  183  LSIVGSWCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKAMAEIKKQYVIFDAKVLSK  242

Query  210  IPRGPLKDKKLA  175
            IP+GPLKDKK A
Sbjct  243  IPKGPLKDKKHA  254



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   283 bits (723),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA
Sbjct  61   LGGGKPADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K+ PHIPEVHIPE+PVLQFASALR ++N    +LR++ASG+DLK FL VI GLW+
Sbjct  121  TTFINKAPPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED VD+FAEKAM E+K+QYAVFDAKVLS+
Sbjct  181  VSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSR  240

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK+A
Sbjct  241  IPRGPLKDKKIA  252



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA
Sbjct  77   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNA  136

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWI
Sbjct  137  TTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWI  196

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            ISIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSK
Sbjct  197  ISIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSK  256

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  257  IPRGPLKDKK  266



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   280 bits (717),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLFLWSNA
Sbjct  66   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV+IPEEPVLQ A ALR+++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  126  STFINKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTLFYI  VLL+TVPV YEKYED+VD+ AEKA+ ELKKQYAV DAKVLSK
Sbjct  186  LSIVGSWVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVLDAKVLSK  245

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  246  IPRGPLKDKK  255



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA
Sbjct  74   FGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNA  133

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI
Sbjct  134  TTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWI  193

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI+ VLLHT+PVLYEKYED+VD  AEKAMHE+KKQYAVFDAKVLSK
Sbjct  194  LSIVGSWCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSK  253

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  254  IPRGPLKDKK  263



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA
Sbjct  75   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNA  134

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWI
Sbjct  135  TTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWI  194

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSK
Sbjct  195  LSIVGSWCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSK  254

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  255  IPRGPLKDKK  264



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ VCH LIL+LA+LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSLVCHCLILSLAILFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IPE  IPE+  +  A +LR ++N   AVLR+IASGRDLK FL+VI GLW+
Sbjct  123  STFINKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREIASGRDLKKFLVVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFY  +V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSK
Sbjct  183  LSILGSCCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYGVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPR PLKDKK
Sbjct  243  IPRSPLKDKK  252



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNA
Sbjct  46   LGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNA  105

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW+
Sbjct  106  STFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWV  165

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSK
Sbjct  166  LSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSK  225

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  226  IPKGPLKDKK  235



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA
Sbjct  72   FGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI
Sbjct  132  TTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWI  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI+ VLLHTVPV+YEKYED+VD  AEKAMHE+KKQYAVFD KVLSK
Sbjct  192  LSIVGSWCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSK  251

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  252  IPRGPLKDKK  261



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNA
Sbjct  64   LGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEVHIPE+P LQ  +ALR ++N   AVLRDIASGRDLK FL++I GLW+
Sbjct  124  TTFINKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDLKKFLIIIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  VLLHTVPV+YEKYED +D FAEKA  E+KKQYAVFDAKVLSK
Sbjct  184  LSILGSCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKATIEIKKQYAVFDAKVLSK  243

Query  210  IPRGPLKDKKLA  175
            IP+ PLK KK+A
Sbjct  244  IPKVPLKYKKMA  255



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   278 bits (710),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNA
Sbjct  64   LGGGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ PHIPEV IPE+  +  A +LR ++N   A+LRDIASGRDLK FL VI GLW+
Sbjct  124  STFISKTPPHIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDLKKFLAVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD FAEKAM E+KKQY VFDAKVLSK
Sbjct  184  LSILGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSK  243

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  244  IPRGPLKDKK  253



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K  PHIPEV IPE+  +  A +LR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  124  STFINKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDLKKFLAVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSK
Sbjct  184  LSILGSCCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSK  243

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  244  IPRGPLKDKK  253



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA
Sbjct  72   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL VI GLW+
Sbjct  132  TTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVIAGLWV  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+VLSK
Sbjct  192  LSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLSK  251

Query  210  IPRGPLKDKKLA  175
            IP+GPLKDKK A
Sbjct  252  IPKGPLKDKKKA  263



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT VCH +ILALA LFLWSNA
Sbjct  63   LGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K  P IP+VHIPE+P+LQFASALR ++N   +VLRDIASGRDLK FL VI GLW+
Sbjct  123  STFINKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GS  +FLTLFYIA VLLHTVPVLYEKYED+VD+F EKA+ E+KKQYAVFDAKVLSK
Sbjct  183  FSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNA
Sbjct  69   LGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW+
Sbjct  129  STFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWV  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSK
Sbjct  189  LSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSK  248

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  249  IPKGPLKDKK  258



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+VHIPE+PVL+FASALR ++N   A+LRDIASGRDLK FL VI GLW+
Sbjct  123  STFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GS  +FLTLFYIA VLLHTVPVLYEKYED VD+F  KA+ E+KKQYAVFDAKVLSK
Sbjct  183  FSILGSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  243  IPRGPLKDKK  252



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNA
Sbjct  62   LGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  122  STFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSK
Sbjct  182  FSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSK  241

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  242  IPRGPLKDKK  251



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  123  STFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSK
Sbjct  183  FSILGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  243  IPRGPLKDKK  252



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLFLWSNA
Sbjct  66   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW+
Sbjct  126  STFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSK
Sbjct  186  VSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSK  245

Query  210  IPRGPLKDKKLA  175
            IPR  LKDKK A
Sbjct  246  IPRS-LKDKKKA  256



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA
Sbjct  71   LGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+
Sbjct  131  TTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSK
Sbjct  191  FSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSK  250

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  251  IPRGPLKDKK  260



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA
Sbjct  61   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLMVI GLW+
Sbjct  121  TTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGSCC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSK
Sbjct  181  LSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSK  240

Query  210  IPRGPLKDK  184
            IPRGPLK K
Sbjct  241  IPRGPLKKK  249



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEVHIPEEPVLQ A+ALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  123  STFINKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDIASGRDLKKFLTVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSK
Sbjct  183  LSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  243  IPRGPLKDKK  252



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   276 bits (705),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA
Sbjct  71   LGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+
Sbjct  131  TTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSK
Sbjct  191  FSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSK  250

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  251  IPRGPLKDKK  260



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLFLWSNA
Sbjct  66   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW+
Sbjct  126  STFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSK
Sbjct  186  VSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSK  245

Query  210  IPRGPLKDKKLA  175
            IPR  LKDKK A
Sbjct  246  IPRS-LKDKKKA  256



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA
Sbjct  71   LGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+
Sbjct  131  TTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSK
Sbjct  191  FSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSK  250

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  251  IPRGPLKDKK  260



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI K+ P I EV IP++  +  A +LR ++N  +AVLR+I SG+DLK FL VI GLW+
Sbjct  123  SIFINKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDLKKFLAVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            + ++GSCC+F+TLFYI VV LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSK
Sbjct  183  LLVLGSCCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKAMTEIKKQYKVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPR PLKDKK
Sbjct  243  IPREPLKDKK  252



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNA
Sbjct  63   LGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW+
Sbjct  123  STFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSK
Sbjct  183  LSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSK  242

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKKL
Sbjct  243  IPRGPLKDKKL  253



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGG  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSNA
Sbjct  61   LGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV IPE+  +  A +LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  121  STFIHKSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASGRDLKKFLVVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGSCC+FLTLFYIA V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSK
Sbjct  181  LSIVGSCCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTEVKKHYATFHAKCLSK  240

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  241  IPRGPLKEKK  250



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW+
Sbjct  123  STFINKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSK
Sbjct  183  LSILGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  243  IPRGPLKDKK  252



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA
Sbjct  62   LGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS+PHIPEV IPE+  +  A +LR ++N   AVLRDIASGR+LK FLMVI GLW+
Sbjct  122  STFINKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDIASGRELKKFLMVIAGLWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+CC+FLTLFYI  V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSK
Sbjct  182  LSIIGTCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKVMAEIKKHYATFHAKCLSK  241

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  242  IPRGPLKEKK  251



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA
Sbjct  72   FGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEVH+PEEP+L+ ASALR ++N+ L VLR+IASGRDL  FL VI GLW+
Sbjct  132  TTFINKKRPHIPEVHLPEEPILEIASALRIEINYTLRVLREIASGRDLTKFLSVIAGLWV  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD   EKA+ E+KKQYAVFDAKVLSK
Sbjct  192  LSVLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLVEKAVKEIKKQYAVFDAKVLSK  251

Query  210  IPRGPLKDKKLA  175
            IP+GPL+DKK A
Sbjct  252  IPKGPLRDKKKA  263



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 166/196 (85%), Gaps = 4/196 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA
Sbjct  72   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM----VIT  403
            ++FI K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL     VI 
Sbjct  132  TTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVNCSVIA  191

Query  402  GLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAK  223
            GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+
Sbjct  192  GLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDAR  251

Query  222  VLSKIPRGPLKDKKLA  175
            VLSKIP+GPLKDKK A
Sbjct  252  VLSKIPKGPLKDKKKA  267



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++LFLWSNA
Sbjct  67   FGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV +PE+P L+ AS LR ++N   AVLR+IASGRDLK FLMV+ GLW 
Sbjct  127  TTFINKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMVVVGLWA  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  +LLHTVPVLYEKY+D++DAFAEKAM ++KKQYAVFDAKVLSK
Sbjct  187  LSIVGSFCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAVFDAKVLSK  246

Query  210  IPRGPLKDKK  181
            IPRGPL  K+
Sbjct  247  IPRGPLGKKR  256



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW+
Sbjct  123  STFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSK
Sbjct  183  LSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  243  IPRGPLKDKK  252



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  59   LGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++F+ KS P IPEV IP++PV++FA ALR ++N   AVLRDIASGRDLK FL VI GLWI
Sbjct  119  ATFVNKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWI  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVL K
Sbjct  179  LSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLRK  238

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  239  IPRGPLKEKK  248



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IP+VHIPEEPVLQ A+ALR ++N   AVLRDIASG+DLK FL VI GLW+
Sbjct  124  STFINKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E KKQYAVFDAKVLSK
Sbjct  184  LSIVGSWANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVFDAKVLSK  243

Query  210  IPRGPLKDKK  181
            IP+G LK+KK
Sbjct  244  IPKGALKNKK  253



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA
Sbjct  62   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW+
Sbjct  122  TTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSK
Sbjct  182  LSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSK  241

Query  210  IPRGPLKDKK  181
            IP+G LK+KK
Sbjct  242  IPKGALKEKK  251



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNA
Sbjct  56   LGAGKPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNA  115

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV +PE+ VL+ ASALR +VN  L V+RDIASG DLK FL VI GLW 
Sbjct  116  STFINKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDIASGNDLKKFLGVIVGLWA  175

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG+CC+FLTLFYI  VLLHTVPV YE YED+VD+F+EKA+ E+KKQYA FD KVLSK
Sbjct  176  LSLVGNCCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSK  235

Query  210  IPRGPLKDKK  181
            IP+GPLK+KK
Sbjct  236  IPKGPLKEKK  245



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWSNA
Sbjct  57   LGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWSNA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IP+V IPE PVL+ ASAL+ ++N  LA LR+IASG+DLK FL VI GLWI
Sbjct  117  STFINKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDLKKFLAVIAGLWI  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GSCC+FLTLFYI  V+LHT+PVLYEKYED+VDAFAEKAM E+KKQY VFDAKVLSK
Sbjct  177  FSILGSCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKAMIEIKKQYIVFDAKVLSK  236

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK A
Sbjct  237  IPRGPLKDKKAA  248



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LIL LAVLFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEV IPEEPVLQFASALR ++N   AVLRDIASG+DLK FL+VI GLW+
Sbjct  124  HAFIHKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWL  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI G+ C+FLTLFYI  VLLHTVPVLYEK+ED++D FAE+AM ELKKQYAVFDAKVLSK
Sbjct  184  LSIAGNWCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKVLSK  243

Query  210  IPRGPLKDKKLA  175
            IP GPLKDKK A
Sbjct  244  IPLGPLKDKKKA  255



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LFLWSNA
Sbjct  65   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W+
Sbjct  125  HTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSK
Sbjct  185  LSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAVFDAKVLSK  244

Query  210  IPRGPLKDKKL  178
            IP GPLK KK+
Sbjct  245  IPMGPLKAKKV  255



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA
Sbjct  64   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+DLK FL V+ GLWI
Sbjct  124  TTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDLKKFLAVVAGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDA+VLSK
Sbjct  184  LSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMQEIKKQYAVFDARVLSK  243

Query  210  IPRGPLKDKKLA  175
            IP GPLKDKK A
Sbjct  244  IPIGPLKDKKNA  255



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNA
Sbjct  64   LGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V +PE+ VL  A+ALR ++N  L V RDIASG++LK FL VI GLW+
Sbjct  124  STFINKSPPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIASGKELKKFLGVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSK
Sbjct  184  LSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSK  243

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKKL
Sbjct  244  IPRGPLKDKKL  254



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FLWSNA
Sbjct  68   LGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV + E+ V+  A+ALR + N   A+LRDI SG+DLK FL VI GLW+
Sbjct  128  SSFINKSPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGKDLKKFLAVIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSC +FLTLFYI  VLLHTVP+LYEKY+D++DAFAEKA  ELKKQYAVFDAKVLSK
Sbjct  188  LSMLGSCFNFLTLFYICFVLLHTVPLLYEKYDDQIDAFAEKAEAELKKQYAVFDAKVLSK  247

Query  210  IPRGPLKDKKL  178
            IP+GPLKDKK 
Sbjct  248  IPKGPLKDKKF  258



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   265 bits (677),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LFLWSNA
Sbjct  65   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W+
Sbjct  125  HTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSK
Sbjct  185  LSIVGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEIKKQYAVFDAKVLSK  244

Query  210  IPRGPLKDKKL  178
            IP GPLK KK+
Sbjct  245  IPMGPLKAKKV  255



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN 
Sbjct  67   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNV  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W+
Sbjct  127  HTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSK
Sbjct  187  LSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSK  246

Query  210  IPRGPLKDKKL  178
            IP GPLK KK+
Sbjct  247  IPTGPLKSKKV  257



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA
Sbjct  62   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW+
Sbjct  122  TTFINKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSK
Sbjct  182  LSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSK  241

Query  210  IPRGPLKDKKLA*DCNSVWCHYVRMCN*SLKNLCFSVIYQQTCWICH  70
            IP+G LK +     C   +C +V  C      +  S++ + + W  H
Sbjct  242  IPKGALKRRS---SCR--FCQFVASCGFLCVVVTLSILLRTSTWCMH  283



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNA
Sbjct  64   LGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW+
Sbjct  124  STFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSK
Sbjct  184  LSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSK  243

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  244  IPRGPLKDKKF  254



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA
Sbjct  72   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+D K FL V+TGLWI
Sbjct  132  TTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDPKKFLAVVTGLWI  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYA+FDAKVLSK
Sbjct  192  LSVVGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAIFDAKVLSK  251

Query  210  IPRGPLKDKKLA  175
            IP GPLKDKK A
Sbjct  252  IPIGPLKDKKNA  263



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA
Sbjct  123  LGGGKPADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNA  182

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP VHIPEEP+LQFASAL  ++N   A LR I SGRDLK FL+VI G WI
Sbjct  183  HTFIHKAPPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWI  242

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            ISIVGS C+FLTLFYIA VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSK
Sbjct  243  ISIVGSWCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEKVLSK  302

Query  210  IPRGPLKDKKLA  175
            IP+GPLK+KKLA
Sbjct  303  IPKGPLKEKKLA  314



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 159/194 (82%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLFLWSNA
Sbjct  65   LGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IPEVHIPEE VLQ AS LR ++N   A LRDIASGRDLK FLMVI GLW+
Sbjct  125  STFIHKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVIAGLWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL--  217
            +SI+GSCC+F+TLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQY V D KVL  
Sbjct  185  LSILGSCCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDEKVLSK  244

Query  216  --SKIPRGPLKDKK  181
              SKIPRG L  KK
Sbjct  245  IMSKIPRGALSKKK  258



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNA
Sbjct  59   LGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS+P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW+
Sbjct  119  SSFINKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWL  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK
Sbjct  179  LSVLGSCCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  239  VPRGPLKDKK  248



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  61   FGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS PHIPEV IP+EPVL+F  ALR ++N   AVLRDIA GRDLKMFL VI GLW+
Sbjct  121  TQFINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSK
Sbjct  181  LSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSK  240

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  241  IPRGPLKQKK  250



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++FLWSNA
Sbjct  65   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEVH+PEEP LQ A+AL  ++N  L +LRDIASGR+LK FLMVI   W+
Sbjct  125  HTFIHKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNLKKFLMVIAAFWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI+ VLLHTV VLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSK
Sbjct  185  LSIVGSWCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKAMIEIKKQYAVFDAKVLSK  244

Query  210  IPRGPLKDKKL  178
            IP+GPLK KK+
Sbjct  245  IPKGPLKTKKV  255



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWSN 
Sbjct  61   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNV  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W+
Sbjct  121  HTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAFWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDAKVL K
Sbjct  181  LSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDAKVLGK  240

Query  210  IPRGPLKDKKL  178
            IP GPLK KK+
Sbjct  241  IPTGPLKTKKV  251



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNA
Sbjct  67   LGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLW+
Sbjct  127  STFINKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWL  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTLFYI  V L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  187  LSVLGSCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEKCLSK  246

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  247  IPKGPLKDKK  256



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNA
Sbjct  93   LGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNA  152

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W+
Sbjct  153  SSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWL  212

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK
Sbjct  213  LSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEIKKQYAVFDEKVLSK  272

Query  210  IPRGPLKDKK  181
            +PRGP KDKK
Sbjct  273  VPRGPAKDKK  282



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNA
Sbjct  89   LGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNA  148

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW+
Sbjct  149  SSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWL  208

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK
Sbjct  209  LSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSK  268

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  269  VPRGPLKDKK  278



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWSNA
Sbjct  57   FGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWSNA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS   IPEVHIP++PV++FA ALR + N    VLRDIA GRDLK FL VI GLWI
Sbjct  117  YAFINKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDLKKFLYVIAGLWI  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+F+TLFY+  VLLH+VPVLYEKYED+VD FAEKAMHE+KKQ AVF+AKVLSK
Sbjct  177  LSIVGSWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAEKAMHEIKKQCAVFNAKVLSK  236

Query  210  IPRGPLKDK  184
            IPRGP K+K
Sbjct  237  IPRGPSKEK  245



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++FLWSNA
Sbjct  67   LGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIMFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPEV IPE+  +  A +LR ++N   A LRDIA GRDLK FL VI GLW+
Sbjct  127  STFINKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDLKKFLSVIAGLWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+G+ C+FLTLFYIA V LHTVP LYEKYED+VDAFAEKA  E KK Y+V  AK LSK
Sbjct  187  FSIIGNFCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFAEKAQTEFKKHYSVIHAKYLSK  246

Query  210  IPRGPLKDKKL  178
            IP+GPLKDKK 
Sbjct  247  IPKGPLKDKKF  257



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 160/194 (82%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLFLWSNA
Sbjct  65   LGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IP VHIPEEPV+Q AS LR +VN     LRDIASGRDLK FL+VI+GLW+
Sbjct  125  STFIHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVISGLWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSCC+F+TLFYIA VLL TVPVLYEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  185  LSILGSCCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDEKVLSK  244

Query  222  VLSKIPRGPLKDKK  181
            V+SKIPRG L  KK
Sbjct  245  VMSKIPRGALTKKK  258



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNA
Sbjct  93   LGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNA  152

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI K+ P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W+
Sbjct  153  SSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWL  212

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK
Sbjct  213  LSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSK  272

Query  210  IPRGPLKDKK  181
            +PRGP KDKK
Sbjct  273  VPRGPAKDKK  282



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWSNA
Sbjct  59   LGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIPEV IPEEPVLQ A+AL  ++N   +VLRDIASGRDLK FL VI GLW+
Sbjct  119  STFINKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDLKKFLSVIAGLWV  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSK
Sbjct  179  LSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  239  IPRGPLKGKK  248



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI +L VLFLWSNA
Sbjct  96   LGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLIFSLGVLFLWSNA  155

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R+++N   A LR+IA GRD+K FL+VI GLW+
Sbjct  156  SSFINKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDIKKFLIVIAGLWL  215

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQY+VFDAKVLSK
Sbjct  216  LSILGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKKQYSVFDAKVLSK  275

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  276  VPRGPLKDKK  285



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNA
Sbjct  62   LGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW+
Sbjct  122  STFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----K  223
            +SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     K
Sbjct  182  LSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKK  241

Query  222  VLSKIPRGPLKDK  184
            VLS+IP+G LK K
Sbjct  242  VLSRIPKGALKKK  254



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP+VHIPEEPVLQ ASAL  ++NH  AVLR IASG+DLK FL+VI   W 
Sbjct  123  HTFINKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAFWA  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG  C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAM E+KKQYA+FDAKVLSK
Sbjct  183  LSIVGCWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAMFDAKVLSK  242

Query  210  IPRGPLKDKKL  178
            IP G LK K++
Sbjct  243  IPVGALKAKRV  253



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNA
Sbjct  62   LGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW+
Sbjct  122  STFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----K  223
            +SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     K
Sbjct  182  LSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKK  241

Query  222  VLSKIPRGPLKDK  184
            VLS+IP+G LK K
Sbjct  242  VLSRIPKGALKKK  254



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  80   LGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  139

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW+
Sbjct  140  TMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDLKKFLSAIAGLWV  199

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP+LY+KYED+VD++ EKAM ELKKQYAV DAKVLSK
Sbjct  200  LSILGGCCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSK  259

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  260  IPRGPLKDKK  269



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  CH LI+ LAVLFLWSNA
Sbjct  76   LGGGKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNA  135

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI KS P IPEVHIPEE +LQ AS LR ++N     LRDIASGRDLK FL  I GLW+
Sbjct  136  SIFINKSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWV  195

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS C+FLTL YIA+V+L TVPV+YEKYED+VDAF EKAM E+KKQYAV D KV SK
Sbjct  196  LSVIGSWCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMVEIKKQYAVLDEKVFSK  255

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  256  IPRGPLKDKK  265



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT VC+ LILALA+LFLWSNA
Sbjct  59   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTLVCYFLILALALLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW+
Sbjct  119  STFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDIASGRDLKKFLTVIAGLWV  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYIA VLL+TVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSK
Sbjct  179  LSIVGSWCNFLTLFYIAFVLLYTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            IP GPLK KK
Sbjct  239  IPMGPLKGKK  248



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  61   FGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS PHIPEV IP+EPVL+FA ALR ++N   AVLRDIA GRDLKMFL VI GLW+
Sbjct  121  TQFINKSTPHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  V+LHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSK
Sbjct  181  LSIVGSWCNFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSK  240

Query  210  IPRGPLKDKK  181
            IP GPLK KK
Sbjct  241  IPMGPLKQKK  250



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA
Sbjct  60   LGGGKPADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PHIPEV IPE+  +  A +LR ++N   AVLR+IA+GRD+K FL VI GLW+
Sbjct  120  TTFINKSPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G+CC+FLTLFYIA V LHTVP LY+KYED+VD+FAEKA  E KK YAV  AK LSK
Sbjct  180  LSVIGNCCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKATVEFKKHYAVIHAKYLSK  239

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK+
Sbjct  240  IPRGPLKDKKV  250



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  72   FGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAILFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV + EEP LQ A+A+R ++N  LAVLR+IASGRDLK FL V++GLW 
Sbjct  132  TTFINKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDLKKFLAVVSGLWF  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GS C+FLTLFYI  VLLHT+PVLYEKYED+VD+FAEKAM E++K+YAVFD KVLSK
Sbjct  192  FSILGSYCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIEIRKKYAVFDEKVLSK  251

Query  210  IPRGPLKDKKLA  175
            IPRGP KDKK A
Sbjct  252  IPRGPSKDKKRA  263



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLWSNA
Sbjct  64   LGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP++H+PEEP L  ASAL  ++N  LAVLRDIASG+DLK FL+VI  LW+
Sbjct  124  HTFINKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAALWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSK
Sbjct  184  VSIVGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDAKVLSK  243

Query  210  IPRGPLKDKKL  178
            IP G LK K++
Sbjct  244  IPVGALKAKRV  254



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNA
Sbjct  212  LGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNA  271

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW+
Sbjct  272  STFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWV  331

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAE A  E+KKQYAVF+ KVLSK
Sbjct  332  LSILGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAENAEAEIKKQYAVFNVKVLSK  391

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  392  IPRGPLKDKKF  402



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +AVLFLWSNA
Sbjct  76   LGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIAVLFLWSNA  135

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW+
Sbjct  136  SMFIHKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWV  195

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC+FLTL YIA+V+L T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVLSK
Sbjct  196  LSILGGCCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKAMVEIKKQYAVLDEKVLSK  255

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  256  IPRGPLKGKK  265



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNA
Sbjct  66   FGGGKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI KS PHIP+VHIPE+PV++ ASALR ++N  +AVLRDIASGRDLK FL  I GLW+
Sbjct  126  SFFINKSLPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDLKSFLYAIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GS  +FLTL YI V++L TVPV YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSK
Sbjct  186  LSILGSWFNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSK  245

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK+A
Sbjct  246  IPRGPLKDKKIA  257



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNA
Sbjct  89   LGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNA  148

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW+
Sbjct  149  SSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWL  208

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK
Sbjct  209  LSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSK  268

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  269  VPRGPLKDKK  278



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 163/218 (75%), Gaps = 29/218 (13%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA
Sbjct  61   LGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM-------  412
            ++FI KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLM       
Sbjct  121  TTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVCCSVFL  180

Query  411  ----------------------VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKY  298
                                  VI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKY
Sbjct  181  SNVSGSWSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKY  240

Query  297  EDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  184
            ED+VD+FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  241  EDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  278



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNA
Sbjct  61   LGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLW+
Sbjct  121  STFINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSK
Sbjct  181  LSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEKCLSK  240

Query  210  IPRGPLKDKK  181
            IP+GPLK+KK
Sbjct  241  IPKGPLKNKK  250



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L VLFLWSNA
Sbjct  89   LGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGVLFLWSNA  148

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FLMVI GLW+
Sbjct  149  SSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGRDIKKFLMVIAGLWL  208

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+ LTL YI  V+LHTVPVLYEKYED++D + EK   E+KKQYAVFD KVLSK
Sbjct  209  LSVLGSCCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEIKKQYAVFDEKVLSK  268

Query  210  IPRGPLKDKK  181
            +PRGP KDKK
Sbjct  269  VPRGPAKDKK  278



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWSNA
Sbjct  60   LGGGKPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++ I KS PHIP V IPE+  +  + +L  ++N   +VLR+IA+GR+LK FL VI GLWI
Sbjct  120  TTLINKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGRELKKFLAVIAGLWI  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYIA V LHTVP LY+KYED VD FAEKA  E KK YAVF AK LSK
Sbjct  180  LSIIGSCCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAEKATVEFKKHYAVFHAKCLSK  239

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  240  IPRGPLKDKKF  250



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNA
Sbjct  67   LGGGKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV I E+  +  A +LR ++N   A LR+I  GRDLK FL+VI G W+
Sbjct  127  STFINKSPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGFWL  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTLFYI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  187  LSVLGSCCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSK  246

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  247  IPKGPLKDKK  256



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VLGGATA W+LFE+LEYH LT VCH LIL+L++LFLWSNA
Sbjct  62   LGGGKPADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTLVCHCLILSLSLLFLWSNA  121

Query  570  SSFIKKSAphipevhi--peepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGL  397
            ++FI KS        +  PE+PVLQFASALR ++N   +VLRDIASGRDLK FL+VI GL
Sbjct  122  TTFINKSQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVLRDIASGRDLKKFLVVIAGL  181

Query  396  WIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL  217
            W++SIVGS C+FLTLFYI  VLLHTVPV YEKYED+VD+FAEKAM E+KKQY VFDAKVL
Sbjct  182  WVLSIVGSWCNFLTLFYIVFVLLHTVPVFYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVL  241

Query  216  SKIPRGPLKDKKLA  175
            SKIPRGPLKDKK A
Sbjct  242  SKIPRGPLKDKKRA  255



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNA
Sbjct  68   LGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V + E  VL  ASALR ++N    +LRDIASGRDLKMFL VI  LWI
Sbjct  128  STFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKMFLGVIAVLWI  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSK
Sbjct  188  VSLVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSK  247

Query  210  IPRGPLKDKK  181
            IP+GPLK+KK
Sbjct  248  IPKGPLKEKK  257



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  60   FGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  120  ATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIVGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SIVGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA HE+KKQYAVFDAKVLSK
Sbjct  180  SSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKAWHEIKKQYAVFDAKVLSK  239

Query  210  IPRGPLKDKK  181
            IP+ PLK+KK
Sbjct  240  IPKRPLKEKK  249



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   258 bits (660),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN+ IS GVLGG TAIWILFE L YHLLT VCHGLI +L VLFLWSNA
Sbjct  88   LGGGKPADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCHGLIFSLGVLFLWSNA  147

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R ++N     LR IA GRD+K FLMVI GLW+
Sbjct  148  SSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALGRDIKKFLMVIAGLWL  207

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK
Sbjct  208  LSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSK  267

Query  210  IPRGPLKDKK  181
            +PRGP KDKK
Sbjct  268  VPRGPAKDKK  277



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  80   LGGGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  139

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ  S LR ++N   + LR+IASGRDLK FL  I GLW+
Sbjct  140  TMFIHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGRDLKKFLSAIAGLWV  199

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP+ Y+KYED+VDA+ EKAM ELKKQYAVFDAKVLSK
Sbjct  200  LSILGGCCSFLTLAYIALVLLFTVPLFYDKYEDKVDAYGEKAMAELKKQYAVFDAKVLSK  259

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  260  IPRGPLKDKK  269



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNA
Sbjct  63   LGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI  + P IPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW+
Sbjct  123  SAFINTAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G+  +FLTLFYI  VLLHTVP+LYEKYED+VDAFAEKA  E+KK YAVFDA VLSK
Sbjct  183  VSVLGNIWNFLTLFYIVFVLLHTVPLLYEKYEDKVDAFAEKAEAEIKKHYAVFDANVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  243  IPRGPLKGKK  252



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGG+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNA
Sbjct  63   LGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FIKKS P IP V IPEEPVL FASALR  +N   A LRDIASG+DLK FL VI GLW+
Sbjct  123  STFIKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDIASGKDLKKFLSVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S  GSCCDFLTL Y   VLL TVP++Y+KYED+VD FAEKAM E+KKQYAVF+ KVLSK
Sbjct  183  LSFFGSCCDFLTLLYSITVLLFTVPLVYDKYEDQVDCFAEKAMVEIKKQYAVFNTKVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  243  IPRGPLKEKK  252



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNA
Sbjct  66   FGGGKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI KS PHIP+VHIPE PV++ ASALR ++N  +AVLR+IASGRDLK FL  I GLW+
Sbjct  126  SFFINKSLPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDLKSFLYAIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTL YI V++L TVP+ YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSK
Sbjct  186  LSIVGSWFNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSK  245

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK+A
Sbjct  246  IPRGPLKDKKIA  257



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 155/190 (82%), Gaps = 6/190 (3%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEV IPEEP L+FASALR ++NH  AVLRDIASGRDLK FL V+ GLWI
Sbjct  117  MTFINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDLKKFLSVVAGLWI  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG CCDFLTL Y   VLL TVP+ YEKYED+VD+FAEKAM E+KKQY VFDA+VLSK
Sbjct  177  LSVVGGCCDFLTLLYTITVLLFTVPLFYEKYEDQVDSFAEKAMAEVKKQYVVFDARVLSK  236

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  237  IPRGPLKDKK  246



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VCH LI+A+ VLFLWSNA
Sbjct  69   LGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAITVLFLWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI  + P IPEV +P + VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW+
Sbjct  129  SAFINTAPPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIASGKDLKKFLVVILGLWV  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+C +FLTLFYI  VLLHTVPVLY+KYED+VDAFAEKA  E+KK YAVF+ +VLSK
Sbjct  189  VSILGNCWNFLTLFYIVFVLLHTVPVLYDKYEDKVDAFAEKAEAEIKKHYAVFNDQVLSK  248

Query  210  IPRGPLKDKKLA  175
            IPRGPL+DK+LA
Sbjct  249  IPRGPLRDKRLA  260



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNA
Sbjct  57   LGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI
Sbjct  117  SAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWI  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSK
Sbjct  177  LSFLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSK  236

Query  210  IPRGPLKDKK  181
            IP+GP KDKK
Sbjct  237  IPKGPSKDKK  246



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +CH LIL LA+LFLWSN 
Sbjct  101  LGGGKPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCHCLILTLALLFLWSNG  160

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PHIPEV IPE+     A +LR ++N   +VLRDIASGRDLKMFL V+ GLW+
Sbjct  161  TAFINKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASGRDLKMFLTVVAGLWV  220

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM E+KKQYAVFDAKVLSK
Sbjct  221  LSILGSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIEIKKQYAVFDAKVLSK  280

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  281  IPRGPLKSKK  290



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL +
Sbjct  123  SNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SK
Sbjct  183  LSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISK  242

Query  210  IPRGPLKDKK  181
            IPRGP K+KK
Sbjct  243  IPRGPFKEKK  252



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT VC+ LI++LA+LFLWSNA
Sbjct  64   LGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTLVCYTLIVSLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEVHIPE+P LQ  SAL  ++N   A LR IASGRDLK FL+VI GLW+
Sbjct  124  HTFIHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSIASGRDLKKFLIVIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +FLTLFYI+VVLLHTVPVLYEKYED++D  AEKA+ ELKKQY VFD KVLSK
Sbjct  184  LSIVGSWANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKALIELKKQYTVFDEKVLSK  243

Query  210  IPRGPLKDKKLA  175
            IP+GPLK KK A
Sbjct  244  IPKGPLKGKKRA  255



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNA
Sbjct  96   LGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNA  155

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW+
Sbjct  156  SSFINKSPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWL  215

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK
Sbjct  216  LSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSK  275

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  276  VPRGPLKDKK  285



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI  + PHIPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLWI
Sbjct  123  SAFINTAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+  +FLTLFYI  VLLHTVPVLYEK+ED+VDA AEKA  E+KK YAVFDA VLSK
Sbjct  183  VSILGNIWNFLTLFYIVFVLLHTVPVLYEKHEDKVDAVAEKAEAEIKKHYAVFDANVLSK  242

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  243  IPRGPLKGKK  252



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KKIS  VLG  TAIW+LFE+LEY+LLT VCH LILALAVLFLWSNA
Sbjct  65   LGGGKPADVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTLVCHILILALAVLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P  PEV +PE+ VL  ASALR +VN  LA LR+IASGRDLK FL VI GLW+
Sbjct  125  STFINKSPPQFPEVILPEDIVLGVASALRIEVNRALAALREIASGRDLKKFLAVIAGLWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SI+GSCC+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA  E+KKQYAVF+AKVLSK
Sbjct  185  FSILGSCCNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKAEAEIKKQYAVFNAKVLSK  244

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  245  IPRGPLKDKKF  255



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNA
Sbjct  74   LGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNA  133

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V + E  VL  ASALR ++N    +LRDIASGRDLK FL VI  LWI
Sbjct  134  STFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKTFLGVIAILWI  193

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSK
Sbjct  194  LSVVGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSK  253

Query  210  IPRGPLKDKK  181
            IP+GPLK+KK
Sbjct  254  IPKGPLKEKK  263



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNA
Sbjct  72   LGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNA  131

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL +
Sbjct  132  SNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLV  191

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SK
Sbjct  192  LSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISK  251

Query  210  IPRGPLKDKK  181
            IPRGP K+KK
Sbjct  252  IPRGPFKEKK  261



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS A
Sbjct  70   LGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYA  129

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI
Sbjct  130  STFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWI  189

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSK
Sbjct  190  LSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSK  249

Query  210  IPRGPLKDKK  181
            IPRGP+K+KK
Sbjct  250  IPRGPVKEKK  259



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNA
Sbjct  100  LGGGKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNA  159

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW+
Sbjct  160  SSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWL  219

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK
Sbjct  220  LSILGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSK  279

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  280  VPRGPLKDKK  289



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  76   LGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  135

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI
Sbjct  136  TMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWI  195

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSK
Sbjct  196  LSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSK  255

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  256  IPRGPLKDKK  265



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA
Sbjct  68   FGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW+
Sbjct  128  HSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSK
Sbjct  188  LSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSK  247

Query  210  IPRGPLKDKK  181
            IP+G LK+K+
Sbjct  248  IPQG-LKNKR  256



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA
Sbjct  61   LGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            +  I KS PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW+
Sbjct  121  TFLINKSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSK
Sbjct  181  LSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSK  240

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  241  IPRGPLKDKKF  251



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  74   LGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  133

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW+
Sbjct  134  TMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWV  193

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSK
Sbjct  194  LSILGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSK  253

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  254  IPRGPLKNKK  263



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS A
Sbjct  59   LGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI
Sbjct  119  STFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWI  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSK
Sbjct  179  LSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            IP+GP+K+KK
Sbjct  239  IPKGPVKEKK  248



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT +CH LI +LAVLFLW+NA
Sbjct  94   LGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTLICHSLIFSLAVLFLWANA  153

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIPEV +PE+P+L+  + LR+++N  LA+L DIA G+DLK FL VI GLWI
Sbjct  154  STFINKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDIAMGKDLKKFLAVIAGLWI  213

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG  C F+TLFYI  VLLHT+P+LYEKYED+VDAFAEKAM E KK Y V + K +SK
Sbjct  214  LSIVGKSCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKAMAEAKKHYGVINEKYISK  273

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  274  IPRGPLKNKK  283



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED++DAF EKA  ELKK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKAEIELKKYYALFEEKCLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  77   LGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  136

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPE+HIPE+P+LQ AS LR ++N   + L +IASGRD+K FL  I GLW+
Sbjct  137  TMFIHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWV  196

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSK
Sbjct  197  LSILGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSK  256

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  257  IPRGPLKNKK  266



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA
Sbjct  65   LGGGKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WI
Sbjct  125  HTFIHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWI  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            ISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+K
Sbjct  185  ISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNK  244

Query  210  IPRGPLKDKKLA  175
            IP+GPLK KKLA
Sbjct  245  IPKGPLKGKKLA  256



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA
Sbjct  51   LGGGKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNA  110

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WI
Sbjct  111  HTFIHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWI  170

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            ISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+K
Sbjct  171  ISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNK  230

Query  210  IPRGPLKDKKLA  175
            IP+GPLK KKLA
Sbjct  231  IPKGPLKGKKLA  242



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  747  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  568
            GGGK ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLFLWSNA 
Sbjct  64   GGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAH  123

Query  567  SFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  388
            SFI KS P IPE+H+ EE  L  ASALRN+VN    VLRDIA GRDLK FLMV+ GLW+I
Sbjct  124  SFINKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVI  183

Query  387  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  208
            S+VGS C FLTL YI  VLLHTVPVLYEK+ED+VD  AEKA  ELKKQY V D KVLSKI
Sbjct  184  SVVGSWCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDEKVLSKI  243

Query  207  PRGPLKDK  184
            P GPLK K
Sbjct  244  PIGPLKAK  251



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VCHGLIL+L +LFLWS A
Sbjct  62   LGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVCHGLILSLVILFLWSKA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEV IPE+  +Q A  LR ++N  LAVLR++A GRD+K FL VI GLW+
Sbjct  122  CTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVALGRDVKKFLTVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS  +FLTL YI  V LHTVPVLYEKYED+VDA AEKAM E+KKQYAV D KVLSK
Sbjct  182  LSMVGSSVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMAEIKKQYAVLDDKVLSK  241

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  242  IPRGPLKDKK  251



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   253 bits (646),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA
Sbjct  82   LGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNA  141

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW+
Sbjct  142  TMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWV  201

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSK
Sbjct  202  LSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSK  261

Query  210  IPRGPLKDKK  181
            IPRGPLK+KK
Sbjct  262  IPRGPLKNKK  271



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWSNA
Sbjct  54   LGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWSNA  113

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LRDI  GRDLK FL+VI GLW 
Sbjct  114  SAFINKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGLWT  173

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S +GS C+FLTLFYI  ++L+TVPVLYEKYED++DA+ EKAM ELKK YA+FD K LSK
Sbjct  174  LSALGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKCLSK  233

Query  210  IPRGPLKDKK  181
            IP+GP KDKK
Sbjct  234  IPKGPSKDKK  243



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNA
Sbjct  60   LGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI
Sbjct  120  SNFINKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBIASGRDLKAFLGVIAVLWI  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSK
Sbjct  180  LSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSK  239

Query  210  IPRGPLKDKK  181
            IP+GP+K+KK
Sbjct  240  IPKGPVKEKK  249



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGG+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +FL SNA
Sbjct  66   LGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMFLLSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+KK+ P IPEV +PEEPVL+FASALR ++N   A LRDIASG+DLK FL VI GLW+
Sbjct  126  STFVKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADLRDIASGKDLKKFLYVIGGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  CDF+TL +   +LL TVP LYEK ED+VD +AEKA+ ELKKQYAVFDAKVLSK
Sbjct  186  LSVVGGICDFMTLIFSITLLLFTVPFLYEKNEDQVDCYAEKAIAELKKQYAVFDAKVLSK  245

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  246  IPRGPLKDKK  255



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNA
Sbjct  61   LGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A ++R ++N   A LR+I  G DLK FL+V+ GLW+
Sbjct  121  STFINKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA+ ELKK YA+FD K LSK
Sbjct  181  LSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEKCLSK  240

Query  210  IPRGPLKDKK  181
            IP+GP K+KK
Sbjct  241  IPKGPSKNKK  250



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALA++FLWSNA
Sbjct  67   LGGGKPADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTLVCHILILALALIFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IPE+ +PE+ VL  A+A R + N  LA+LRDIASGR+LK FL VI GLW+
Sbjct  127  STFINKSPPKIPEIIVPEDIVLGIAAAFRIEFNRALAILRDIASGRELKKFLAVIAGLWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G+  +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA  ELKKQYAVF+ KVLSK
Sbjct  187  LSILGNYFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEAELKKQYAVFNTKVLSK  246

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKKL
Sbjct  247  IPRGPLKDKKL  257



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR+LK FL+VI GLWI
Sbjct  123  STFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS C+FLTLFYI  V L+TVPVLYEKYED+VDA  EKA  ELKK YA+F+ K LSK
Sbjct  183  LSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIELKKYYALFEEKCLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLWSNA
Sbjct  63   LGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ KS P IPEV +PE+ V + AS LR ++N  +AVL DIASGRDLK FL VI GL +
Sbjct  123  SNFLNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAGLLV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EK+  ++KKQYA+ D K LSK
Sbjct  183  LSLVGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEKYLSK  242

Query  210  IPRGPLKDKK  181
            IPRGP K+KK
Sbjct  243  IPRGPFKEKK  252



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNA
Sbjct  60   LGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI
Sbjct  120  SNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNIASGRDLKAFLGVIAVLWI  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSK
Sbjct  180  LSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSK  239

Query  210  IPRGPLKDKK  181
            IP+GP+K+KK
Sbjct  240  IPKGPVKEKK  249



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA
Sbjct  150  FGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNA  209

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             SFI K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW+
Sbjct  210  HSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWV  269

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSK
Sbjct  270  LSIVGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSK  329

Query  210  IPRGPLKDKK  181
            IP+G LK+K+
Sbjct  330  IPQG-LKNKR  338



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LI  LAV +LWSNA
Sbjct  73   LGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLITFLAVFYLWSNA  132

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL V+  LWI
Sbjct  133  SNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDIASGRDLKAFLGVVAVLWI  192

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSK
Sbjct  193  LSVVGKWFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSK  252

Query  210  IPRGPLKDKK  181
            IP+GP+K+KK
Sbjct  253  IPKGPVKEKK  262



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNA
Sbjct  65   LGGGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNA  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P  PEV I E  V+  ASAL  + N   A+LR++ASG+DLK FL VI GLW+
Sbjct  125  STFISKSRPKFPEVIISENVVVSVASALTIEFNRAFAILREVASGKDLKKFLAVIAGLWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSC +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA HE+KKQYAVFD KVLSK
Sbjct  185  LSVLGSCFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEHEIKKQYAVFDVKVLSK  244

Query  210  IPRGPLKDKKL  178
            +P+  LK KK 
Sbjct  245  LPKAILKYKKF  255



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA
Sbjct  80   LGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNA  139

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N  ++ LR+IASGRD+K FL  I GLW+
Sbjct  140  TMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWV  199

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C  FLTL YIA+VLL TVP+ Y+KYED+VD++ EKAM ELKKQYAV DAKV SK
Sbjct  200  LSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSK  259

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  260  IPRGPLKDKK  269



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNA
Sbjct  19   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNA  78

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+
Sbjct  79   SSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWL  138

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  139  FSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSK  198

Query  210  IPRGPLKDKK  181
            IP+G LKDKK
Sbjct  199  IPKG-LKDKK  207



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNA
Sbjct  66   LGGGKPADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI
Sbjct  126  SAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWI  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S +GS C+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSK
Sbjct  186  LSALGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSK  245

Query  210  IPRGPLKDKK  181
            IP+GP KDKK
Sbjct  246  IPKGPSKDKK  255



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA
Sbjct  61   LGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW+
Sbjct  121  HSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSK
Sbjct  181  MSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSK  240

Query  210  IPRGPLKDKKL  178
            IP   LK KK+
Sbjct  241  IPVAALKAKKV  251



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA
Sbjct  61   LGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             SFI KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW+
Sbjct  121  HSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSK
Sbjct  181  MSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSK  240

Query  210  IPRGPLKDKKL  178
            IP   LK KK+
Sbjct  241  IPVAALKAKKV  251



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   249 bits (637),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 1/192 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA
Sbjct  61   LGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNA  120

Query  570  SSFIK-KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLW  394
            +  I  +S PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW
Sbjct  121  TFLINNRSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLW  180

Query  393  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  214
            ++S VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LS
Sbjct  181  VLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLS  240

Query  213  KIPRGPLKDKKL  178
            KIPRGPLKDKK 
Sbjct  241  KIPRGPLKDKKF  252



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNA
Sbjct  64   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+
Sbjct  124  SSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWL  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             S++GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  184  FSVLGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSK  243

Query  210  IPRGPLKDKK  181
            IP+G LKDKK
Sbjct  244  IPKG-LKDKK  252



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNA
Sbjct  57   LGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLWI
Sbjct  117  STFINKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGLWI  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTLFYI  + L+TVPVLYEKY+D++DAF EKAM ELKK  A+FD K L+K
Sbjct  177  LSVLGSCCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMIELKKYCAIFDEKCLAK  236

Query  210  IPRGPLKDKK  181
            IP+GP K+KK
Sbjct  237  IPKGPSKNKK  246



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++A
Sbjct  64   LGGGKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+ I KS P+IPEV +PE+ VL+ AS LR + N  LA+LR+IASGR+LK FL  I GLW+
Sbjct  124  STHITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIASGRELKKFLAFIAGLWV  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS  + +TLFYI  VLLHTVPV YEKYED+VD FAEKAM E+KKQ+AVF+ KVLSK
Sbjct  184  LSMVGSWFNSVTLFYITFVLLHTVPVFYEKYEDQVDPFAEKAMVEIKKQFAVFNEKVLSK  243

Query  210  IPRGPLKDKK  181
            +PRGPLKDKK
Sbjct  244  VPRGPLKDKK  253



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++LFLWSN 
Sbjct  68   FGGGKPADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSMLFLWSNV  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI K  P IP V + EEP +  A ALRN++N   AVLR+IASGRDLK FL+V+  LW 
Sbjct  128  TIFINKRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDLKKFLVVVAVLWF  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
             SIVGSCC+FLTLFY+  VLLHTVPVLYEKY +++DAF EKA  E+KKQYAVFDAK L K
Sbjct  188  FSIVGSCCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATVEIKKQYAVFDAKFLCK  247

Query  210  IPRGPLKDKKLA  175
            IP+GP  DKK A
Sbjct  248  IPKGPF-DKKRA  258



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA
Sbjct  62   FGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW+
Sbjct  122  HTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS C+FLTLFYIA+VLLH VPVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSK
Sbjct  182  LSVVGSWCNFLTLFYIALVLLHIVPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSK  241

Query  210  IP  205
            IP
Sbjct  242  IP  243



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA
Sbjct  60   FGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  120  ATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSK
Sbjct  180  LSIVGNWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSK  239

Query  210  IPRGPL  193
            IP+ PL
Sbjct  240  IPKRPL  245



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH LI+ LA+ FLWS A
Sbjct  59   LGGGKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHILIILLAIPFLWSYA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K+ P IP+V +PE+ +LQ  ++LR ++N  ++ LRD+ASGRDL+ FL    GLWI
Sbjct  119  NTFINKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGRDLRKFLSAFLGLWI  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI GS C+FLTL Y+  +LLHTVPVLYEKYED+VD FAEKA+ ELKKQYA FDAKVLSK
Sbjct  179  LSIAGSWCNFLTLLYMCFILLHTVPVLYEKYEDQVDPFAEKALIELKKQYAEFDAKVLSK  238

Query  210  IPRGPLKDKK  181
            IP GPL++KK
Sbjct  239  IPLGPLQEKK  248



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H +IL LAVLFLWSNA
Sbjct  68   LGGGKPADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHVMILLLAVLFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IP++HIPEEP+LQ AS LR ++N   + L +IASGRDLK FL VI GLW+
Sbjct  128  TMFIHKSPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSVIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP+LY+KYED+VD + EKAM ELKKQYAVFDAKVLSK
Sbjct  188  LSILGGCCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLELKKQYAVFDAKVLSK  247

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  248  IPMGPLKNKK  257



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 162/222 (73%), Gaps = 31/222 (14%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN 
Sbjct  67   LGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNV  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W+
Sbjct  127  HTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWV  186

Query  390  ISIVGSCCDFLTLFYI-------------------------------AVVLLHTVPVLYE  304
            +S+VGS C+FLTLFY                                A VLLHTVPVLYE
Sbjct  187  LSVVGSWCNFLTLFYTCNDTGLLFLVPSSFIYTNFILNFDPSSLWKSAFVLLHTVPVLYE  246

Query  303  KYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  178
            KYED+VD FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  247  KYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  288



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   247 bits (631),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA
Sbjct  62   FGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FIKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW+
Sbjct  122  HTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS C+FLTLFYIA+VLLH +PVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSK
Sbjct  182  LSVVGSWCNFLTLFYIALVLLHILPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSK  241

Query  210  IP  205
            IP
Sbjct  242  IP  243



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  84   LGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNA  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW+
Sbjct  144  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWV  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM ELKKQYAV D KVLSK
Sbjct  204  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  264  IPLGPLKNKK  273



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  744  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  565
            G   AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+
Sbjct  36   GCVSADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASA  95

Query  564  FIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  385
            F+ K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S
Sbjct  96   FVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILS  155

Query  384  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  205
             +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP
Sbjct  156  FLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIP  215

Query  204  RGPLKDKK  181
            +GP KDKK
Sbjct  216  KGPSKDKK  223



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNA
Sbjct  69   FGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K    IP++   E+     ASALR ++N    V+ D+ASGRDLK FLMV+ GLWI
Sbjct  129  SAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDVASGRDLKKFLMVVAGLWI  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSK
Sbjct  189  LSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSK  248

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  249  IPRGPLKDKKF  259



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  85   LGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNA  144

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI
Sbjct  145  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRELKKFLIAIFGLWI  204

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSK
Sbjct  205  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSK  264

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  265  IPLGPLKNKK  274



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  81   LGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNA  140

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW+
Sbjct  141  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRDLKKFLIAIAGLWV  200

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSK
Sbjct  201  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSK  260

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  261  IPLGPLKNKK  270



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  84   LGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNA  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPE+HIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI
Sbjct  144  TMFINKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWI  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSK
Sbjct  204  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  264  IPLGPLKNKK  273



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  85   LGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNA  144

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI
Sbjct  145  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWI  204

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSK
Sbjct  205  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSK  264

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  265  IPLGPLKNKK  274



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LFLWSNA
Sbjct  66   LGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P +P+V+IPE+PVLQ A+ALR ++N  LA+LR+IASGRDLK FL VI GLW+
Sbjct  126  STFINKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREIASGRDLKKFLSVIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+ G+  +FLTLFY A VLL TVPV+YEKYED+VD FAEKA+ E+KKQY VFDAKVLSK
Sbjct  186  LSVAGNLFNFLTLFYTAFVLLFTVPVIYEKYEDKVDPFAEKAIIEIKKQYKVFDAKVLSK  245

Query  210  IPRGPLK  190
            +PRGPLK
Sbjct  246  LPRGPLK  252



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNA
Sbjct  69   FGGGKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K    IP++   E+     ASALR ++N    V+ ++ASGRDLK FLMV+ GLWI
Sbjct  129  SAFINKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNVASGRDLKKFLMVVAGLWI  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSK
Sbjct  189  LSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSK  248

Query  210  IPRGPLKDKKL  178
            IPRGPLKDKK 
Sbjct  249  IPRGPLKDKKF  259



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  83   LGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  142

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW+
Sbjct  143  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWV  202

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSK
Sbjct  203  LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSK  262

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  263  IPLGPLKNKK  272



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT V H LI  LA+LFLWSNA
Sbjct  66   LGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTLVAHILIATLAILFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L +IASG+DLK FL VI GLW+
Sbjct  126  HTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNIASGKDLKKFLAVIAGLWV  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI+ VLLHTVPV+YEKYED++D  AEK   E KKQYAVFDAKVL+K
Sbjct  186  LSVVGKWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKVTIEFKKQYAVFDAKVLNK  245

Query  210  IPRGPLKDKK  181
            IPRG LK+K+
Sbjct  246  IPRG-LKNKR  254



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K++PHIPEV+IPE+PVLQ  S LR ++N  L VLR+IASG+D+K F++VI GLW+
Sbjct  123  CTFIHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGKDVKKFILVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSC +FLTLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCYNFLTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  222  VLSKIPRGPLKDKK  181
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 162/225 (72%), Gaps = 36/225 (16%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNA
Sbjct  62   LGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW+
Sbjct  122  STFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIA--------------------------------VVLLHTVPVLY  307
            +SIVG+ C+F+TLFYI                                  VLLHTVPV+Y
Sbjct  182  LSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIY  241

Query  306  EKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  184
            EKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  242  EKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 162/225 (72%), Gaps = 36/225 (16%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNA
Sbjct  62   LGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW+
Sbjct  122  STFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIA--------------------------------VVLLHTVPVLY  307
            +SIVG+ C+F+TLFYI                                  VLLHTVPV+Y
Sbjct  182  LSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIY  241

Query  306  EKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  184
            EKYED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  242  EKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  84   LGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW+
Sbjct  144  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIVGLWV  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  204  LSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  264  IPMGPLKNKK  273



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 156/222 (70%), Gaps = 32/222 (14%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNA
Sbjct  15   LGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNA  74

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW+
Sbjct  75   SSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWL  134

Query  390  ISIVGSCCDFLTLFYIA--------------------------------VVLLHTVPVLY  307
            +SI+GSCC+FLTLFYI                                  V+LHTVPV+Y
Sbjct  135  LSILGSCCNFLTLFYIGEGSQLSIPFLAPLLPNVDLVFTVDLSLLCQTVFVVLHTVPVIY  194

Query  306  EKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  181
            EKYED++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  195  EKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  236



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA
Sbjct  70   LGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNA  129

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW+
Sbjct  130  HTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDLKKFLAVIAGLWV  189

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK + E KKQYAVFDAKVLSK
Sbjct  190  LSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVIIEFKKQYAVFDAKVLSK  249

Query  210  IPRGPLKDKK  181
            IPRG LK+K+
Sbjct  250  IPRG-LKNKR  258



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA
Sbjct  71   LGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW+
Sbjct  131  HAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI  VLLHTVPV+YEKYED++D  AEKA  E KKQYAVFDAKVLSK
Sbjct  191  LSVVGKWCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKATIEFKKQYAVFDAKVLSK  250

Query  210  IPRGPLKDKK  181
            IP G LK K+
Sbjct  251  IPHG-LKSKR  259



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNA
Sbjct  57   LGGGKPADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+ KS P IP++ +PE+ VL+ ASALR ++N  LAVL DIA+GRD+K FL VI  LW+
Sbjct  117  STFVNKSPPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWV  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+GS  +FLTL YI  VLLHTVP+ YEKYED++D  AEKA  E+KKQY VFD KVLSK
Sbjct  177  LSIIGSWFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSK  236

Query  210  IPRGPLKDKK  181
            IP G LK+ K
Sbjct  237  IPVGLLKELK  246



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  74   LGGGKPADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNA  133

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR IASGRDLK FL  I GLW+
Sbjct  134  TMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQIASGRDLKKFLSAIVGLWV  193

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G CC FLTL YIA+VLL T+P+LY+KYED+VD++ EKAM ELKKQYAVFDAKVLSK
Sbjct  194  LSVLGGCCSFLTLAYIALVLLFTLPLLYDKYEDKVDSYGEKAMAELKKQYAVFDAKVLSK  253

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  254  IPRGPLKDKK  263



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA
Sbjct  71   LGGGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW+
Sbjct  131  HAFIHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDIASGRDLKKFLAVIAGLWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI  V+LHTVPV+YEKYED++D  AE+A  E KKQYA FDAKVLSK
Sbjct  191  LSVVGKWCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERATIEFKKQYAXFDAKVLSK  250

Query  210  IPRGPLKDKK  181
            IP G LK+K+
Sbjct  251  IPHG-LKNKR  259



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  79   LGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  138

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW+
Sbjct  139  TMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLTAIAGLWV  198

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  199  MSILGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  258

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  259  IPLGPLKNKK  268



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LAVLF+WSNA
Sbjct  76   LGGGKPADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLAVLFIWSNA  135

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S FI KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW+
Sbjct  136  SMFINKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLTAIAGLWV  195

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG CC+FLTL YI +V+L T+PVLYEK+ED+VDA+ EKAM E+KKQYAV D KVLSK
Sbjct  196  LSIVGGCCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKAMVEMKKQYAVLDEKVLSK  255

Query  210  IPRGPLKDKK  181
            IPRGPLK KK
Sbjct  256  IPRGPLKGKK  265



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA
Sbjct  71   LGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW+
Sbjct  131  HAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI  VLLHTVPV+YE+YED++D  AEKA  E KKQYAVFDAKVLSK
Sbjct  191  LSVVGKWCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKATIEFKKQYAVFDAKVLSK  250

Query  210  IPRGPLKDKK  181
            IP G LK K+
Sbjct  251  IPHG-LKSKR  259



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFLWSN 
Sbjct  65   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNV  124

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
              FI KS P+IPEV IPE+  +  A +LR+++N  L  LR+I  GRDLK FL+VI GLW+
Sbjct  125  CIFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDLKKFLIVIGGLWV  184

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSK
Sbjct  185  LSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSK  244

Query  210  IPRGPLKDKK  181
            IP+G LK+KK
Sbjct  245  IPKGALKNKK  254



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  85   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  144

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW+
Sbjct  145  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWV  204

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  205  LSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  264

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  265  IPMGPLKNKK  274



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  85   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  144

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW+
Sbjct  145  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWV  204

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  205  LSIMGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  264

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  265  IPMGPLKNKK  274



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  77   LGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  136

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW 
Sbjct  137  TMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLAAIAGLWF  196

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  197  VSILGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  256

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  257  IPLGPLKNKK  266



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA
Sbjct  60   FGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI
Sbjct  120  HTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWI  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  VLLHTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSK
Sbjct  180  LSIVGNWCNFLTLFYITFVLLHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSK  239

Query  210  IPRGPLKDK  184
            IP GPLK K
Sbjct  240  IPLGPLKAK  248



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+FLWSNA
Sbjct  67   LGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVMFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +   K+APHIPEV +PEEP LQ AS LR  +N   A+L +IASGR+LK FL+VI GLW+
Sbjct  127  HTIFHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASGRELKKFLIVIAGLWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLHTVPVLYEKYE +VD  AEKA  E+KKQY VFDAKV++K
Sbjct  187  LSIVGSWCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIEMKKQYGVFDAKVVTK  246

Query  210  IPRGPLKDKK  181
            +    LK+K+
Sbjct  247  VRETVLKNKR  256



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS PHIPEVHIPE+P+LQ  S LR ++N  L +LR+IASG+D+K F++VI GLW+
Sbjct  123  CTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL--  217
            +SI+GSC +FLTLFY A VLL T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVL  
Sbjct  183  LSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRK  242

Query  216  --SKIPRGPLKDKK  181
              SKIPRG L  KK
Sbjct  243  VISKIPRGALNKKK  256



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLWSN 
Sbjct  56   FGGGKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNG  115

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
              FI KS P IPE+ IPE+ +LQ  S++  ++N  L V+RDIASG+DLK FL VI GLW+
Sbjct  116  LGFINKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWV  175

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G  C+FLTL YIA+VLL +VPV YEKY+ ++D  AEKAM E+KKQYAVFDAKVLSK
Sbjct  176  VSILGKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSK  235

Query  210  IPRGPLKDKKL  178
            IPRG LK KK+
Sbjct  236  IPRGALKAKKI  246



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  84   LGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW+
Sbjct  144  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWV  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  204  LSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  264  IPLGPLKNKK  273



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA
Sbjct  122  LGGGKPADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNA  181

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI+KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI
Sbjct  182  TMFIRKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWI  241

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELK QYAV DAKVLSK
Sbjct  242  LSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKNQYAVLDAKVLSK  301

Query  210  IPRGPLKDKK  181
            IPR   K+KK
Sbjct  302  IPRWTSKNKK  311



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  59   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FIKKS P IPE+H+PEE  L  AS+LRN+VN    +LR IA GRDLK FLMVI GLWI
Sbjct  119  HTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGLWI  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+  +FLTL YI  V+LHTVP++YEK+ED+VD FAEKAM EL+KQY VFD KV+SK
Sbjct  179  ISVVGNWFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQYLVFDEKVISK  238

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  239  IPIASLKAK  247



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA
Sbjct  69   FGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI
Sbjct  129  HTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWI  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSK
Sbjct  189  LSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSK  248

Query  210  IPRGPLKDK  184
            IP GPLK K
Sbjct  249  IPLGPLKAK  257



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             G GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA
Sbjct  69   FGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNA  128

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI
Sbjct  129  HTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWI  188

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSK
Sbjct  189  LSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSK  248

Query  210  IPRGPLKDK  184
            IP GPLK K
Sbjct  249  IPLGPLKAK  257



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSNA
Sbjct  67   LGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P+IPEV IPE+  +  A +LR ++N   + LRDI  GRDLK FL+VI  LW+
Sbjct  127  CTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G+CC+FLTL YI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+F+ K LSK
Sbjct  187  LSVLGNCCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFEEKCLSK  246

Query  210  IPRGPLKDKK  181
            IP+G LK+KK
Sbjct  247  IPKGHLKNKK  256



>gb|KJB24288.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=233

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  735  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  556
            +AD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI 
Sbjct  43   KADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIH  102

Query  555  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  376
            KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVG
Sbjct  103  KSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVG  162

Query  375  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  196
            + C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSKIP+ P
Sbjct  163  NWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRP  222

Query  195  L  193
            L
Sbjct  223  L  223



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSK
Sbjct  183  ISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPVASLKAK  251



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  64   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  124  HTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSK
Sbjct  184  ISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSK  243

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  244  IPVASLKAK  252



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLFLWSN 
Sbjct  60   LGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLWSNT  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S F+ K  P IPEV +PE+ V + ASALR ++N   AVL DIASGRDLK  L VI GLW+
Sbjct  120  SDFLNKPPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDLKKVLAVIAGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSC + LTL YI+ VLLHTVPVLYEKYED+VDA++EK   E+KKQYAVFD K LSK
Sbjct  180  LSLIGSCINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKTWIEIKKQYAVFDEKYLSK  239

Query  210  IPRGPLKDKK  181
            IP+G LK +K
Sbjct  240  IPKGALKGEK  249



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSK
Sbjct  183  ISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPVASLKAK  251



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK A++F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  84   LGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW+
Sbjct  144  TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWV  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  204  LSVLGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  264  IPLGPLKNKK  273



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LG GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYH LT VCH LIL LAVLFLWSNA
Sbjct  66   LGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IP+VH+PEEP+LQ AS LR ++N   AVL  I SGRDLK FLMVI G+WI
Sbjct  126  HTFIHKSPPRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSGRDLKKFLMVIAGVWI  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  +LLHT PVLYEKYED++D  AEKA+ E+KKQYAVFDAKVLSK
Sbjct  186  LSIVGNWCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIEIKKQYAVFDAKVLSK  245

Query  210  IPRGPLKDK  184
            IP G LK K
Sbjct  246  IPVGLLKAK  254



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W+NKK+S GVLGGAT  W+LFE+LEYHLLT +CH +I+ALAVLFLWSNA
Sbjct  76   LGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELLEYHLLTLLCHVMIVALAVLFLWSNA  135

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI
Sbjct  136  TMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWI  195

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSK
Sbjct  196  LSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSK  255

Query  210  IPRGPLKDKK  181
            IPRGPLKDKK
Sbjct  256  IPRGPLKDKK  265



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A
Sbjct  57   FGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K+ PHIPEVHIPE+ VLQ AS LRN++N    +LR+IA GRDLK FLMV+ GLW+
Sbjct  117  TTFIHKTPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDLKKFLMVVAGLWV  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL TVPVLYEKYED+VD F EKAM E+KKQYAV D    +K
Sbjct  177  LSKVGSSCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSK  236

Query  222  VLSKIPRGPLKDKK  181
            V+SKIPRG    KK
Sbjct  237  VMSKIPRGAFNKKK  250



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTFINKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSK
Sbjct  183  ISVVGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPVASLKAK  251



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  83   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  142

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IPEVHIPEEPVLQ AS LR ++N     LR+IASGRDLK F+  I GLW+
Sbjct  143  TMFIHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGRDLKKFISAIAGLWV  202

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  203  LSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  262

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  263  IPLGPLKNKK  272



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA
Sbjct  61   LGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  121  TTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSK
Sbjct  181  LSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSK  240

Query  210  IPRGPL  193
            IPRGPL
Sbjct  241  IPRGPL  246



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSN 
Sbjct  85   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNV  144

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FI KS P IP+VHIPEEPVLQ AS LR ++N   + LR+IASGRDLK F+  I GLW+
Sbjct  145  TRFIHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGRDLKKFISAIAGLWV  204

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSK
Sbjct  205  LSILGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSK  264

Query  210  IPRGPLKDKK  181
            IP GPLK+KK
Sbjct  265  IPLGPLKNKK  274



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             G GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA
Sbjct  67   FGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI
Sbjct  127  HTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWI  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVG+ C+FLTLFYI  VL HTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSK
Sbjct  187  LSIVGNWCNFLTLFYITFVLSHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSK  246

Query  210  IPRGPLKDK  184
            IP GPLK K
Sbjct  247  IPLGPLKAK  255



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A
Sbjct  44   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSA  103

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  104  STFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  163

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +K
Sbjct  164  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  223

Query  222  VLSKIPRG  199
            V+SKIP+G
Sbjct  224  VMSKIPKG  231



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEVH+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTFINKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  V+LHTVP++YEK+ED+VD  AEKAM EL+KQY VFD KV+SK
Sbjct  183  ISVVGNWCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMKELQKQYLVFDEKVISK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPIASLKAK  251



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A
Sbjct  62   FGGGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ PHIPE+HIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW+
Sbjct  122  ITFIHKTPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDLKKFLLVIAGLWL  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SIVGS C+FLTL YIA +LL TVPVLYEKYED+VD F EKAM E+KKQYAVFD    +K
Sbjct  182  LSIVGSSCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVFDEKVLSK  241

Query  222  VLSKIPRGPLKDKK  181
            V+SKIPRG    KK
Sbjct  242  VMSKIPRGAFNKKK  255



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA
Sbjct  61   LGGGKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+
Sbjct  121  TTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSK
Sbjct  181  LSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSK  240

Query  210  IPRGPLK  190
            IPRGPL 
Sbjct  241  IPRGPLN  247



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A
Sbjct  59   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSA  118

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  119  STFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  178

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +K
Sbjct  179  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  238

Query  222  VLSKIPRG  199
            V+SKIP+G
Sbjct  239  VMSKIPKG  246



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A
Sbjct  60   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  120  STFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +K
Sbjct  180  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSK  239

Query  222  VLSKIPRGPLKDKK  181
            V+SKIP+G    KK
Sbjct  240  VMSKIPKGAFYKKK  253



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A
Sbjct  61   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  121  STFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +K
Sbjct  181  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSK  240

Query  222  VLSKIPRGPLKDKK  181
            V+SKIP+G    KK
Sbjct  241  VMSKIPKGAFYKKK  254



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A
Sbjct  73   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSA  132

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  133  STFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  192

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +K
Sbjct  193  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSK  252

Query  222  VLSKIPRGPLKDKK  181
            V+SKIP+G    KK
Sbjct  253  VMSKIPKGAFYKKK  266



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNA
Sbjct  68   FGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIP+V IPE+ VLQ AS +  ++N    +LR+IASG+DLK FL VI GLW+
Sbjct  128  STFINKSPPHIPQVQIPEKLVLQIASVITLEINRAFVILREIASGKDLKQFLSVIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SK
Sbjct  188  VSILGKWYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSK  247

Query  210  IPRGPLKDKKL  178
            IPRG LKDKK 
Sbjct  248  IPRGQLKDKKF  258



>ref|NP_001042463.1| Os01g0226300 [Oryza sativa Japonica Group]
 dbj|BAF04377.1| Os01g0226300, partial [Oryza sativa Japonica Group]
Length=178

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -1

Query  711  NKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipe  532
            N+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPE
Sbjct  1    NRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPE  60

Query  531  vhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTL  352
            V IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL
Sbjct  61   VIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTL  120

Query  351  FYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  181
             YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  121  VYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  177



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V H LIL+LA LFL+SN 
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSNV  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
              F+ KS P+IPEV IPE+  +  A +LR+++N     LR+I  GRDLK FL+VI GLW+
Sbjct  123  CIFVHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVIGGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSK
Sbjct  183  LSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSK  242

Query  210  IPRGPLKDKK  181
            IP+G LK+KK
Sbjct  243  IPKGALKNKK  252



>ref|XP_004965478.1| PREDICTED: reticulon-like protein B2-like [Setaria italica]
Length=257

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LW++KK S  V+GGAT IW+LFEVL YHLLT + H LI  LA+LFL S A
Sbjct  66   LGGGKTADVLLWKDKKTSAVVIGGATVIWVLFEVLGYHLLTLISHVLIGVLAILFLLSKA  125

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FIKKS P+IP V IPE+ V+  + ALRND+N  L + R+IA G DLK FL VI GLWI
Sbjct  126  TTFIKKSPPNIPLVEIPEDLVVNVSQALRNDINRALHLFREIAMGHDLKKFLGVIVGLWI  185

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S VGSCCDFLTL YIAV++LHTVP+LY+KY+D+VD FA +A  E +KQY V DAKVLSK
Sbjct  186  LSSVGSCCDFLTLIYIAVLMLHTVPILYDKYQDKVDHFAGRAHTEARKQYEVLDAKVLSK  245

Query  210  IPRGPLKDKK  181
            IPRGP K KK
Sbjct  246  IPRGPAKPKK  255



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  61   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  121  HTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMVVVGLWI  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SK
Sbjct  181  ISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSK  240

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  241  IPIASLKAK  249



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT VCH LILA A+LFLWSNA
Sbjct  61   LGGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             + I KS P IPEVH+PE+ VLQ ASAL  ++N   A LR +A+G+D K FLM+I GLW+
Sbjct  121  CTLINKSPPRIPEVHLPEKLVLQVASALCVEINSAFAGLRSVAAGKDFKKFLMIIAGLWV  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSK
Sbjct  181  LSIVGSSCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKAMVEIKKQYAVFDAKVLSK  240

Query  210  IPRGPLKDKKL  178
            IP   LK K++
Sbjct  241  IPVASLKAKRV  251



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++ +LFLWSNA
Sbjct  64   LGGGKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             + + K+ P IP  H+PEEP L+ ASALR ++NH  A LRDI +G+D+K FL+ I GLWI
Sbjct  124  HTLLHKAPPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDVKKFLIAIVGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----K  223
            +SIVGS C+FLTLFYI  VLL T+P LY+KYED++D  AEKA HE+KKQY VFDA    K
Sbjct  184  LSIVGSWCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHEIKKQYVVFDAKVLSK  243

Query  222  VLSKIPRGPLKDK  184
            VLSKIP+G LK K
Sbjct  244  VLSKIPKGLLKGK  256



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +LFLWSNA
Sbjct  68   FGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVMLFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIP+V IPE+PVLQ ASA+ +++N    ++R+IASG+DLK FL  I GLW+
Sbjct  128  STFINKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREIASGKDLKQFLSAIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKVLSK
Sbjct  188  VSILGKYYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALTEMKKQYAVFDAKVLSK  247

Query  210  IPRGPLKDKKL  178
            IPRG  K KK 
Sbjct  248  IPRGQTKAKKF  258



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+LFLWSNA
Sbjct  67   FGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAMLFLWSNA  126

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS P IP+V IPE+PVLQ ASA+  ++N    +LR+IASG+DLK FL VI GLW+
Sbjct  127  STFINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIASGKDLKQFLSVIAGLWV  186

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YI VVLL T+PV YEKY+D+VDAFAEKAM E+KKQYAVFDAKVLSK
Sbjct  187  LSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAFAEKAMIEIKKQYAVFDAKVLSK  246

Query  210  IPRGPLKDKK  181
            +P+G +KDKK
Sbjct  247  VPKGQMKDKK  256



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW+
Sbjct  123  CTFIHKSTPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVFSK  242

Query  222  VLSKIPRGPLKDKK  181
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNA
Sbjct  68   FGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNA  127

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI KS PHIP+V IPE+PVLQ AS +  ++N    +LR+IASG+DLK FL VI GLW+
Sbjct  128  STFINKSPPHIPQVQIPEKPVLQIASVITMEINRAFVILREIASGKDLKQFLSVIAGLWV  187

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+G   +FLTL YI VVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SK
Sbjct  188  VSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSK  247

Query  210  IPRGPLKDKKL  178
            IPRG LKDKK 
Sbjct  248  IPRGQLKDKKF  258



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A
Sbjct  60   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSA  119

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PHIPEVHIPEE VL+ AS LR ++N    VLRDIASGRDLK FL+VI GLW+
Sbjct  120  TTFIHKSPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWV  179

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S +GS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +K
Sbjct  180  LSKLGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  239

Query  222  VLSKIPRGPLKDKK  181
            V+SKIP+G    KK
Sbjct  240  VMSKIPKGAFYKKK  253



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA
Sbjct  70   LGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNA  129

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW+
Sbjct  130  HTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSIASGKDLKKFLAVIAGLWV  189

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK   E KKQY VFDAKVLSK
Sbjct  190  LSVVGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVTIEFKKQYDVFDAKVLSK  249

Query  210  IPRGPLKDKK  181
            IP G LK+K+
Sbjct  250  IPCG-LKNKR  258



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  61   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNA  120

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FIKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLM++ GLWI
Sbjct  121  HTFIKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMIVVGLWI  180

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SK
Sbjct  181  ISVVGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSK  240

Query  210  IPRGPLK  190
            IP   LK
Sbjct  241  IPIASLK  247



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FLW NA
Sbjct  62   LGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFLWCNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS PH+PEV I E+  L    +LR  +N  L  LRDIASGRDLK FL     LW+
Sbjct  122  TTFISKSRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDIASGRDLKKFLAAAAALWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SI+ +CC FL LFYIA V L+TVPVLYEKYED VDAFAEKA  E KK Y V   K LSK
Sbjct  182  LSIIANCCSFLMLFYIAFVALYTVPVLYEKYEDRVDAFAEKAEAEFKKHYVVIHVKYLSK  241

Query  210  IPRGPLKDKKL  178
            IP GPLKDKK 
Sbjct  242  IPMGPLKDKKF  252



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 152/194 (78%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A
Sbjct  57   FGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K+ PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW+
Sbjct  117  TTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWV  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +K
Sbjct  177  LSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSK  236

Query  222  VLSKIPRGPLKDKK  181
            V+SKIPRG    KK
Sbjct  237  VMSKIPRGAFNKKK  250



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLWI
Sbjct  123  CTFIHKATPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSILGSCCNFLTLFYIATVLLFTIPVIYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  222  VLSKIPRGPLKDKK  181
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSN 
Sbjct  63   LGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNV  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTFINKASPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+ C+FLTL Y   V+LHTVP+LYEK+ED+VD  AEKA+ EL+KQY VFD KVLSK
Sbjct  183  ISVVGNWCNFLTLVYFCFVILHTVPMLYEKHEDKVDPLAEKALKELQKQYVVFDEKVLSK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPIASLKAK  251



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS   LG AT IW LFE+LEYHLLT +CH LI  LAVLFLWSNA
Sbjct  95   LGGGKPADVLLWRNKKISASALGVATVIWFLFELLEYHLLTLLCHILIFTLAVLFLWSNA  154

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+FI K+ P IP+VHIP+  +L+F S LR ++N  L+VLRDIASG++LK F  VI GLW+
Sbjct  155  SAFIHKAPPRIPDVHIPDNALLEFISVLRFEINRALSVLRDIASGKELKKFFGVIAGLWV  214

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S+VGS  +FLTL Y+  VLLHTVPVLYEKYED VDAFAEKA  ELKKQYAV D K LSK
Sbjct  215  VSVVGSWFNFLTLVYLLFVLLHTVPVLYEKYEDHVDAFAEKAAIELKKQYAVADEKFLSK  274

Query  210  IPRGPLKDKKLA  175
            IPRGPLKDKK A
Sbjct  275  IPRGPLKDKKSA  286



>ref|XP_006656127.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=262

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A
Sbjct  71   LGGGKTADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKA  130

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FIKKS P IP V IPE+  +  + ALRND+N  L + R+IA G DLK FL VI  LW+
Sbjct  131  TTFIKKSPPDIPVVQIPEDVAVNVSRALRNDINRALHLFREIALGHDLKKFLGVIVALWV  190

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S VGSCCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSK
Sbjct  191  LSEVGSCCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSK  250

Query  210  IPRGPLKDKK  181
            IPRGP K KK
Sbjct  251  IPRGPSKPKK  260



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A
Sbjct  57   FGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW+
Sbjct  117  TTFIHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWV  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQYAV D    +K
Sbjct  177  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSK  236

Query  222  VLSKIPRGPLKDK  184
            V+SKIPRG    K
Sbjct  237  VMSKIPRGAFNKK  249



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +FLWSNA
Sbjct  64   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +F+KKS P IPEVH+ EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  124  HAFMKKSPPKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSK
Sbjct  184  ISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSK  243

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  244  IPLASLKAK  252



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +CH LIL LA+LFLWSNA
Sbjct  63   LGGGKPADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLCHCLILTLAILFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P+IPEV IP++  + FA +LR ++N   A LR+I  G DLK FL+VI GLWI
Sbjct  123  TTFINKSPPNIPEVKIPDDLAVNFARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  183  LSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSK  242

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  243  IPKGPLKDKK  252



>ref|NP_001046501.1| Os02g0265900 [Oryza sativa Japonica Group]
 dbj|BAD27895.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF08415.1| Os02g0265900 [Oryza sativa Japonica Group]
 gb|EAZ22509.1| hypothetical protein OsJ_06173 [Oryza sativa Japonica Group]
 dbj|BAG96495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LW++KKIS  V+GGAT +W+LFEV++YH LT + H LI  LA+LFLWS A
Sbjct  39   LGGGKAADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKA  98

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            + FIKKS P+IPEV I E+  +  A ALR D+N  L +LR+I+ G DL  FL VI  LWI
Sbjct  99   TIFIKKSPPNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWI  158

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S +GS CDFLTLFY+AV++LHTVP+LY KY+D+VD FA KA  EL +QY+V DAKVLSK
Sbjct  159  LSEIGSLCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGKAHVELSRQYSVLDAKVLSK  218

Query  210  IPRGPLKDKK  181
            IPRGP KDKK
Sbjct  219  IPRGPAKDKK  228



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWR+KK S  VLG AT +WI FE LEYHL+T  CH +IL LAV FLWSN 
Sbjct  84   LGGGKPADVLLWRDKKESASVLGAATVLWIFFECLEYHLITLFCHIMILFLAVFFLWSNG  143

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            SSFI K+ P IP+V IPE+ VL  ASALR ++N    VLR+IASGRDLK FL VI  LWI
Sbjct  144  SSFINKAPPEIPKVQIPEKCVLDIASALRIELNKGFHVLREIASGRDLKTFLGVIAVLWI  203

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++G C  FLTLFY+  VLLH+ P++YEK+ED++DA AEKA  E KKQYAVF+ KVLSK
Sbjct  204  VSVIGKCFSFLTLFYLTFVLLHSAPLIYEKHEDQIDAVAEKAWIEFKKQYAVFNEKVLSK  263

Query  210  IPRGPLKDKK  181
            IP+GP+K+KK
Sbjct  264  IPKGPVKEKK  273



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EY  LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYRFLTFLCHFAMAALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW+
Sbjct  123  CTFIHKSTPRIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWV  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDDKVFSK  242

Query  222  VLSKIPRGPLKDKK  181
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ PH+PEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW 
Sbjct  123  CTFIHKATPHLPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWA  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +K
Sbjct  183  LSIIGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSK  242

Query  222  VLSKIPRGPLKDKK  181
            VLSKIPRG L  KK
Sbjct  243  VLSKIPRGALNKKK  256



>ref|NP_001057713.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAD45275.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF19627.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAG93532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A
Sbjct  75   LGGGKTADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKA  134

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FIKKS P IP V IPE+  +  + ALR+D+N  L + R+IA G DLK FL VI  LW+
Sbjct  135  TTFIKKSPPDIPVVQIPEDVAVNVSRALRSDINRALHLFREIALGHDLKKFLGVIVALWV  194

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S VGSCCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSK
Sbjct  195  LSEVGSCCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSK  254

Query  210  IPRGPLKDKK  181
            IPRGP+K KK
Sbjct  255  IPRGPVKPKK  264



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +CH LIL LA+LFLWSNA
Sbjct  64   LGGGKPADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+VI GLWI
Sbjct  124  TTFINKSPPNIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSK
Sbjct  184  LSVLGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSK  243

Query  210  IPRGPLKDKK  181
            IP+GPLKDKK
Sbjct  244  IPKGPLKDKK  253



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  747  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  568
            GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A+
Sbjct  61   GGGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSAT  120

Query  567  SFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  388
            +FI K+ PHIPE+HIPE+ VL+ AS LR ++N    VLR IA GRDLK FLMV+ GLW++
Sbjct  121  TFIHKTPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDLKKFLMVVAGLWVL  180

Query  387  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKV  220
            SI+GS C FLTL YIA V+L TVPVLYEKYED+VD F EKAM E+KKQYAV D    +KV
Sbjct  181  SILGSSCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKV  240

Query  219  LSKIPRGPLKDKKL  178
            +SKIP G L  KKL
Sbjct  241  MSKIPIGALMKKKL  254



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +FLWSNA
Sbjct  64   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +F+KKS P IPE+ + EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  124  HAFMKKSPPKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSK
Sbjct  184  ISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSK  243

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  244  IPLASLKAK  252



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A
Sbjct  57   FGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSA  116

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K  PHIPEVHIPEE  LQ AS LR ++N    +LR+IA GR+LK FLMV+ GLW+
Sbjct  117  TTFIHKKPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGRELKKFLMVVAGLWV  176

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +K
Sbjct  177  LSKVGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSK  236

Query  222  VLSKIPRGPLKDKK  181
            V+SKIPRG    KK
Sbjct  237  VMSKIPRGAFNKKK  250



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
             GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A
Sbjct  58   FGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSA  117

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            ++FI K+ PHIPEVHIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW+
Sbjct  118  TTFIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDLKKFLLVIAGLWV  177

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AK  223
            +S VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +K
Sbjct  178  LSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  237

Query  222  VLSKIPRG  199
            V+SKIP+G
Sbjct  238  VMSKIPKG  245



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNKKIS  VL  ATA+WI FE+LEYHLLT V H LIL LAVLFLWSNA
Sbjct  64   LGGGKPADVLLWRNKKISASVLSVATAVWIFFELLEYHLLTLVGHILILLLAVLFLWSNA  123

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI K+ P IP VH+PEEP LQFASAL  ++N   A L  I SGRDLK FL+VI G WI
Sbjct  124  HTFIHKAPPRIPVVHLPEEPFLQFASALTIEINRGFAALHAIGSGRDLKTFLVVIVGTWI  183

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS  +F+TLFYI  VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSK
Sbjct  184  LSIVGSWVNFMTLFYIVFVLLHTVPVLYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLSK  243

Query  210  IPRGPLKDKKLA  175
            IP+GPLK KKLA
Sbjct  244  IPKGPLKYKKLA  255



>ref|XP_011037168.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+LFLWSNA
Sbjct  62   LGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALLFLWSNA  121

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             +FI KS P IP+VH+PEEPVLQ ASAL  ++N     LR IA+G+DLK FL+VI GLW+
Sbjct  122  HAFIYKSPPRIPQVHLPEEPVLQVASALCVEINGAYVFLRSIAAGKDLKKFLIVIAGLWV  181

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +SIVGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSK
Sbjct  182  MSIVGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSK  241

Query  210  IPRGPLKDKKL  178
            IP   LK KK+
Sbjct  242  IPVAALKAKKV  252



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA
Sbjct  63   LGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNA  122

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
             + I K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWI
Sbjct  123  HTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWI  182

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            IS+VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSK
Sbjct  183  ISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSK  242

Query  210  IPRGPLKDK  184
            IP   LK K
Sbjct  243  IPIASLKAK  251



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = -1

Query  750  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  571
            LGGGK ADV LWRNK +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+WSN 
Sbjct  51   LGGGKAADVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNG  110

Query  570  SSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWI  391
            S+F+KKS P IP+V IPE+PVL+F S  R ++N   + LRDIASG+DLK FL++I  LW 
Sbjct  111  STFLKKSPPRIPQVIIPEKPVLEFVSDARIEINRAFSSLRDIASGKDLKKFLLLIVVLWA  170

Query  390  ISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSK  211
            +S++GS  DFL+L Y+  V L T+P  YEKYEDE+D+FA  A  ELKKQYA FDAKVLSK
Sbjct  171  LSVLGSLFDFLSLVYLTTVSLLTLPSFYEKYEDEIDSFAHGAAAELKKQYAAFDAKVLSK  230

Query  210  IPRGPLKDKK  181
            IPRG L+++K
Sbjct  231  IPRGLLQNRK  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840