BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032H16

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK38726.1|AF369706_1  importin alpha 1                              273   2e-84   Capsicum annuum
ref|XP_009796205.1|  PREDICTED: importin subunit alpha-1                269   6e-83   Nicotiana sylvestris
ref|XP_009592620.1|  PREDICTED: importin subunit alpha-1                267   3e-82   Nicotiana tomentosiformis
ref|XP_006344784.1|  PREDICTED: importin subunit alpha-1                266   5e-82   Solanum tuberosum [potatoes]
ref|XP_004230322.1|  PREDICTED: importin subunit alpha-1                262   2e-80   Solanum lycopersicum
ref|XP_007031183.1|  Importin alpha isoform 1                           259   3e-79   Theobroma cacao [chocolate]
ref|XP_007031184.1|  Importin alpha isoform 2                           259   4e-79   
gb|ABB55384.1|  importin alpha 1-like                                   253   6e-78   Solanum tuberosum [potatoes]
ref|XP_002319478.1|  importin alpha-1 subunit family protein            254   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_007205030.1|  hypothetical protein PRUPE_ppa004046mg             251   4e-76   Prunus persica
ref|XP_011092170.1|  PREDICTED: importin subunit alpha                  251   7e-76   Sesamum indicum [beniseed]
ref|XP_011023801.1|  PREDICTED: importin subunit alpha                  250   9e-76   Populus euphratica
ref|XP_008246117.1|  PREDICTED: importin subunit alpha-1                250   1e-75   Prunus mume [ume]
ref|XP_010674568.1|  PREDICTED: importin subunit alpha-1a               249   2e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB26294.1|  hypothetical protein B456_004G235800                    249   2e-75   Gossypium raimondii
gb|KDP23371.1|  hypothetical protein JCGZ_23204                         249   4e-75   Jatropha curcas
ref|XP_010549392.1|  PREDICTED: importin subunit alpha-1                247   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_010270837.1|  PREDICTED: importin subunit alpha-like             246   2e-74   Nelumbo nucifera [Indian lotus]
emb|CAN64716.1|  hypothetical protein VITISV_026717                     246   3e-74   Vitis vinifera
ref|XP_002281670.1|  PREDICTED: importin subunit alpha                  246   4e-74   Vitis vinifera
ref|XP_008453295.1|  PREDICTED: importin subunit alpha                  243   4e-73   Cucumis melo [Oriental melon]
ref|XP_002512528.1|  importin alpha, putative                           241   5e-73   
emb|CDX94988.1|  BnaC05g06830D                                          243   5e-73   
ref|XP_010024140.1|  PREDICTED: importin subunit alpha                  243   1e-72   Eucalyptus grandis [rose gum]
ref|NP_001275782.1|  importin alpha                                     242   1e-72   Citrus sinensis [apfelsine]
gb|KFK43224.1|  hypothetical protein AALP_AA1G096500                    242   1e-72   Arabis alpina [alpine rockcress]
ref|XP_008370371.1|  PREDICTED: importin subunit alpha-like             241   2e-72   
ref|XP_009337642.1|  PREDICTED: importin subunit alpha-like isofo...    241   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_009337641.1|  PREDICTED: importin subunit alpha-like isofo...    241   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_010267916.1|  PREDICTED: importin subunit alpha-like             241   3e-72   Nelumbo nucifera [Indian lotus]
gb|ABO21639.1|  importin alpha-like protein                             239   1e-71   Brassica napus [oilseed rape]
ref|XP_009148181.1|  PREDICTED: importin subunit alpha-1                239   1e-71   Brassica rapa
emb|CDX93514.1|  BnaA06g05340D                                          239   1e-71   
ref|XP_010475758.1|  PREDICTED: importin subunit alpha-1a-like          238   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010544159.1|  PREDICTED: importin subunit alpha-1b-like          236   2e-70   Tarenaya hassleriana [spider flower]
emb|CDY31102.1|  BnaA08g26520D                                          236   2e-70   Brassica napus [oilseed rape]
ref|XP_008388467.1|  PREDICTED: importin subunit alpha-1                236   2e-70   
ref|XP_009373302.1|  PREDICTED: importin subunit alpha-1-like           236   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_006417589.1|  hypothetical protein EUTSA_v10007310mg             236   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_004302281.1|  PREDICTED: importin subunit alpha-4                235   4e-70   Fragaria vesca subsp. vesca
emb|CDY32165.1|  BnaCnng06740D                                          234   1e-69   Brassica napus [oilseed rape]
ref|XP_010458212.1|  PREDICTED: importin subunit alpha-1b-like is...    233   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010914627.1|  PREDICTED: importin subunit alpha isoform X2       233   3e-69   Elaeis guineensis
ref|XP_010458211.1|  PREDICTED: importin subunit alpha-1b-like is...    233   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004144743.1|  PREDICTED: importin subunit alpha-1-like           233   5e-69   Cucumis sativus [cucumbers]
ref|XP_009110839.1|  PREDICTED: importin subunit alpha-1-like iso...    232   8e-69   Brassica rapa
ref|XP_006304709.1|  hypothetical protein CARUB_v10011976mg             232   9e-69   Capsella rubella
ref|XP_010914626.1|  PREDICTED: importin subunit alpha isoform X1       232   9e-69   Elaeis guineensis
ref|XP_008801729.1|  PREDICTED: importin subunit alpha-1a isoform X2    231   2e-68   Phoenix dactylifera
ref|XP_002889740.1|  hypothetical protein ARALYDRAFT_888168             231   2e-68   Arabidopsis lyrata subsp. lyrata
gb|EYU38410.1|  hypothetical protein MIMGU_mgv1a004192mg                231   2e-68   Erythranthe guttata [common monkey flower]
ref|XP_010931776.1|  PREDICTED: importin subunit alpha-like             231   3e-68   Elaeis guineensis
ref|XP_008806746.1|  PREDICTED: importin subunit alpha-1-like           219   1e-67   
ref|XP_003554623.1|  PREDICTED: importin subunit alpha-1-like           228   3e-67   Glycine max [soybeans]
ref|XP_006488809.1|  PREDICTED: importin subunit alpha-1b-like          227   6e-67   Citrus sinensis [apfelsine]
ref|XP_003521670.1|  PREDICTED: importin subunit alpha-1-like           227   6e-67   Glycine max [soybeans]
gb|KHN03948.1|  Importin subunit alpha                                  227   6e-67   Glycine soja [wild soybean]
ref|XP_006842676.1|  hypothetical protein AMTR_s00147p00043750          227   7e-67   Amborella trichopoda
gb|KDO72000.1|  hypothetical protein CISIN_1g009700mg                   226   2e-66   Citrus sinensis [apfelsine]
emb|CAA74966.1|  Importin alpha-like protein                            225   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494548.1|  PREDICTED: importin subunit alpha-like             225   3e-66   Cicer arietinum [garbanzo]
ref|XP_002519178.1|  importin alpha, putative                           224   4e-66   
gb|KDP27876.1|  hypothetical protein JCGZ_18956                         225   4e-66   Jatropha curcas
ref|XP_003536050.1|  PREDICTED: importin subunit alpha-1-like           225   4e-66   Glycine max [soybeans]
ref|NP_001031011.1|  importin alpha isoform 4                           223   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801728.1|  PREDICTED: importin subunit alpha-1a isoform X1    225   5e-66   Phoenix dactylifera
gb|KHN16078.1|  Importin subunit alpha-1                                224   5e-66   Glycine soja [wild soybean]
gb|AES82394.2|  importin subunit alpha-1b                               224   8e-66   Medicago truncatula
ref|XP_003556535.1|  PREDICTED: importin subunit alpha-1-like iso...    224   9e-66   Glycine max [soybeans]
ref|NP_172398.1|  importin alpha isoform 4                              224   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023748.1|  PREDICTED: importin subunit alpha-1-like iso...    224   1e-65   Populus euphratica
ref|XP_003626176.1|  Importin subunit alpha                             224   1e-65   
ref|XP_011023747.1|  PREDICTED: importin subunit alpha-1-like iso...    223   1e-65   Populus euphratica
ref|XP_009781700.1|  PREDICTED: importin subunit alpha-1-like iso...    221   2e-65   Nicotiana sylvestris
ref|XP_003591197.1|  Importin subunit alpha-1                           223   2e-65   Medicago truncatula
gb|ACF86631.1|  unknown                                                 214   3e-65   Zea mays [maize]
ref|XP_002318966.1|  Importin alpha-1 subunit family protein            223   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_007144986.1|  hypothetical protein PHAVU_007G199900g             223   3e-65   Phaseolus vulgaris [French bean]
gb|KDP23418.1|  hypothetical protein JCGZ_23251                         223   3e-65   Jatropha curcas
ref|XP_006380207.1|  hypothetical protein POPTR_0008s22930g             223   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010095558.1|  Importin subunit alpha                             224   3e-65   
ref|XP_006382424.1|  Importin alpha-1 subunit family protein            222   4e-65   Populus trichocarpa [western balsam poplar]
ref|XP_011013186.1|  PREDICTED: importin subunit alpha-1-like           222   4e-65   Populus euphratica
ref|XP_009781699.1|  PREDICTED: importin subunit alpha-1-like iso...    222   5e-65   Nicotiana sylvestris
gb|EYU25627.1|  hypothetical protein MIMGU_mgv1a004356mg                222   5e-65   Erythranthe guttata [common monkey flower]
ref|XP_010684628.1|  PREDICTED: importin subunit alpha                  222   5e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN12909.1|  Importin subunit alpha-1                                222   6e-65   Glycine soja [wild soybean]
gb|AFW77280.1|  hypothetical protein ZEAMMB73_231111                    213   6e-65   
ref|XP_003546338.1|  PREDICTED: importin subunit alpha-1-like iso...    222   6e-65   Glycine max [soybeans]
ref|XP_003533220.1|  PREDICTED: importin subunit alpha-1-like iso...    222   7e-65   
ref|XP_004495675.1|  PREDICTED: importin subunit alpha-1b-like is...    220   7e-65   
gb|KHN14650.1|  Importin subunit alpha-1                                221   7e-65   Glycine soja [wild soybean]
ref|XP_004244944.1|  PREDICTED: importin subunit alpha-1                221   7e-65   Solanum lycopersicum
ref|XP_009621534.1|  PREDICTED: importin subunit alpha-1-like           221   8e-65   Nicotiana tomentosiformis
ref|XP_010931697.1|  PREDICTED: importin subunit alpha-1b               221   9e-65   Elaeis guineensis
ref|XP_008797160.1|  PREDICTED: importin subunit alpha-1b-like          221   1e-64   Phoenix dactylifera
ref|XP_008810191.1|  PREDICTED: importin subunit alpha-1b-like          221   1e-64   Phoenix dactylifera
ref|NP_187328.1|  Importin subunit alpha-1                              221   1e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75513.1|  Importin alpha-like protein                            221   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495674.1|  PREDICTED: importin subunit alpha-1b-like is...    221   1e-64   Cicer arietinum [garbanzo]
gb|AAL06825.1|  AT3g06720/F3E22_14                                      221   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036930.1|  PREDICTED: importin subunit alpha-1 isoform X1     221   1e-64   Populus euphratica
gb|AAB72116.2|  AtKAP alpha                                             221   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036931.1|  PREDICTED: importin subunit alpha-1 isoform X2     221   1e-64   Populus euphratica
ref|XP_006345634.1|  PREDICTED: importin subunit alpha-1-like           221   2e-64   Solanum tuberosum [potatoes]
ref|XP_010486198.1|  PREDICTED: importin subunit alpha-1 isoform X1     221   2e-64   Camelina sativa [gold-of-pleasure]
gb|EEC78554.1|  hypothetical protein OsI_18524                          220   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010444089.1|  PREDICTED: importin subunit alpha-1-like           221   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010094009.1|  Importin subunit alpha-1                           221   2e-64   Morus notabilis
ref|XP_002512485.1|  importin alpha, putative                           221   2e-64   Ricinus communis
ref|XP_010464259.1|  PREDICTED: importin subunit alpha-1-like           221   2e-64   Camelina sativa [gold-of-pleasure]
gb|KDP28222.1|  hypothetical protein JCGZ_13993                         220   2e-64   Jatropha curcas
ref|XP_002882488.1|  AT-IMP                                             220   2e-64   
ref|XP_010914512.1|  PREDICTED: importin subunit alpha-1b-like          220   3e-64   Elaeis guineensis
ref|XP_004487798.1|  PREDICTED: importin subunit alpha-1-like           220   3e-64   Cicer arietinum [garbanzo]
ref|NP_001054692.1|  Os05g0155500                                       220   4e-64   
ref|XP_007205032.1|  hypothetical protein PRUPE_ppa004091mg             219   7e-64   Prunus persica
gb|KHN03320.1|  Importin subunit alpha-1                                218   8e-64   Glycine soja [wild soybean]
ref|XP_008245768.1|  PREDICTED: importin subunit alpha-1                219   8e-64   Prunus mume [ume]
gb|KJB82641.1|  hypothetical protein B456_013G206500                    219   8e-64   Gossypium raimondii
ref|XP_007138966.1|  hypothetical protein PHAVU_009G253500g             219   8e-64   Phaseolus vulgaris [French bean]
ref|XP_007051048.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 1         219   9e-64   
ref|XP_006297392.1|  hypothetical protein CARUB_v10013416mg             219   9e-64   Capsella rubella
ref|XP_010268071.1|  PREDICTED: importin subunit alpha-1-like           218   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_006655009.1|  PREDICTED: importin subunit alpha-1b-like          218   1e-63   Oryza brachyantha
dbj|BAE71209.1|  putative importin alpha                                218   2e-63   Trifolium pratense [peavine clover]
ref|XP_002275593.1|  PREDICTED: importin subunit alpha-1 isoform X1     218   2e-63   
gb|ABM05487.1|  Impa1                                                   218   2e-63   Nicotiana benthamiana
dbj|BAA88950.1|  importin alpha 1b                                      218   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KHG29743.1|  Importin subunit alpha-1 -like protein                  218   2e-63   Gossypium arboreum [tree cotton]
ref|XP_011046400.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    218   2e-63   Populus euphratica
ref|XP_010093918.1|  Importin subunit alpha                             222   2e-63   
gb|KJB41861.1|  hypothetical protein B456_007G124900                    216   2e-63   Gossypium raimondii
ref|XP_009606138.1|  PREDICTED: importin subunit alpha                  218   3e-63   Nicotiana tomentosiformis
gb|KHN02923.1|  Importin subunit alpha-1                                218   3e-63   Glycine soja [wild soybean]
gb|KHG28859.1|  Importin subunit alpha-1                                218   3e-63   Gossypium arboreum [tree cotton]
ref|XP_010649543.1|  PREDICTED: importin subunit alpha-1 isoform X2     217   3e-63   
ref|XP_003550530.1|  PREDICTED: importin subunit alpha-1-like           217   3e-63   Glycine max [soybeans]
gb|KJB24393.1|  hypothetical protein B456_004G143100                    217   3e-63   Gossypium raimondii
dbj|BAK07842.1|  predicted protein                                      211   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB24392.1|  hypothetical protein B456_004G143100                    217   4e-63   Gossypium raimondii
ref|XP_009789105.1|  PREDICTED: importin subunit alpha                  217   4e-63   Nicotiana sylvestris
ref|XP_010094336.1|  Importin subunit alpha-1                           217   4e-63   Morus notabilis
ref|XP_008458386.1|  PREDICTED: importin subunit alpha-1-like           217   4e-63   Cucumis melo [Oriental melon]
gb|KJB41862.1|  hypothetical protein B456_007G124900                    217   4e-63   Gossypium raimondii
gb|KHG01621.1|  Importin subunit alpha-1 -like protein                  217   4e-63   Gossypium arboreum [tree cotton]
gb|AFW81447.1|  hypothetical protein ZEAMMB73_731576                    217   5e-63   
ref|XP_004150082.1|  PREDICTED: importin subunit alpha-1-like           217   5e-63   Cucumis sativus [cucumbers]
ref|XP_006378029.1|  hypothetical protein POPTR_0010s00370g             210   5e-63   
ref|NP_001141568.1|  uncharacterized protein LOC100273684               216   5e-63   Zea mays [maize]
gb|KHG28860.1|  Importin subunit alpha-1                                217   6e-63   Gossypium arboreum [tree cotton]
ref|XP_007031099.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 2         216   6e-63   
ref|XP_008350735.1|  PREDICTED: importin subunit alpha-1b-like          208   7e-63   
gb|AES65063.2|  importin subunit alpha-1b                               216   7e-63   Medicago truncatula
ref|XP_004977076.1|  PREDICTED: importin subunit alpha-1b-like is...    216   7e-63   Setaria italica
emb|CDP17235.1|  unnamed protein product                                216   7e-63   Coffea canephora [robusta coffee]
ref|XP_010259399.1|  PREDICTED: importin subunit alpha-1                216   8e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010231685.1|  PREDICTED: importin subunit alpha-1b               216   1e-62   Brachypodium distachyon [annual false brome]
ref|XP_008360253.1|  PREDICTED: importin subunit alpha-1-like iso...    215   1e-62   
ref|XP_004144766.1|  PREDICTED: importin subunit alpha-1-like           216   1e-62   Cucumis sativus [cucumbers]
ref|XP_002440631.1|  hypothetical protein SORBIDRAFT_09g004320          216   1e-62   Sorghum bicolor [broomcorn]
ref|XP_007163337.1|  hypothetical protein PHAVU_001G226400g             215   2e-62   Phaseolus vulgaris [French bean]
ref|XP_003594812.1|  Importin subunit alpha-1                           216   2e-62   
ref|XP_002515324.1|  importin alpha, putative                           213   2e-62   
ref|XP_009393195.1|  PREDICTED: importin subunit alpha-1b-like          215   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49857.1|  hypothetical protein B456_008G142000                    215   2e-62   Gossypium raimondii
ref|XP_009369966.1|  PREDICTED: importin subunit alpha-1-like           215   3e-62   Pyrus x bretschneideri [bai li]
gb|KHG15238.1|  Importin subunit alpha-1 -like protein                  214   3e-62   Gossypium arboreum [tree cotton]
gb|KDO87079.1|  hypothetical protein CISIN_1g009679mg                   212   4e-62   Citrus sinensis [apfelsine]
ref|XP_004295110.1|  PREDICTED: importin subunit alpha-1-like           214   5e-62   Fragaria vesca subsp. vesca
ref|XP_008360251.1|  PREDICTED: importin subunit alpha-1-like iso...    214   6e-62   
ref|XP_001760522.1|  predicted protein                                  214   6e-62   
ref|XP_006480039.1|  PREDICTED: importin subunit alpha-like             214   7e-62   Citrus sinensis [apfelsine]
ref|XP_009412111.1|  PREDICTED: importin subunit alpha-1b-like          213   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001234006.1|  importin subunit alpha                             213   1e-61   Solanum lycopersicum
ref|XP_008781168.1|  PREDICTED: importin subunit alpha-like isofo...    213   1e-61   Phoenix dactylifera
gb|EPS72677.1|  impa2                                                   204   1e-61   Genlisea aurea
gb|KDO87077.1|  hypothetical protein CISIN_1g009679mg                   212   1e-61   Citrus sinensis [apfelsine]
ref|XP_006407910.1|  hypothetical protein EUTSA_v10020480mg             213   1e-61   Eutrema salsugineum [saltwater cress]
gb|EMT29219.1|  Importin subunit alpha-1b                               213   2e-61   
ref|XP_004158728.1|  PREDICTED: importin subunit alpha-1-like           212   2e-61   
ref|XP_010024115.1|  PREDICTED: importin subunit alpha-1a               212   2e-61   Eucalyptus grandis [rose gum]
ref|XP_008453860.1|  PREDICTED: importin subunit alpha-1                212   3e-61   Cucumis melo [Oriental melon]
gb|AII99829.1|  importin alpha                                          212   3e-61   Nicotiana tabacum [American tobacco]
ref|XP_011092122.1|  PREDICTED: importin subunit alpha-1                212   3e-61   Sesamum indicum [beniseed]
ref|XP_009631847.1|  PREDICTED: importin subunit alpha-1a-like          212   3e-61   Nicotiana tomentosiformis
ref|XP_004302255.1|  PREDICTED: importin subunit alpha-1                212   3e-61   Fragaria vesca subsp. vesca
ref|XP_009796163.1|  PREDICTED: importin subunit alpha-1a-like          212   3e-61   Nicotiana sylvestris
ref|XP_010548966.1|  PREDICTED: importin subunit alpha-1-like           211   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_009414157.1|  PREDICTED: importin subunit alpha-1a-like          212   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373267.1|  PREDICTED: importin subunit alpha-1b               212   4e-61   Pyrus x bretschneideri [bai li]
ref|XP_009347771.1|  PREDICTED: importin subunit alpha-1-like           212   4e-61   Pyrus x bretschneideri [bai li]
emb|CDO98799.1|  unnamed protein product                                211   4e-61   Coffea canephora [robusta coffee]
ref|XP_007154341.1|  hypothetical protein PHAVU_003G110500g             211   4e-61   Phaseolus vulgaris [French bean]
ref|XP_008781167.1|  PREDICTED: importin subunit alpha-like isofo...    212   5e-61   Phoenix dactylifera
gb|ABM05488.1|  Impa2                                                   211   5e-61   Nicotiana benthamiana
ref|XP_001773629.1|  predicted protein                                  211   5e-61   
ref|XP_008345591.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    211   5e-61   
ref|XP_009612538.1|  PREDICTED: importin subunit alpha-1a-like          211   6e-61   Nicotiana tomentosiformis
ref|XP_007222489.1|  hypothetical protein PRUPE_ppa004118mg             211   6e-61   Prunus persica
ref|XP_002274422.1|  PREDICTED: importin subunit alpha                  211   6e-61   Vitis vinifera
ref|XP_002282816.1|  PREDICTED: importin subunit alpha-1                211   7e-61   Vitis vinifera
emb|CDO98800.1|  unnamed protein product                                211   8e-61   Coffea canephora [robusta coffee]
ref|XP_009338212.1|  PREDICTED: importin subunit alpha-1-like           211   9e-61   Pyrus x bretschneideri [bai li]
ref|XP_001763761.1|  predicted protein                                  210   1e-60   
ref|XP_008388495.1|  PREDICTED: importin subunit alpha-1b-like          210   1e-60   Malus domestica [apple tree]
ref|XP_007031098.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    211   2e-60   
ref|XP_001778004.1|  predicted protein                                  210   2e-60   
ref|XP_008223291.1|  PREDICTED: importin subunit alpha-1-like           210   2e-60   Prunus mume [ume]
gb|KHG14170.1|  Importin subunit alpha-1 -like protein                  206   2e-60   Gossypium arboreum [tree cotton]
ref|XP_010043209.1|  PREDICTED: importin subunit alpha-1a-like          209   3e-60   Eucalyptus grandis [rose gum]
gb|AIU34461.1|  putative importin subunit alpha-2                       209   3e-60   Taraxacum brevicorniculatum
ref|XP_009402512.1|  PREDICTED: importin subunit alpha-1b-like          209   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU46779.1|  hypothetical protein MIMGU_mgv1a0058492mg               205   4e-60   Erythranthe guttata [common monkey flower]
gb|AGZ15387.1|  importin alpha                                          209   4e-60   Phaseolus vulgaris [French bean]
ref|XP_008340751.1|  PREDICTED: importin subunit alpha-1                209   6e-60   
ref|XP_009401503.1|  PREDICTED: importin subunit alpha-1b-like          208   6e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010546997.1|  PREDICTED: importin subunit alpha-1                208   8e-60   Tarenaya hassleriana [spider flower]
ref|XP_009763482.1|  PREDICTED: importin subunit alpha-1a-like          207   2e-59   Nicotiana sylvestris
emb|CDY34430.1|  BnaC01g22030D                                          207   3e-59   Brassica napus [oilseed rape]
ref|XP_011079596.1|  PREDICTED: importin subunit alpha-like             207   3e-59   Sesamum indicum [beniseed]
ref|XP_009146474.1|  PREDICTED: importin subunit alpha-1-like           206   3e-59   Brassica rapa
ref|XP_010489893.1|  PREDICTED: importin subunit alpha-1-like           207   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_011082432.1|  PREDICTED: importin subunit alpha-like             206   4e-59   Sesamum indicum [beniseed]
ref|XP_010558435.1|  PREDICTED: importin subunit alpha-1-like           206   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_011041680.1|  PREDICTED: importin subunit alpha-like             206   5e-59   Populus euphratica
gb|AAM96997.1|  unknown protein                                         200   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355841.1|  PREDICTED: importin subunit alpha-like             206   6e-59   Solanum tuberosum [potatoes]
ref|XP_002519264.1|  importin alpha, putative                           204   7e-59   Ricinus communis
ref|XP_006355403.1|  PREDICTED: importin subunit alpha-1-like iso...    206   8e-59   Solanum tuberosum [potatoes]
ref|XP_010434881.1|  PREDICTED: importin subunit alpha-1-like           205   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004228994.1|  PREDICTED: importin subunit alpha-1a               205   1e-58   Solanum lycopersicum
ref|XP_002320318.1|  hypothetical protein POPTR_0014s11920g             205   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010024770.1|  PREDICTED: importin subunit alpha-1                204   2e-58   Eucalyptus grandis [rose gum]
ref|NP_171769.1|  importin alpha isoform 6                              204   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973743.1|  importin alpha isoform 6                              204   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001773628.1|  predicted protein                                  204   2e-58   
gb|AHJ25927.1|  importin subunit alpha-1                                204   3e-58   Senecio scandens
gb|KJB28705.1|  hypothetical protein B456_005G065400                    204   3e-58   Gossypium raimondii
ref|XP_009107883.1|  PREDICTED: importin subunit alpha-1-like           204   3e-58   Brassica rapa
emb|CDY22779.1|  BnaA08g06090D                                          204   3e-58   Brassica napus [oilseed rape]
emb|CDY52043.1|  BnaC08g48070D                                          204   3e-58   Brassica napus [oilseed rape]
gb|EPS62504.1|  hypothetical protein M569_12283                         204   4e-58   Genlisea aurea
gb|AAK38727.1|AF369707_1  importin alpha 2                              204   4e-58   Capsicum annuum
emb|CDY09716.1|  BnaC07g33450D                                          204   4e-58   Brassica napus [oilseed rape]
gb|KDP27954.1|  hypothetical protein JCGZ_19034                         204   4e-58   Jatropha curcas
gb|AFW79686.1|  importin alpha-1b subunit, mRNA                         199   4e-58   
ref|XP_006414387.1|  hypothetical protein EUTSA_v10024884mg             204   4e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009136744.1|  PREDICTED: importin subunit alpha-1                204   5e-58   Brassica rapa
gb|AAK32824.1|AF361811_1  AT3g06720/F3E22_14                            203   6e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74965.1|  Importin alpha-like protein                            203   6e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42624.1|  hypothetical protein AALP_AA1G019500                    203   6e-58   Arabis alpina [alpine rockcress]
gb|EMS47918.1|  Importin subunit alpha-1a                               203   7e-58   Triticum urartu
ref|XP_006285325.1|  hypothetical protein CARUB_v10006712mg             203   7e-58   Capsella rubella
ref|NP_001154239.1|  importin alpha isoform 2                           203   7e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09437.1|  hypothetical protein B456_001G142300                    202   1e-57   Gossypium raimondii
ref|XP_011100802.1|  PREDICTED: importin subunit alpha-1a-like          202   1e-57   Sesamum indicum [beniseed]
ref|XP_002868159.1|  AT3g06720/F3E22_14                                 203   1e-57   
ref|XP_004967840.1|  PREDICTED: importin subunit alpha-1a-like          202   2e-57   Setaria italica
ref|XP_007031101.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    202   2e-57   
ref|XP_002302745.2|  hypothetical protein POPTR_0002s20060g             202   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011042196.1|  PREDICTED: importin subunit alpha-like             202   3e-57   Populus euphratica
ref|XP_003566399.1|  PREDICTED: importin subunit alpha-1a               201   3e-57   Brachypodium distachyon [annual false brome]
gb|KDO71825.1|  hypothetical protein CISIN_1g009544mg                   199   4e-57   Citrus sinensis [apfelsine]
ref|XP_010551087.1|  PREDICTED: importin subunit alpha-1-like           201   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_010670910.1|  PREDICTED: importin subunit alpha-1                201   5e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008673870.1|  PREDICTED: importin subunit alpha-1a               201   5e-57   Zea mays [maize]
ref|XP_006488879.1|  PREDICTED: importin subunit alpha-1-like           201   7e-57   Citrus sinensis [apfelsine]
gb|KDO71823.1|  hypothetical protein CISIN_1g009544mg                   200   7e-57   Citrus sinensis [apfelsine]
ref|XP_010556709.1|  PREDICTED: importin subunit alpha-2-like           200   8e-57   Tarenaya hassleriana [spider flower]
gb|EYU44000.1|  hypothetical protein MIMGU_mgv1a004419mg                200   8e-57   Erythranthe guttata [common monkey flower]
pdb|4BQK|B  Chain B, Rice Importin_alpha : Vird2nls Complex             198   1e-56   Agrobacterium tumefaciens
pdb|4BQK|A  Chain A, Rice Importin_alpha : Vird2nls Complex             198   1e-56   Agrobacterium tumefaciens
pdb|4BPL|A  Chain A, Rice Importin_alpha In Complex With Nucleopl...    198   1e-56   Xenopus
pdb|2YNS|A  Chain A, Rimp_alpha_b54nls                                  199   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042611.1|  Os01g0253300                                       199   2e-56   
ref|XP_004977075.1|  PREDICTED: importin subunit alpha-1b-like is...    200   2e-56   
gb|EAY73331.1|  hypothetical protein OsI_01208                          199   2e-56   Oryza sativa Indica Group [Indian rice]
pdb|4B8J|A  Chain A, Rimp_alpha1a                                       199   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644004.1|  PREDICTED: importin subunit alpha-1a-like          198   3e-56   
ref|NP_001148537.1|  LOC100282153                                       198   5e-56   
dbj|BAJ34004.1|  unnamed protein product                                193   5e-56   
ref|XP_007035863.1|  Importin alpha, putative                           199   6e-56   
ref|XP_004508265.1|  PREDICTED: importin subunit alpha-1-like           197   1e-55   
gb|KDO81726.1|  hypothetical protein CISIN_1g009184mg                   197   1e-55   
ref|XP_006472169.1|  PREDICTED: importin subunit alpha-1b-like          197   1e-55   
gb|KHG26190.1|  Importin subunit alpha-1 -like protein                  197   2e-55   
gb|KJB12653.1|  hypothetical protein B456_002G029800                    196   2e-55   
gb|KJB12655.1|  hypothetical protein B456_002G029800                    196   2e-55   
gb|AAQ13406.1|AF005265_1  importin                                      196   2e-55   
emb|CDY01921.1|  BnaC02g28060D                                          195   5e-55   
ref|XP_002961054.1|  hypothetical protein SELMODRAFT_266556             195   8e-55   
ref|XP_002966958.1|  hypothetical protein SELMODRAFT_439828             195   8e-55   
ref|XP_006396421.1|  hypothetical protein EUTSA_v10028572mg             195   9e-55   
emb|CDX97257.1|  BnaA02g20480D                                          195   1e-54   
ref|XP_009128526.1|  PREDICTED: importin subunit alpha-2-like           194   1e-54   
ref|XP_006307204.1|  hypothetical protein CARUB_v10008795mg             195   1e-54   
ref|XP_003610377.1|  Importin alpha-1b subunit                          192   2e-54   
gb|EMS45808.1|  Importin subunit alpha-1b                               196   2e-54   
ref|XP_007035722.1|  Importin alpha isoform 2                           194   2e-54   
ref|XP_007035721.1|  Importin alpha isoform 1                           194   2e-54   
emb|CDY15260.1|  BnaC05g01390D                                          193   4e-53   
ref|XP_004306871.1|  PREDICTED: importin subunit alpha-1-like           189   1e-52   
ref|XP_010474848.1|  PREDICTED: importin subunit alpha-2                189   2e-52   
ref|XP_002508520.1|  predicted protein                                  188   2e-52   
gb|KEH32336.1|  importin subunit alpha                                  185   4e-51   
emb|CDX89948.1|  BnaA10g01340D                                          185   4e-51   
ref|XP_009119620.1|  PREDICTED: importin subunit alpha-1                185   4e-51   
ref|XP_010456072.1|  PREDICTED: importin subunit alpha-2                184   4e-51   
ref|XP_010424664.1|  PREDICTED: importin subunit alpha-2-like           184   4e-51   
ref|NP_192124.1|  Importin alpha 3                                      185   5e-51   
emb|CAA70703.1|  Kap alpha protein                                      185   5e-51   
emb|CAA75514.1|  Importin alpha-like protein                            184   6e-51   
ref|XP_010522815.1|  PREDICTED: importin subunit alpha isoform X1       184   8e-51   
ref|XP_010501291.1|  PREDICTED: importin subunit alpha-2-like           187   2e-50   
ref|XP_006289883.1|  hypothetical protein CARUB_v10003501mg             183   3e-50   
gb|AES92711.2|  importin subunit alpha-like protein                     182   4e-50   
ref|XP_003610514.1|  Importin alpha-1b subunit                          182   5e-50   
gb|AES92265.2|  importin subunit alpha                                  180   8e-50   
ref|XP_010429262.1|  PREDICTED: importin subunit alpha-2                181   8e-50   
ref|XP_007510824.1|  predicted protein                                  181   1e-49   
ref|XP_002872853.1|  ATIMPALPHA3/MOS6                                   181   1e-49   
gb|KEH28816.1|  importin subunit alpha                                  176   1e-49   
ref|XP_003610068.1|  Importin alpha-1b subunit                          180   1e-49   
gb|KEH18646.1|  importin subunit alpha-like protein                     178   3e-49   
ref|XP_003638654.1|  Importin subunit alpha                             178   3e-49   
ref|XP_005849695.1|  hypothetical protein CHLNCDRAFT_30497              178   2e-48   
ref|XP_003609724.1|  Importin alpha-1b subunit                          177   5e-48   
ref|XP_005646985.1|  importin alpha                                     177   5e-48   
gb|KHN03926.1|  Importin subunit alpha                                  176   7e-48   
ref|XP_003520790.1|  PREDICTED: importin subunit alpha-like             176   7e-48   
gb|KEH32656.1|  importin subunit alpha                                  171   1e-47   
gb|KJB34728.1|  hypothetical protein B456_006G080400                    175   2e-47   
gb|KDD73677.1|  hypothetical protein H632_c1936p0                       174   4e-47   
ref|XP_003057280.1|  predicted protein                                  174   6e-47   
gb|AES92706.2|  importin subunit alpha                                  172   7e-47   
gb|KDO42368.1|  hypothetical protein CISIN_1g043676mg                   172   7e-47   
emb|CDY64806.1|  BnaCnng45030D                                          173   7e-47   
ref|XP_001698656.1|  importin alpha                                     173   1e-46   
ref|XP_001419614.1|  predicted protein                                  172   2e-46   
ref|XP_003610509.1|  Importin alpha-1b subunit                          172   3e-46   
ref|XP_008246369.1|  PREDICTED: importin subunit alpha-like             168   4e-46   
gb|AES92712.2|  importin subunit alpha-like protein                     171   5e-46   
ref|XP_006471707.1|  PREDICTED: importin subunit alpha-1a-like          172   1e-45   
ref|XP_002590287.1|  hypothetical protein BRAFLDRAFT_279360             170   1e-45   
gb|KDO38014.1|  hypothetical protein CISIN_1g0355071mg                  171   1e-45   
ref|XP_003610515.1|  Importin alpha-1b subunit                          171   2e-45   
emb|CEF99159.1|  Armadillo-type fold                                    169   2e-45   
dbj|BAB24841.1|  unnamed protein product                                160   3e-45   
emb|CDX90948.1|  BnaA03g26280D                                          169   4e-45   
ref|XP_009134443.1|  PREDICTED: importin subunit alpha-2-like           169   4e-45   
gb|AAG42106.2|  karyopherin alpha 6                                     159   9e-45   
ref|XP_005758728.1|  hypothetical protein EMIHUDRAFT_460128             167   1e-44   
ref|XP_005778844.1|  hypothetical protein EMIHUDRAFT_421349             167   1e-44   
gb|KDO44063.1|  hypothetical protein CISIN_1g043116mg                   166   2e-44   
gb|KFK30907.1|  hypothetical protein AALP_AA6G041500                    167   2e-44   
ref|XP_010495334.1|  PREDICTED: importin subunit alpha-1-like           166   3e-44   
gb|KFK30823.1|  hypothetical protein AALP_AA6G030600                    169   4e-44   
gb|EEE54508.1|  hypothetical protein OsJ_01650                          164   8e-44   
gb|KDO41451.1|  hypothetical protein CISIN_1g037142mg                   162   1e-43   
gb|EDL80567.1|  karyopherin (importin) alpha 6                          159   1e-43   
ref|NP_001042958.1|  Os01g0343200                                       165   1e-43   
ref|XP_010513590.1|  PREDICTED: importin subunit alpha-1-like           162   2e-43   
ref|XP_006494504.1|  PREDICTED: uncharacterized protein LOC102608704    159   4e-43   
gb|EMP28421.1|  Importin subunit alpha-7                                162   5e-43   
ref|XP_006471848.1|  PREDICTED: importin subunit alpha-1a-like          160   7e-43   
ref|XP_010440459.1|  PREDICTED: importin subunit alpha-1-like           162   9e-43   
ref|XP_009870457.1|  PREDICTED: importin subunit alpha-5-like           154   1e-42   
ref|XP_005302236.1|  PREDICTED: importin subunit alpha-7                162   1e-42   
ref|XP_009967872.1|  PREDICTED: importin subunit alpha-5-like           153   1e-42   
gb|EAX07569.1|  karyopherin alpha 6 (importin alpha 7), isoform C...    157   1e-42   
emb|CDY05638.1|  BnaC02g38990D                                          162   2e-42   
gb|KFK30899.1|  hypothetical protein AALP_AA6G040600                    160   2e-42   
ref|XP_002957574.1|  hypothetical protein VOLCADRAFT_84159              161   2e-42   
ref|XP_010144524.1|  PREDICTED: importin subunit alpha-5-like           155   2e-42   
gb|KDO52349.1|  hypothetical protein CISIN_1g042204mg                   161   2e-42   
gb|KJB81070.1|  hypothetical protein B456_013G128000                    154   3e-42   
ref|XP_006471714.1|  PREDICTED: importin subunit alpha-1-like iso...    159   3e-42   
ref|XP_011305943.1|  PREDICTED: importin subunit alpha-7 isoform X2     161   3e-42   
ref|XP_011305942.1|  PREDICTED: importin subunit alpha-7 isoform X1     161   3e-42   
ref|XP_008945481.1|  PREDICTED: importin subunit alpha-5-like           156   3e-42   
gb|ELU00208.1|  hypothetical protein CAPTEDRAFT_220826                  160   3e-42   
ref|XP_006117607.1|  PREDICTED: importin subunit alpha-7                160   5e-42   
ref|XP_007908530.1|  PREDICTED: importin subunit alpha-6                160   5e-42   
ref|XP_006089256.1|  PREDICTED: importin subunit alpha-6 isoform X2     160   5e-42   
gb|KEH41663.1|  importin subunit alpha                                  157   5e-42   
ref|XP_006494501.1|  PREDICTED: disease resistance protein At4g27...    164   5e-42   
ref|XP_011396312.1|  Importin subunit alpha-1                           160   6e-42   
ref|XP_006494500.1|  PREDICTED: disease resistance protein At4g27...    164   6e-42   
gb|KEH41662.1|  importin subunit alpha                                  156   6e-42   
gb|KDO38489.1|  hypothetical protein CISIN_1g043950mg                   159   6e-42   
ref|XP_006089255.1|  PREDICTED: importin subunit alpha-6 isoform X1     160   6e-42   
ref|NP_001008018.1|  karyopherin alpha 6 (importin alpha 7)             160   7e-42   
ref|XP_006502877.1|  PREDICTED: importin subunit alpha-7 isoform X1     160   7e-42   
dbj|BAE32900.1|  unnamed protein product                                160   7e-42   
ref|XP_006019402.1|  PREDICTED: importin subunit alpha-7                160   7e-42   
ref|XP_006494499.1|  PREDICTED: importin subunit alpha-1a-like          159   7e-42   
ref|NP_032494.3|  importin subunit alpha-7                              160   8e-42   
emb|CAD89699.1|  importin alpha 5.1 protein                             160   8e-42   
ref|XP_004025455.1|  PREDICTED: importin subunit alpha-7                159   8e-42   
ref|XP_006274864.1|  PREDICTED: importin subunit alpha-7                160   8e-42   
gb|KDO38849.1|  hypothetical protein CISIN_1g037562mg                   160   8e-42   
ref|XP_006433499.1|  hypothetical protein CICLE_v10004067mg             151   8e-42   
gb|EHH14552.1|  hypothetical protein EGK_00497                          159   8e-42   
gb|EHH61950.1|  hypothetical protein EGM_20113                          159   8e-42   
gb|AAC53373.1|  importin alpha S2                                       159   9e-42   
ref|XP_005079689.1|  PREDICTED: importin subunit alpha-7                159   9e-42   
gb|EPY87292.1|  Importin alpha-7 subunit isoform 1-like protein         159   9e-42   
ref|NP_001084482.1|  importin alpha 5.2 protein                         159   9e-42   
ref|XP_003801323.1|  PREDICTED: importin subunit alpha-7                159   9e-42   
ref|XP_005104028.1|  PREDICTED: importin subunit alpha-7-like iso...    159   1e-41   
ref|XP_005104029.1|  PREDICTED: importin subunit alpha-7-like iso...    159   1e-41   
gb|KDR14157.1|  Importin subunit alpha-7                                159   1e-41   
ref|XP_003228760.2|  PREDICTED: importin subunit alpha-7                159   1e-41   
emb|CDY33917.1|  BnaA02g30700D                                          159   1e-41   
pdb|4UAD|A  Chain A, Importin Alpha 7 Delta Ibb In Complex With I...    159   1e-41   
gb|KEH41661.1|  importin subunit alpha                                  155   1e-41   
ref|XP_009065239.1|  hypothetical protein LOTGIDRAFT_108452             159   1e-41   
ref|XP_003500689.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   1e-41   
ref|XP_004591683.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   1e-41   
ref|XP_003891548.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   1e-41   
dbj|BAK62408.1|  importin alpha-7 subunit                               159   1e-41   
ref|XP_006994430.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   1e-41   
ref|XP_004471452.1|  PREDICTED: importin subunit alpha-7                159   1e-41   
gb|ERE85411.1|  importin subunit alpha-7 isoform 1                      159   1e-41   
dbj|BAE01108.1|  unnamed protein product                                159   1e-41   
ref|XP_005270768.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   1e-41   
gb|EPS69743.1|  hypothetical protein M569_05021                         159   1e-41   
dbj|BAG63185.1|  unnamed protein product                                159   1e-41   
ref|XP_007125169.1|  PREDICTED: importin subunit alpha-7                159   2e-41   
ref|XP_005317797.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
dbj|BAK62519.1|  importin alpha-7 subunit                               159   2e-41   
ref|XP_008271996.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_006196983.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
ref|XP_008271998.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
ref|NP_036448.1|  importin subunit alpha-7                              159   2e-41   
ref|XP_004266580.1|  PREDICTED: importin subunit alpha-7 isoform 3      159   2e-41   
ref|XP_008271999.1|  PREDICTED: importin subunit alpha-7 isoform X4     159   2e-41   
ref|XP_005004294.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
ref|XP_004784121.1|  PREDICTED: importin subunit alpha-7                158   2e-41   
ref|XP_008692699.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_003356325.2|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_005665232.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_008846295.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_005004293.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
dbj|BAG58497.1|  unnamed protein product                                159   2e-41   
ref|XP_004603617.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_007170659.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
gb|ELK02023.1|  Importin subunit alpha-7                                159   2e-41   
ref|XP_006176257.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
ref|XP_003989858.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004425942.1|  PREDICTED: importin subunit alpha-7 isoform 2      159   2e-41   
ref|NP_001069422.1|  importin subunit alpha-7                           159   2e-41   
ref|XP_010352204.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_005317796.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
gb|ELR48730.1|  Importin subunit alpha-7                                159   2e-41   
ref|XP_004266579.1|  PREDICTED: importin subunit alpha-7 isoform 2      159   2e-41   
ref|XP_004678794.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004406508.1|  PREDICTED: importin subunit alpha-7                159   2e-41   
ref|XP_006158180.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_005906256.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004642996.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004603616.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
tpg|DAA33092.1|  TPA: importin subunit alpha-7                          159   2e-41   
ref|XP_007170657.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_006734216.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_004266578.1|  PREDICTED: importin subunit alpha-7 isoform 1      159   2e-41   
gb|ELW48631.1|  Importin subunit alpha-7                                159   2e-41   
ref|XP_003471249.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_006924365.1|  PREDICTED: importin subunit alpha-7                159   2e-41   
ref|XP_006158181.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_004740986.1|  PREDICTED: importin subunit alpha-7                159   2e-41   
ref|XP_004678795.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|NP_001015029.2|  importin subunit alpha-7                           159   2e-41   
ref|XP_008951744.1|  PREDICTED: importin subunit alpha-7 isoform X3     159   2e-41   
ref|XP_004642997.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_007538559.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
gb|EKC25623.1|  Importin subunit alpha-7                                159   2e-41   
ref|XP_002720679.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_008846287.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_011433097.1|  PREDICTED: importin subunit alpha-7-like           159   2e-41   
ref|XP_010442392.1|  PREDICTED: importin subunit alpha-1-like           159   2e-41   
gb|EFB27376.1|  hypothetical protein PANDA_010861                       159   2e-41   
ref|XP_004425941.1|  PREDICTED: importin subunit alpha-7 isoform 1      159   2e-41   
ref|XP_004005080.1|  PREDICTED: importin subunit alpha-7 isoform 1      159   2e-41   
ref|XP_007538558.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004591684.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|NP_989192.1|  karyopherin alpha 1 (importin alpha 5)                159   2e-41   
ref|XP_007468725.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_006494505.1|  PREDICTED: importin subunit alpha-1a-like          160   2e-41   
ref|XP_004705074.1|  PREDICTED: importin subunit alpha-7 isoform X2     159   2e-41   
ref|XP_006471709.1|  PREDICTED: importin subunit alpha-1a-like is...    159   2e-41   
ref|XP_008064949.1|  PREDICTED: importin subunit alpha-7                159   2e-41   
ref|XP_004705073.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_004005081.1|  PREDICTED: importin subunit alpha-7 isoform 2      159   2e-41   
gb|KDO37705.1|  hypothetical protein CISIN_1g039940mg                   157   2e-41   
ref|XP_008155237.1|  PREDICTED: importin subunit alpha-7 isoform X1     159   2e-41   
ref|XP_005878401.1|  PREDICTED: importin subunit alpha-7 isoform X1     158   3e-41   
ref|XP_005395100.1|  PREDICTED: importin subunit alpha-7 isoform X3     158   3e-41   
ref|XP_005395099.1|  PREDICTED: importin subunit alpha-7 isoform X2     158   3e-41   



>gb|AAK38726.1|AF369706_1 importin alpha 1 [Capsicum annuum]
Length=535

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGSNEQIRFLASQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ G N GIN+YAQMIDECEGLDK+ENLQTHDNNEIYEK VKILEKYW +E
Sbjct  442  NILKVGEMDKETGANGGINLYAQMIDECEGLDKIENLQTHDNNEIYEKTVKILEKYWAEE  501

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE NLPDGVD NQQGF FGN+QPNVP
Sbjct  502  DEEQNLPDGVDGNQQGFQFGNNQPNVP  528



>ref|XP_009796205.1| PREDICTED: importin subunit alpha-1 [Nicotiana sylvestris]
Length=531

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS +QIRFLASQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQSAEFDIKKEAAWAISNATSGGSYDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ GMN GIN+YAQMIDEC+GLDK+ENLQTHDNNEIYEKAVKILEKYW +E
Sbjct  438  NILKVGEMDKEAGMNGGINLYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILEKYWAEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LPDG+D NQQGF FGNSQPNVP
Sbjct  498  DEEQILPDGIDGNQQGFQFGNSQPNVP  524



>ref|XP_009592620.1| PREDICTED: importin subunit alpha-1 [Nicotiana tomentosiformis]
Length=531

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS +QIRFLASQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQSAEFDIKKEAAWAISNATSGGSYDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ GMN GIN+YAQM+DEC+GLDK+ENLQTHDNNEIYEKAVKILEKYW +E
Sbjct  438  NILKVGEVDKEAGMNGGINLYAQMMDECDGLDKIENLQTHDNNEIYEKAVKILEKYWAEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE   PDGVD NQQGF FGNSQPNVP
Sbjct  498  DEEQIFPDGVDGNQQGFQFGNSQPNVP  524



>ref|XP_006344784.1| PREDICTED: importin subunit alpha-1 [Solanum tuberosum]
Length=534

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGSN+QIRFLASQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQNAEFDIKKEAAWAISNATSGGSNDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ G N GIN+YAQ IDEC+GLDK+ENLQTHDNNE+YEKAVKILEKYW +E
Sbjct  441  NILKVGEVDKEAGANGGINLYAQTIDECDGLDKIENLQTHDNNELYEKAVKILEKYWAEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE NLPDG D NQQGF FGN+QPNVP
Sbjct  501  DEEQNLPDGADGNQQGFQFGNNQPNVP  527



>ref|XP_004230322.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=534

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGSN+QIRFL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQNAEFDIKKEAAWAISNATSGGSNDQIRFLTSQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ G N GIN+Y  MIDEC+GLDK+ENLQTHDNNEIYEKAVKILEKYW +E
Sbjct  441  NILKVGEVDKEAGTNGGINMYTHMIDECDGLDKIENLQTHDNNEIYEKAVKILEKYWAEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE NLPDG D N QGF FGN+QPNVP
Sbjct  501  DEEQNLPDGADGNPQGFQFGNNQPNVP  527



>ref|XP_007031183.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY11685.1| Importin alpha isoform 1 [Theobroma cacao]
Length=536

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  382  LQHAEFDIKKEAAWAISNATSGGAHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYEKAVKILE+YW  +
Sbjct  442  NILKVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEE  501

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E NL DG +ENQQGF FG +QPNVP
Sbjct  502  EDDEQNLQDGGNENQQGFNFGANQPNVP  529



>ref|XP_007031184.1| Importin alpha isoform 2 [Theobroma cacao]
 gb|EOY11686.1| Importin alpha isoform 2 [Theobroma cacao]
Length=540

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  386  LQHAEFDIKKEAAWAISNATSGGAHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  445

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYEKAVKILE+YW  +
Sbjct  446  NILKVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEE  505

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E NL DG +ENQQGF FG +QPNVP
Sbjct  506  EDDEQNLQDGGNENQQGFNFGANQPNVP  533



>gb|ABB55384.1| importin alpha 1-like [Solanum tuberosum]
Length=445

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGSN+QIRFLASQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  302  LQNAEFDIKKEAAWAISNATSGGSNDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLE  361

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ G N GIN+YAQ IDEC+GLDK+ENLQTHDNNE+YEKAVKILEKYW +E
Sbjct  362  NILKVGEVDKEAGANGGINLYAQTIDECDGLDKIENLQTHDNNELYEKAVKILEKYWAEE  421

Query  360  DEEPNLPDGVDENQQGFTFGNSQ  292
            DEE NLPDG D NQ GF FGN+Q
Sbjct  422  DEEQNLPDGADGNQLGFQFGNNQ  444



>ref|XP_002319478.1| importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE95401.1| importin alpha-1 subunit family protein [Populus trichocarpa]
Length=537

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATS GS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  383  LQHAEFDIKKEAAWAISNATSAGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEADK++G+N G+N+YAQM+DEC+GLDK+ENLQTHDNNEIYEKAVKILE+YW  +
Sbjct  443  NILKVGEADKEMGLNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  502

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVPE  277
            ED EP + DG D NQQGF FG +QP+VP+
Sbjct  503  EDGEPIVQDGGDGNQQGFAFGTNQPSVPQ  531



>ref|XP_007205030.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
 gb|EMJ06229.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
Length=533

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+ LAS+GC+KPLCDLLICPDPRI+TVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSHEQIQHLASRGCIKPLCDLLICPDPRIITVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMNDGIN+YAQ++DECEGLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  441  NILKVGEADKEMGMNDGINLYAQLVDECEGLDKIENLQTHDNNEIYEKAVKILERYWAEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +E  N+ +  D NQ  FTFG +QPN P
Sbjct  501  EEGQNIQENGDGNQHDFTFGANQPNPP  527



>ref|XP_011092170.1| PREDICTED: importin subunit alpha [Sesamum indicum]
Length=540

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAI NATSGGS  QIR LAS GC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LEHAEFEIKKEAAWAIFNATSGGSPAQIRLLASHGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK+ GMN GINIYAQMID CEGLDKLENLQ+HDNNEIY+KAVKILEKYW +E
Sbjct  447  NILKVGEIDKENGMNGGINIYAQMIDYCEGLDKLENLQSHDNNEIYDKAVKILEKYWVEE  506

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+ NL DGVD N QGF+FGN++ NVP
Sbjct  507  DEDQNLADGVDGNHQGFSFGNNKANVP  533



>ref|XP_011023801.1| PREDICTED: importin subunit alpha [Populus euphratica]
Length=537

 Score =   250 bits (639),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATS GS+EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQHAEFEIKKEAAWAISNATSAGSHEQIQFLVSQGCIKPLCDLLTCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEADK++G+N G+N+YAQM+DEC+GLDK+ENLQTHDNNEIYEKAVKILE+YW  +
Sbjct  443  NILKVGEADKEMGLNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  502

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVPE  277
            ED EP + DG D NQQGF FG +QP+VP+
Sbjct  503  EDGEPIVQDGGDGNQQGFAFGTNQPSVPQ  531



>ref|XP_008246117.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=533

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS++QI+ LAS+GC+KPLCDLLICPDPRI+TVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSHDQIQHLASRGCIKPLCDLLICPDPRIITVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMNDGIN+YAQ++DECEGLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  441  NILKVGEADKEMGMNDGINLYAQLVDECEGLDKIENLQTHDNNEIYEKAVKILERYWAEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE  N+    D NQ  FTFG +QPN P
Sbjct  501  DEGQNIQVNGDGNQHDFTFGANQPNPP  527



>ref|XP_010674568.1| PREDICTED: importin subunit alpha-1a [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+ EQIRFL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQNAEFDIKKEAAWAISNATSGGAPEQIRFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            N+LKVGE DK++GMN G+NIYAQMIDECEGLDK+ENLQTHDNN+IYEKAVK+LEKYW +E
Sbjct  441  NLLKVGETDKEMGMNGGVNIYAQMIDECEGLDKIENLQTHDNNDIYEKAVKVLEKYWAEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +EE N  DG   NQQGF FG +QPN+P
Sbjct  501  EEEQNAQDGAAMNQQGFNFGATQPNIP  527



>gb|KJB26294.1| hypothetical protein B456_004G235800 [Gossypium raimondii]
Length=537

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 135/146 (92%), Gaps = 2/146 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  385  AEFDIKKEAAWAISNATSGGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENIL  444

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDE-  355
            KVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYEKAVKILE+YW +E+E 
Sbjct  445  KVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEEED  504

Query  354  EPNLPDGVDENQQGFTFG-NSQPNVP  280
            E N+ DG +ENQQGF FG N QP+ P
Sbjct  505  EQNIQDGGNENQQGFNFGVNQQPSAP  530



>gb|KDP23371.1| hypothetical protein JCGZ_23204 [Jatropha curcas]
Length=535

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  382  LQHAEFDIKKEAAWAISNATSGGSHEQIQFLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYEKAVKILE+YW +E
Sbjct  442  NILKVGEADKEMGLNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEE  501

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +EE  + DG D NQQGF FG++QPN P
Sbjct  502  EEEQTVQDGGDGNQQGFPFGSNQPNAP  528



>ref|XP_010549392.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=537

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+++QI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  383  LQHAEFDIKKEAAWAISNATSGGTHDQIKFLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKV EADK++G+N G+N+YAQM++E +GLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  443  NILKVSEADKEMGLNGGVNLYAQMVEESDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  502

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +E+ N  D ++EN QQGF FGNSQP+VP
Sbjct  503  EEDQNHQDAMNENAQQGFNFGNSQPSVP  530



>ref|XP_010270837.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQHAEFEIKKEAAWAISNATSGGTHEQIQYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGD-  364
            NILKVGEADK+LG   G+N+YAQMIDECEGLDK+ENLQ HDNNEIYEKA+KILE+YW D 
Sbjct  440  NILKVGEADKELGKTGGVNMYAQMIDECEGLDKIENLQNHDNNEIYEKAMKILERYWVDE  499

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            E+EE NL DG +  QQGF FGNSQPNVP
Sbjct  500  EEEEQNLQDG-EITQQGFEFGNSQPNVP  526



>emb|CAN64716.1| hypothetical protein VITISV_026717 [Vitis vinifera]
Length=523

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAW ISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  370  LQHAEFDIKKEAAWGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCPDPRIVTVCLEGLE  429

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK+ G N GIN+YAQMIDEC+GLDK+E LQTHDNNEIYEK+VK+LE+YW +E
Sbjct  430  NILKVGEADKESGKNGGINLYAQMIDECDGLDKIELLQTHDNNEIYEKSVKLLERYWAEE  489

Query  360  DEE-PNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  N+ DG D NQQGF FG+SQPN+P
Sbjct  490  DEEVQNVQDG-DGNQQGFGFGSSQPNLP  516



>ref|XP_002281670.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CBI39614.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAW ISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  382  LQHAEFDIKKEAAWGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK+ G N GIN+YAQMIDEC+GLDK+E LQTHDNNEIYEK+VK+LE+YW +E
Sbjct  442  NILKVGEADKESGKNGGINLYAQMIDECDGLDKIELLQTHDNNEIYEKSVKLLERYWAEE  501

Query  360  DEE-PNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  N+ DG D NQQGF FG+SQPN+P
Sbjct  502  DEEVQNVQDG-DGNQQGFGFGSSQPNLP  528



>ref|XP_008453295.1| PREDICTED: importin subunit alpha [Cucumis melo]
Length=536

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEA WAISNATSGGS++QI+FL +QGC+KPLCDLL CPDPRIVTVCLEGL+
Sbjct  381  LQHAEFDIKKEAGWAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCPDPRIVTVCLEGLD  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +GMN GINIYAQ IDECEGLDK+ENLQ+HDNNEIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKDMGMNGGINIYAQAIDECEGLDKIENLQSHDNNEIYEKAVKMLERYWAEE  500

Query  360  DE--EPNLPDGVDENQQGFTFGNSQPNVP  280
            DE  E N     D NQ GF FG +QPNVP
Sbjct  501  DEEQEQNPQQNGDANQHGFAFGANQPNVP  529



>ref|XP_002512528.1| importin alpha, putative [Ricinus communis]
 gb|EEF49980.1| importin alpha, putative [Ricinus communis]
Length=450

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  300  LQHAEFDIKKEAAWAISNATSGGSHEQIQFLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  359

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA K++GMN G+N+YAQMIDEC+GLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  360  NILKVGEAKKEMGMNGGVNLYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  419

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            +EE N+ +  D NQQ F FG +QP
Sbjct  420  EEEQNVQESGDGNQQSFAFGTNQP  443



>emb|CDX94988.1| BnaC05g06830D [Brassica napus]
Length=540

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 136/148 (92%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  386  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  445

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  446  NILKIGEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  505

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            ++E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  506  EDEQILPDGVNENPQQGFSFGNNQTAAP  533



>ref|XP_010024140.1| PREDICTED: importin subunit alpha [Eucalyptus grandis]
 gb|KCW60572.1| hypothetical protein EUGRSUZ_H03303 [Eucalyptus grandis]
Length=542

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQHAEFEIKKEAAWAISNATSGGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            N+LK+GEADK++G+N G+N+Y QMIDECEGLDK+E+LQTHDNNEIYEKAVKILE+YW +E
Sbjct  447  NVLKIGEADKEMGLNGGVNLYGQMIDECEGLDKIESLQTHDNNEIYEKAVKILERYWAEE  506

Query  360  DE--EPNLPDGVDENQQGFTFGNSQPNVP  280
            ++  E +  D V+ + QGFTFG + PN+P
Sbjct  507  EDGVEDDTQDAVNGDAQGFTFGANAPNLP  535



>ref|NP_001275782.1| importin alpha [Citrus sinensis]
 gb|ACU56981.1| importin alpha [Citrus sinensis]
Length=535

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGGS++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQHAEFEIKKEAAWAISNATSGGSHQQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMN+GIN+YAQMIDEC+GLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  440  NILKVGEADKEMGMNNGINVYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  499

Query  360  DEEPNLPD--GVDENQQGFTFGNSQPNVP  280
            +EE  L    G+   QQGF F  +QPN+P
Sbjct  500  EEEEQLIQEGGIGNQQQGFGFATNQPNIP  528



>gb|KFK43224.1| hypothetical protein AALP_AA1G096500 [Arabis alpina]
Length=539

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  385  LQTAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+NDG+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  445  NILKVGEADKEMGLNDGVNLYAQLIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  504

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            DEE  L DG +EN QQ F FGN+QP  P
Sbjct  505  DEEQILQDGGNENPQQAFNFGNNQPAAP  532



>ref|XP_008370371.1| PREDICTED: importin subunit alpha-like [Malus domestica]
Length=532

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 10/151 (7%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEE  500

Query  360  DEEPNLPDGVDEN----QQGFTFGNSQPNVP  280
            DEE      V EN    QQGFTFG +QPN P
Sbjct  501  DEE------VQENGNGTQQGFTFGTNQPNPP  525



>ref|XP_009337642.1| PREDICTED: importin subunit alpha-like isoform X2 [Pyrus x bretschneideri]
Length=532

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 10/151 (7%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEE  500

Query  360  DEEPNLPDGVDEN----QQGFTFGNSQPNVP  280
            DEE      V EN    QQGFTFG +QPN P
Sbjct  501  DEE------VQENGNGTQQGFTFGTNQPNPP  525



>ref|XP_009337641.1| PREDICTED: importin subunit alpha-like isoform X1 [Pyrus x bretschneideri]
Length=533

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 10/151 (7%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYEKAVK+LE+YW +E
Sbjct  442  NILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEE  501

Query  360  DEEPNLPDGVDEN----QQGFTFGNSQPNVP  280
            DEE      V EN    QQGFTFG +QPN P
Sbjct  502  DEE------VQENGNGTQQGFTFGTNQPNPP  526



>ref|XP_010267916.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQHAEFEIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGD-  364
            NILKVGEADK+LG   G+NIYAQMIDECEGLDK+ENLQ HDNNEIYEK++KILE+YW D 
Sbjct  440  NILKVGEADKELGKTGGVNIYAQMIDECEGLDKIENLQNHDNNEIYEKSMKILERYWVDE  499

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            E+EE N+ DG +  QQGF FG +QPNVP
Sbjct  500  EEEEQNIQDG-EIAQQGFEFGTNQPNVP  526



>gb|ABO21639.1| importin alpha-like protein [Brassica napus]
 gb|ABO21640.1| importin alpha-like protein [Brassica napus]
Length=542

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  447  NILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  506

Query  360  DE-EPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  507  EEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>ref|XP_009148181.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
Length=542

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  447  NILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  506

Query  360  DE-EPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  507  EEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>emb|CDX93514.1| BnaA06g05340D [Brassica napus]
Length=542

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  447  NILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  506

Query  360  DE-EPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  507  EEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>ref|XP_010475758.1| PREDICTED: importin subunit alpha-1a-like [Camelina sativa]
Length=540

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  386  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  445

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW ++
Sbjct  446  NILKVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWNED  505

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE +L DGV+EN QQ F FG +QP  P
Sbjct  506  EEEQSLQDGVNENSQQTFNFGTNQPAAP  533



>ref|XP_010544159.1| PREDICTED: importin subunit alpha-1b-like [Tarenaya hassleriana]
Length=540

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS++QI+FL +Q C+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  386  LQHAEFDIKKEAAWAISNATSGGSHDQIKFLVTQDCIKPLCDLLICPDPRIVTVCLEGLE  445

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N G+N+YAQ+++E +GLDK+ENLQTHDNNEIYEKAVKILE+YW +E
Sbjct  446  NILKVGEADKEMGLNGGVNLYAQVVEESDGLDKIENLQTHDNNEIYEKAVKILERYWAEE  505

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE NL DG+++N QQGF FG  QP  P
Sbjct  506  EEEQNLQDGMNQNGQQGFNFGTDQPGAP  533



>emb|CDY31102.1| BnaA08g26520D [Brassica napus]
Length=542

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILEKYW  +
Sbjct  447  NILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILEKYWAEE  506

Query  363  EDEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            EDEE  L DG +EN QQGF+FGN+QP  P
Sbjct  507  EDEEQILTDGGNENPQQGFSFGNNQPAAP  535



>ref|XP_008388467.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=534

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKNMGMNGGINLYAQIIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE       + NQQG+TFG +QPN P
Sbjct  501  DEEVQENGNGNGNQQGYTFGANQPNPP  527



>ref|XP_009373302.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009373303.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=534

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKNMGMNGGINLYAQIIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE       + NQQGFTF  +QPN P
Sbjct  501  DEEVQENGNGNGNQQGFTFAANQPNPP  527



>ref|XP_006417589.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
 gb|ESQ35942.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
Length=539

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  385  LQTAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  445  NILKVGEADKDMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  504

Query  360  DEEPNLPDGVDENQQ-GFTFGNSQPNVP  280
            +EE N+PDG  EN Q GF FGN+QP  P
Sbjct  505  EEEQNMPDGGSENPQLGFNFGNNQPAAP  532



>ref|XP_004302281.1| PREDICTED: importin subunit alpha-4 [Fragaria vesca subsp. vesca]
Length=531

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  379  LQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEADK++G N+GIN++AQMIDE +GL+K+ENLQTHDNNEIYEKAVKILE+YW  +
Sbjct  439  NILKVGEADKEMGANNGINLFAQMIDEFDGLEKIENLQTHDNNEIYEKAVKILERYWAEE  498

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            EDEE NL    D N   FTFG +QP  P
Sbjct  499  EDEEQNLQQNGDGN--AFTFGGNQPAAP  524



>emb|CDY32165.1| BnaCnng06740D [Brassica napus]
Length=542

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KP+CDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPICDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW  +
Sbjct  447  NILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  506

Query  363  EDEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            EDEE  L DG +EN QQGF+FGN+QP  P
Sbjct  507  EDEEQILTDGGNENPQQGFSFGNNQPAAP  535



>ref|XP_010458212.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Camelina 
sativa]
Length=540

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  389  AEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENIL  448

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +++EE
Sbjct  449  KVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEE  508

Query  351  PNLPDGVDEN-QQGFTFGNSQPNVP  280
              L DG +EN QQ F FG +QP  P
Sbjct  509  QILQDGGNENSQQTFNFGTNQPAAP  533



>ref|XP_010914627.1| PREDICTED: importin subunit alpha isoform X2 [Elaeis guineensis]
Length=533

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGSNEQI FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYEK +KILE+YW +E
Sbjct  441  NILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +  G  E    F FG +QP+ P
Sbjct  501  DDEGQVVQGTGEG-AAFEFGANQPSAP  526



>ref|XP_010458211.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Camelina 
sativa]
Length=540

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  389  AEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENIL  448

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +++EE
Sbjct  449  KVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEE  508

Query  351  PNLPDGVDEN-QQGFTFGNSQPNVP  280
              L DG +EN QQ F FG +QP  P
Sbjct  509  QILQDGGNENSQQTFNFGTNQPAAP  533



>ref|XP_004144743.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
 ref|XP_004158712.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
 gb|KGN61011.1| hypothetical protein Csa_2G034640 [Cucumis sativus]
Length=537

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEA WAISNATSGGS++QI+FL +QGC+KPLCDLL CPDPRIVTVCLEGL+
Sbjct  381  LQHAEFDIKKEAGWAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCPDPRIVTVCLEGLD  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +GMN GINIYAQ IDECEGLDK+ENLQ+HDNNEIYEKAVK+LE+YW +E
Sbjct  441  NILKVGEADKDMGMNGGINIYAQAIDECEGLDKIENLQSHDNNEIYEKAVKMLERYWAEE  500

Query  360  DEEPNLPDGV---DENQQGFTFGNSQPNVP  280
            DEE          D NQ GF FG +QPNVP
Sbjct  501  DEEQEQNPQQQNGDANQHGFAFGANQPNVP  530



>ref|XP_009110839.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Brassica 
rapa]
 ref|XP_009110840.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Brassica 
rapa]
Length=542

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  387  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  446

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW  +
Sbjct  447  NILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEE  506

Query  363  EDEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            EDEE  L DG +EN QQGF+FGN+Q   P
Sbjct  507  EDEEQILTDGGNENPQQGFSFGNNQAAAP  535



>ref|XP_006304709.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
 gb|EOA37607.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
Length=540

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++LA+QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  386  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLATQGCIKPLCDLLVCPDPRIVTVCLEGLE  445

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE DK++G+NDG+N+Y Q+I+EC+GLDK+E+LQ+HDNNEIYEKAVKILE+YW +E
Sbjct  446  NILKVGETDKEMGLNDGVNLYGQIIEECDGLDKVESLQSHDNNEIYEKAVKILERYWAEE  505

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE  L DG +EN QQ F+FG +QP  P
Sbjct  506  EEEQILQDGGNENSQQAFSFGTNQPAAP  533



>ref|XP_010914626.1| PREDICTED: importin subunit alpha isoform X1 [Elaeis guineensis]
Length=557

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGSNEQI FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  405  LQHAEFDIKKEAAWAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  464

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYEK +KILE+YW +E
Sbjct  465  NILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEE  524

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +  G  E    F FG +QP+ P
Sbjct  525  DDEGQVVQGTGEG-AAFEFGANQPSAP  550



>ref|XP_008801729.1| PREDICTED: importin subunit alpha-1a isoform X2 [Phoenix dactylifera]
Length=533

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGSNEQI FLASQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSNEQIHFLASQGCIKPLCDLLVCPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    IN YAQMIDECEGLDK+ENLQ HDNNEIYEK +KILE+YW +E
Sbjct  441  NILKVGEAEKDLGRTGDINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWIEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +  G  E    F FG +QP+ P
Sbjct  501  DDEGQVVQGTGEGAT-FEFGANQPSAP  526



>ref|XP_002889740.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65999.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  384  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  444  NILKVGEADKEMGLNGGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  503

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE  L DG +EN QQ F FGN+QP  P
Sbjct  504  EEEQILQDGGNENSQQAFNFGNNQPAAP  531



>gb|EYU38410.1| hypothetical protein MIMGU_mgv1a004192mg [Erythranthe guttata]
Length=540

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS EQIRFL SQGC+KPLCDLLI PDPRIVTVCLEGLE
Sbjct  385  LQHAEFDIKKEAAWAISNATSGGSPEQIRFLVSQGCIKPLCDLLISPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK+ G+N GINIYAQMID+CEGLDK+E LQ+HDNNEIYEKAVKILEKYW +E
Sbjct  445  NILKVGEADKESGLNGGINIYAQMIDDCEGLDKIETLQSHDNNEIYEKAVKILEKYWAEE  504

Query  360  DEEPNLPD-GVD-ENQQGFTFGNSQPNVP  280
            DE+ N+ D GVD  N QGF FGN+QPNVP
Sbjct  505  DEDQNIADAGVDGNNNQGFNFGNNQPNVP  533



>ref|XP_010931776.1| PREDICTED: importin subunit alpha-like [Elaeis guineensis]
Length=533

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWA+SNATSGGSNEQI FL +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  381  LQHAEFDIKKEAAWAMSNATSGGSNEQIHFLVNQGCIKPLCDLLVCPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYEK +KILE+YW +E
Sbjct  441  NILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +  G  E    F FG +QP+VP
Sbjct  501  DDEGQVVQGSAEG-VAFEFGANQPSVP  526



>ref|XP_008806746.1| PREDICTED: importin subunit alpha-1-like, partial [Phoenix dactylifera]
Length=210

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISN TSGGSNEQI FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  58   LQHAEFDIKKEAAWAISNTTSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  117

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   GIN YAQMID CEGLDK+ENLQ HDNNEIYE+ +KILE++W +E
Sbjct  118  NILKVGEAEKDLGRTGGINPYAQMIDGCEGLDKIENLQGHDNNEIYERTIKILERFWVEE  177

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +  G  E    F F  +Q +VP
Sbjct  178  DDEGQVVQGSAEG-TAFEFRANQSSVP  203



>ref|XP_003554623.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
 gb|KHN43332.1| Importin subunit alpha-1b [Glycine soja]
Length=532

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            D+E  +P G D +Q GF FG +QP
Sbjct  500  DDE-TMPPG-DASQSGFNFGGAQP  521



>ref|XP_006488809.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis]
Length=528

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 128/148 (86%), Gaps = 5/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF++KKEA+WAISNATSGG+ EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQHAEFEVKKEASWAISNATSGGTREQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILK+GEADK+ G +  +N+Y++MIDEC+GLDK+ENLQ+HDNNEIYEKAVK+LE+YW  +
Sbjct  438  NILKIGEADKEAG-STTVNVYSEMIDECDGLDKIENLQSHDNNEIYEKAVKLLERYWVEE  496

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E N+PDG   N   F FG  QPN+P
Sbjct  497  EDDEQNIPDG---NNPEFNFGTGQPNIP  521



>ref|XP_003521670.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC++PLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIRPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            D+E  +P G D +Q GF FG +QP
Sbjct  500  DDE-TMPPG-DASQSGFNFGGTQP  521



>gb|KHN03948.1| Importin subunit alpha [Glycine soja]
Length=532

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC++PLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIRPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            D+E  +P G D +Q GF FG +QP
Sbjct  500  DDE-TMPPG-DASQSGFNFGGTQP  521



>ref|XP_006842676.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda]
 gb|ERN04351.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda]
Length=527

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG++EQI++L +QGC++PLCDLL+CPDPRIVTVCLEGLE
Sbjct  377  LQTAEFDIKKEAAWAISNATSGGTHEQIKYLVNQGCIRPLCDLLVCPDPRIVTVCLEGLE  436

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG  DG+N+YAQ+ID+ EGLDK+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  437  NILKVGEAEKNLGNTDGVNLYAQLIDDAEGLDKIENLQSHDNNEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNV  283
            DE+  LP G +     FTFG++QP +
Sbjct  497  DEDTLLPPG-ETAPAAFTFGSNQPPI  521



>gb|KDO72000.1| hypothetical protein CISIN_1g009700mg [Citrus sinensis]
Length=528

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 5/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF++KKEA+WAISNATSGG+ EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQHAEFEVKKEASWAISNATSGGTREQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILK+GEADK+ G     N+Y++MIDEC+GLDK+ENLQ+HDNNEIYEKAVK+LE+YW  +
Sbjct  438  NILKIGEADKEAGSTTA-NVYSEMIDECDGLDKIENLQSHDNNEIYEKAVKLLERYWVEE  496

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E N+PDG   N   F FG  QPN+P
Sbjct  497  EDDEQNIPDG---NNPEFNFGTGQPNIP  521



>emb|CAA74966.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=528

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  375  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  434

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  435  NILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  494

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE  L DG ++N QQGF FGN+ P  P
Sbjct  495  EEEQILQDGGNDNSQQGFNFGNN-PAAP  521



>ref|XP_004494548.1| PREDICTED: importin subunit alpha-like [Cicer arietinum]
Length=531

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  E
Sbjct  439  NILKVGEADKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWL-E  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            DE+  +P G D +Q GF FG S+ P+VP
Sbjct  498  DEDETMPPG-DASQSGFNFGGSEVPSVP  524



>ref|XP_002519178.1| importin alpha, putative [Ricinus communis]
 gb|EEF43042.1| importin alpha, putative [Ricinus communis]
Length=488

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI+++ SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  337  LQNAEFDIKKEAAWAISNATSGGTHEQIKYMVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  396

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +  +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVK+LE YW +E
Sbjct  397  NILKVGEAEKNLGNSGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKVLETYWLEE  456

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D +QQGF FG + P+ P
Sbjct  457  DDE-TLPPG-DNSQQGFHFGGNDPSAP  481



>gb|KDP27876.1| hypothetical protein JCGZ_18956 [Jatropha curcas]
Length=529

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+NEQI++L SQGCVKPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +  +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  438  NILKVGEAEKNLGNSGDVNMYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  QQGF FG   P+VP
Sbjct  498  DDE-TLPTG-DGFQQGFHFGGKDPSVP  522



>ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            ++E  +P G D +Q GF FG+S  P VP
Sbjct  500  EDE-TMPPG-DASQSGFNFGSSDAPTVP  525



>ref|NP_001031011.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28423.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=456

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  303  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  362

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  363  NILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  422

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE  L DG ++N QQ F FGN+ P  P
Sbjct  423  EEEQILQDGGNDNSQQAFNFGNN-PAAP  449



>ref|XP_008801728.1| PREDICTED: importin subunit alpha-1a isoform X1 [Phoenix dactylifera]
Length=539

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIR------FLASQGCVKPLCDLLICPDPRIVTV  559
              HAEFDIKKEAAWAISNATSGGSNEQI+      FLASQGC+KPLCDLL+CPDPRIVTV
Sbjct  381  LQHAEFDIKKEAAWAISNATSGGSNEQIQYVLFFIFLASQGCIKPLCDLLVCPDPRIVTV  440

Query  558  CLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILE  379
            CLEGLENILKVGEA+K LG    IN YAQMIDECEGLDK+ENLQ HDNNEIYEK +KILE
Sbjct  441  CLEGLENILKVGEAEKDLGRTGDINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILE  500

Query  378  KYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +YW +ED+E  +  G  E    F FG +QP+ P
Sbjct  501  RYWIEEDDEGQVVQGTGEGAT-FEFGANQPSAP  532



>gb|KHN16078.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            ++E  +P G D +Q GF FG+S  P VP
Sbjct  500  EDE-TMPPG-DASQSGFNFGSSDAPTVP  525



>gb|AES82394.2| importin subunit alpha-1b [Medicago truncatula]
Length=532

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK  G+ DG+N YA++IDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNAGITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            D+E  +P G D +Q GF FG S+ P VP
Sbjct  500  DDEA-MPPG-DASQSGFNFGGSEVPAVP  525



>ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006606551.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 gb|KHN20271.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            ++E  +P G D +Q GF FG+S  P VP
Sbjct  500  EDE-TMPPG-DASQSGFNFGSSDAPAVP  525



>ref|NP_172398.1| importin alpha isoform 4 [Arabidopsis thaliana]
 ref|NP_849623.1| importin alpha isoform 4 [Arabidopsis thaliana]
 sp|O80480.1|IMPA4_ARATH RecName: Full=Importin subunit alpha-4; Short=IMPa-4 [Arabidopsis 
thaliana]
 gb|AAC24079.1| Match to mRNA for importin alpha-like protein 4 (impa4) gb|Y14616 
from A. thaliana. ESTs gb|N96440, gb|N37503, gb|N37498 
and gb|T42198 come from this gene [Arabidopsis thaliana]
 gb|AAM13992.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AAM51388.1| putative importin alpha protein [Arabidopsis thaliana]
 dbj|BAH19416.1| AT1G09270 [Arabidopsis thaliana]
 gb|AEE28421.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28422.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=538

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  385  LQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +E
Sbjct  445  NILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  504

Query  360  DEEPNLPDGVDEN-QQGFTFGNSQPNVP  280
            +EE  L DG ++N QQ F FGN+ P  P
Sbjct  505  EEEQILQDGGNDNSQQAFNFGNN-PAAP  531



>ref|XP_011023748.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQSAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE   +P G D +Q GF FG   P VP
Sbjct  498  DE--TMPPG-DASQSGFQFGGEAPAVP  521



>ref|XP_003626176.1| Importin subunit alpha [Medicago truncatula]
Length=563

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK  G+ DG+N YA++IDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNAGITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            D+E  +P G D +Q GF FG S+ P VP
Sbjct  500  DDEA-MPPG-DASQSGFNFGGSEVPAVP  525



>ref|XP_011023747.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=529

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  379  LQSAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  439  NILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE   +P G D +Q GF FG   P VP
Sbjct  499  DE--TMPPG-DASQSGFQFGGEAPAVP  522



>ref|XP_009781700.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Nicotiana 
sylvestris]
Length=453

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  302  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  361

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  362  NILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEE  421

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG+ + +VP
Sbjct  422  DDE-TMPPG-DAPQQGFQFGDGEVSVP  446



>ref|XP_003591197.1| Importin subunit alpha-1 [Medicago truncatula]
 gb|AES61448.1| importin subunit alpha-1b [Medicago truncatula]
Length=533

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G N  +N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNNGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            ++E  +P G D +Q GF FG+++ P+VP
Sbjct  500  EDE-TMPPG-DASQSGFNFGSAEVPSVP  525



>gb|ACF86631.1| unknown [Zea mays]
Length=234

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  88   AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  147

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  148  KVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  206

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  207  A-MPSG-DNPQNGFNFGN-QPSVP  227



>ref|XP_002318966.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE94889.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D +Q GF FG   P VP
Sbjct  498  EDE-TMPPG-DASQSGFQFGGEAPAVP  522



>ref|XP_007144986.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
 gb|ESW16980.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
Length=532

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKSIGNTGDVNLYAQIIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            D+E  +P G D +Q GF FGN+  P VP
Sbjct  500  DDE-TMPPG-DASQSGFNFGNNDAPAVP  525



>gb|KDP23418.1| hypothetical protein JCGZ_23251 [Jatropha curcas]
Length=528

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  376  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  435

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK LG + G+N+YAQMID+ +GL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  436  NILKVGEADKNLGNSGGVNLYAQMIDDSDGLEKIENLQSHDNTEIYEKAVKILETYWLEE  495

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            ++E  +P G D +Q GF FG S+ P VP
Sbjct  496  EDE-TMPPG-DASQSGFQFGGSEMPAVP  521



>ref|XP_006380207.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
 gb|ERP58004.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
Length=529

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +  +N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGNSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  QQGF FG +   VP
Sbjct  499  DDEA-LPSG-DGAQQGFHFGENNVQVP  523



>ref|XP_010095558.1| Importin subunit alpha [Morus notabilis]
 gb|EXB60957.1| Importin subunit alpha [Morus notabilis]
Length=628

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 10/147 (7%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGGS+EQI+FL +QGC+ PLCDLL CPDPRI+TVCLEGLE
Sbjct  381  LQHAEFEIKKEAAWAISNATSGGSHEQIQFLVTQGCIAPLCDLLACPDPRIITVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N GIN+YAQ IDEC+GLDK+E+LQ HDNNEIYEKAVKILE+YW +E
Sbjct  441  NILKVGEADKEMGLNGGINLYAQQIDECDGLDKIESLQNHDNNEIYEKAVKILERYWTEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D++ NLP           F   QP +P
Sbjct  501  DDDENLP----------VFAGGQPTLP  517



>ref|XP_006382424.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|ERP60221.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKE+AWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKESAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  438  NILKVGEADKNVSDTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D +Q GF FG   P VP
Sbjct  498  DDE-TMPPG-DASQSGFQFGGDAPAVP  522



>ref|XP_011013186.1| PREDICTED: importin subunit alpha-1-like [Populus euphratica]
Length=529

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +  +N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGNSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  QQGF FG +   VP
Sbjct  499  DDEA-LPSG-DGAQQGFHFGENNVQVP  523



>ref|XP_009781699.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Nicotiana 
sylvestris]
Length=529

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG+ + +VP
Sbjct  498  DDE-TMPPG-DAPQQGFQFGDGEVSVP  522



>gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Erythranthe guttata]
 gb|EYU42202.1| hypothetical protein MIMGU_mgv1a004354mg [Erythranthe guttata]
Length=531

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFD+KKEAAWAISNATSGG++EQI++L SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDVKKEAAWAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGKTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+EP  P G    QQGF FG S  ++P
Sbjct  499  DDEPA-PPGDAAAQQGFQFGGSDVSLP  524



>ref|XP_010684628.1| PREDICTED: importin subunit alpha [Beta vulgaris subsp. vulgaris]
Length=531

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS +QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSPDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEA+K LG + GIN+YAQM+++ EGLDK+ENLQ+HDNNEIYEKAVKILE YW D 
Sbjct  440  NILKIGEAEKNLGTSGGINVYAQMVEDAEGLDKIENLQSHDNNEIYEKAVKILETYWVD-  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVPE  277
            DE+  LP   +  Q GF FG ++ NVP+
Sbjct  499  DEDEALPSA-EGAQNGFEFGGNELNVPQ  525



>gb|KHN12909.1| Importin subunit alpha-1 [Glycine soja]
Length=526

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  375  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  434

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +G +  +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  435  NILKVGEAEKSMGNSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  494

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  Q GF FGN+   VP
Sbjct  495  DDE-TLPTG-DGAQPGFNFGNNDVPVP  519



>gb|AFW77280.1| hypothetical protein ZEAMMB73_231111, partial [Zea mays]
Length=227

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  81   AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  140

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  141  KVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  199

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  200  A-MPSG-DNPQNGFNFGN-QPSVP  220



>ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
Length=531

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  440  NILKVGEAEKSLGNTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  Q GF FGN+   VP
Sbjct  500  DDE-TLPAG-DGAQPGFNFGNNDLPVP  524



>ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine 
max]
Length=531

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +G +  +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  440  NILKVGEAEKSMGNSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  Q GF FGN+   VP
Sbjct  500  DDE-TLPTG-DGAQPGFNFGNNDVPVP  524



>ref|XP_004495675.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Cicer arietinum]
Length=455

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  302  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  361

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  362  NILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  421

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            D+E  +P G D  Q GF FG+++ P+VP
Sbjct  422  DDE-TMPPG-DAAQSGFNFGSAEVPSVP  447



>gb|KHN14650.1| Importin subunit alpha-1 [Glycine soja]
Length=533

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  442  NILKVGEAEKSLGNTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  501

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  Q GF FGN+   VP
Sbjct  502  DDE-TLPAG-DGAQPGFNFGNNDLPVP  526



>ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=529

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    IN+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKSLGRTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG  + +VP
Sbjct  498  DDE-TMPPG-DAAQQGFQFGGGEVSVP  522



>ref|XP_009621534.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
 ref|XP_009621540.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
Length=529

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG+ + +VP
Sbjct  498  DDE-TMPPG-DAPQQGFQFGDGEVSVP  522



>ref|XP_010931697.1| PREDICTED: importin subunit alpha-1b [Elaeis guineensis]
Length=531

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E+++
Sbjct  442  KVGEAEKNLGATGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDD  501

Query  351  PNLPDGVDENQQGFTFGNS-QPNVP  280
              +P G D  Q GF FGN+ Q  VP
Sbjct  502  A-MPTG-DAAQSGFHFGNNEQVQVP  524



>ref|XP_008797160.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E+++
Sbjct  442  KVGEAEKNLGTTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDD  501

Query  351  PNLPDGVDENQQGFTFGNS-QPNVP  280
              +P G D  Q GF FGN+ Q  VP
Sbjct  502  A-MPTG-DAAQTGFNFGNNEQVQVP  524



>ref|XP_008810191.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810193.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810194.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQTAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGATAGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            +++  +P G D  Q GF FGN+ Q  VP
Sbjct  499  EDD-AMPTG-DAAQSGFQFGNNEQVQVP  524



>ref|NP_187328.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 ref|NP_850524.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 sp|Q96321.2|IMPA1_ARATH RecName: Full=Importin subunit alpha-1; Short=IMPa-1; AltName: 
Full=Karyopherin subunit alpha-1; Short=KAP-alpha-1 [Arabidopsis 
thaliana]
 gb|AAC27644.1| importin alpha [Arabidopsis thaliana]
 gb|AAF63826.1| importin alpha [Arabidopsis thaliana]
 gb|AAM19769.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAM67050.1| importin alpha [Arabidopsis thaliana]
 gb|AAM78039.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AEE74447.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 gb|AEE74448.1| Importin subunit alpha-1 [Arabidopsis thaliana]
Length=532

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  438  NILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E   P GVD +Q GF FG +Q  VP
Sbjct  498  EDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>emb|CAA75513.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=532

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  438  NILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E   P GVD +Q GF FG +Q  VP
Sbjct  498  EDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_004495674.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Cicer arietinum]
Length=533

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            D+E  +P G D  Q GF FG+++ P+VP
Sbjct  500  DDE-TMPPG-DAAQSGFNFGSAEVPSVP  525



>gb|AAL06825.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=532

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  438  NILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E   P GVD +Q GF FG +Q  VP
Sbjct  498  EDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_011036930.1| PREDICTED: importin subunit alpha-1 isoform X1 [Populus euphratica]
Length=530

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKE+AWAISNATSGG++EQI++L  QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKESAWAISNATSGGTHEQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  439  NILKVGEADKNVSNTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D +Q GF FG   P VP
Sbjct  499  DDE-TMPPG-DASQSGFQFGGDAPAVP  523



>gb|AAB72116.2| AtKAP alpha [Arabidopsis thaliana]
Length=532

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  438  NILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E   P GVD +Q GF FG +Q  VP
Sbjct  498  EDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_011036931.1| PREDICTED: importin subunit alpha-1 isoform X2 [Populus euphratica]
Length=529

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKE+AWAISNATSGG++EQI++L  QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKESAWAISNATSGGTHEQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  438  NILKVGEADKNVSNTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D +Q GF FG   P VP
Sbjct  498  DDE-TMPPG-DASQSGFQFGGDAPAVP  522



>ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum]
Length=529

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    IN+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGRTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG  + +VP
Sbjct  498  DDE-TMPPG-DAPQQGFQFGGGEVSVP  522



>ref|XP_010486198.1| PREDICTED: importin subunit alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010486199.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486200.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486201.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  D
Sbjct  440  NILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLED  499

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            EDEE   P GVD +Q GF FG +Q  VP
Sbjct  500  EDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>gb|EEC78554.1| hypothetical protein OsI_18524 [Oryza sativa Indica Group]
Length=502

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  355  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  414

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  415  KVGEAEKNLGAGD-VNAYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  473

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QPNVP
Sbjct  474  A-MPSG-DNAQNGFNFGNQQPNVP  495



>ref|XP_010444089.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVQQGCIKPLCDLLVCPDPRIITVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  D
Sbjct  440  NILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLED  499

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            EDEE   P GVD +Q GF FG +Q  VP
Sbjct  500  EDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>ref|XP_010094009.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55043.1| Importin subunit alpha-1 [Morus notabilis]
Length=530

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGNTGGVNQYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            +++  +P G D +Q GF FG  Q P+VP
Sbjct  498  EDD-TMPPG-DASQSGFNFGGDQVPSVP  523



>ref|XP_002512485.1| importin alpha, putative [Ricinus communis]
 gb|EEF49937.1| importin alpha, putative [Ricinus communis]
Length=531

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+++QI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LENAEFDIKKEAAWAISNATSGGTHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMND-GINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGD  364
            NILKVGEADK LG ND G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +
Sbjct  438  NILKVGEADKNLGNNDGGVNLYAQMIDDAEGLEKIENLQSHDNIEIYEKAVKILETYWLE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNS-QPNVP  280
            E++E  +P G D +Q GF FG S  P +P
Sbjct  498  EEDE-TMPPG-DASQSGFQFGGSDMPTIP  524



>ref|XP_010464259.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  D
Sbjct  440  NILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLED  499

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            EDEE   P GVD +Q GF FG +Q  VP
Sbjct  500  EDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>gb|KDP28222.1| hypothetical protein JCGZ_13993 [Jatropha curcas]
Length=535

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEF+IKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  386  AEFEIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENIL  445

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG +   N+YAQ+ID+ EGL+K+ENLQ+HDN++IYEKAVKILE YW +EDE+
Sbjct  446  KVGEAEKNLGNSGETNLYAQLIDDAEGLEKIENLQSHDNHDIYEKAVKILETYWLEEDED  505

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D +Q GF FG ++  VP
Sbjct  506  ETLPSG-DASQSGFHFGGNEVPVP  528



>ref|XP_002882488.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58747.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  438  NILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED+E   P GVD +Q GF FG +Q  VP
Sbjct  498  EDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_010914512.1| PREDICTED: importin subunit alpha-1b-like [Elaeis guineensis]
Length=531

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E+++
Sbjct  442  KVGEAEKNLGTTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDD  501

Query  351  PNLPDGVDENQQGFTFGNS-QPNVP  280
              +P G D  Q GF FGN+ Q  VP
Sbjct  502  A-MPAG-DAAQTGFHFGNNEQLQVP  524



>ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum]
Length=531

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  440  NILKVGEAEKSFGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWL-E  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG+S   VP
Sbjct  499  DEDETLPAG-DGSQPGFNFGSSDLPVP  524



>ref|NP_001054692.1| Os05g0155500 [Oryza sativa Japonica Group]
 sp|Q9SLX0.2|IMA1B_ORYSJ RecName: Full=Importin subunit alpha-1b [Oryza sativa Japonica 
Group]
 dbj|BAF16606.1| Os05g0155500 [Oryza sativa Japonica Group]
 gb|EEE62387.1| hypothetical protein OsJ_17176 [Oryza sativa Japonica Group]
 gb|AGW80665.1| hypothetical protein [Oryza sativa Japonica Group]
Length=534

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  387  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  446

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  447  KVGEAEKNLGAGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  505

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QPNVP
Sbjct  506  A-MPSG-DNAQNGFNFGNQQPNVP  527



>ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
 gb|EMJ06231.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
Length=530

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI+ L  QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  381  AEFDIKKEAAWAISNATSGGSHEQIKILVDQGCIKPLCDLLICPDPRIVTVCLEGLENIL  440

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQ ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  EDE+
Sbjct  441  KVGEAEKNLGTTGGVNLYAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYW-VEDED  499

Query  351  PNLPDGVDENQQGFTF-GNSQPNVP  280
              +P G D +Q GF F GN  P VP
Sbjct  500  ETMPPG-DASQTGFNFGGNGMPTVP  523



>gb|KHN03320.1| Importin subunit alpha-1 [Glycine soja]
Length=487

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG +EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  336  LQNAEFDIKKEAAWAISNATSGGIHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  395

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  396  NILKVGEAEKSLGNTGDVNEYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  455

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D  Q GF FGN++  VP
Sbjct  456  EDE-TLPSG-DGAQPGFNFGNNELPVP  480



>ref|XP_008245768.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=530

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI+ L  QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  381  AEFDIKKEAAWAISNATSGGSHEQIKILVDQGCIKPLCDLLICPDPRIVTVCLEGLENIL  440

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQ ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW  EDE+
Sbjct  441  KVGEAEKNLGTTGGVNLYAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYW-VEDED  499

Query  351  PNLPDGVDENQQGFTFGNS-QPNVP  280
              +P G D +Q GF FG S  P VP
Sbjct  500  ETMPPG-DASQTGFNFGGSGMPTVP  523



>gb|KJB82641.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
 gb|KJB82642.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
Length=529

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK LG   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  438  NILKVGEADKNLGTTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D +Q GF FG  +  VP
Sbjct  498  EDE-TMPPG-DASQTGFHFGGGELPVP  522



>ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
 gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
Length=529

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  439  NILKVGEAEKSLGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            D++  LP G D  Q GF FGN  P
Sbjct  499  DDD-TLPTG-DGAQPGFNFGNELP  520



>ref|XP_007051048.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 ref|XP_007051049.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95205.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95206.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
Length=534

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  443  NILKVGEAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVED  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D +Q GF FG +Q  VP
Sbjct  503  EDEP-LPPG-DASQSGFQFGANQHPVP  527



>ref|XP_006297392.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 ref|XP_006297393.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30290.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30291.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
Length=536

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  442  NILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNHEIYEKAVKILEAYWLEE  501

Query  360  -DEEPNLPDGVDENQQGFTFGNSQPNVP  280
             DEE     GVD +Q GF FG +Q +VP
Sbjct  502  GDEETQQAPGVDSSQAGFQFGGNQASVP  529



>ref|XP_010268071.1| PREDICTED: importin subunit alpha-1-like [Nelumbo nucifera]
Length=529

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
             + AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LHTAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE++K LG   G+N+YAQ+IDE EGLDK+ENLQ HDN+EIYEKAVKILE YW +E
Sbjct  438  NILKVGESEKNLGNTGGVNVYAQLIDEAEGLDKIENLQIHDNSEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
             +E   P   D +Q GF FG S+  VP
Sbjct  498  QDEILAP--ADASQPGFQFGGSELQVP  522



>ref|XP_006655009.1| PREDICTED: importin subunit alpha-1b-like [Oryza brachyantha]
Length=529

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K L   D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  439  NILKVGEAEKNLAAGD-VNAYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +++  +P G D  Q GF FGN QPNVP
Sbjct  498  EDDA-MPSG-DNAQNGFNFGNQQPNVP  522



>dbj|BAE71209.1| putative importin alpha [Trifolium pratense]
Length=533

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            ++E  +P G +  Q GF FG ++ P+VP
Sbjct  500  EDE-TMPPG-EAAQSGFNFGGAEVPSVP  525



>ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 ref|XP_010649542.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 emb|CBI22923.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  381  AEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  440

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG +  +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  441  KVGEAEKTLGNSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D +Q GF FG +  +VP
Sbjct  501  -TLPSG-DGSQPGFQFGGNDVSVP  522



>gb|ABM05487.1| Impa1 [Nicotiana benthamiana]
Length=532

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP   D    GF FG  +  +P
Sbjct  500  DDE-QLPSA-DAQHSGFNFGGGELPLP  524



>dbj|BAA88950.1| importin alpha 1b [Oryza sativa Japonica Group]
Length=534

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  384  LQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  444  NILKVGEAEKNLGAGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +++  +P G D  Q GF  GN QPNVP
Sbjct  503  EDDA-MPSG-DNAQNGFNLGNQQPNVP  527



>gb|KHG29743.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=556

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+++Q++FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHDQMKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK LG   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  438  NILKVGEADKNLGTTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D +Q GF FG  +  VP
Sbjct  498  EDE-TMPPG-DASQTGFHFGGGELPVP  522



>ref|XP_011046400.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Populus euphratica]
Length=529

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTV LEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVSLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +   N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGNSGDANFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D  QQGF FG +   VP
Sbjct  499  DDE-TLPSG-DGAQQGFQFGGNDVQVP  523



>ref|XP_010093918.1| Importin subunit alpha [Morus notabilis]
 gb|EXB54870.1| Importin subunit alpha [Morus notabilis]
Length=840

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 10/147 (7%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF+IKKEAAWAISNATSGGS+EQI+FL +QGC+ PLCDLL CPDPRI+TVCLEGLE
Sbjct  381  LQHAEFEIKKEAAWAISNATSGGSHEQIQFLVTQGCIAPLCDLLACPDPRIITVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK++G+N GIN+YAQ IDEC+GLDK+E+LQ HDNNEIYEKAVKILE+YW +E
Sbjct  441  NILKVGEADKEMGLNGGINLYAQQIDECDGLDKIESLQNHDNNEIYEKAVKILERYWTEE  500

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D++ NLP           F   QP +P
Sbjct  501  DDDENLP----------VFAGGQPTLP  517


 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 10/118 (8%)
 Frame = -3

Query  633  FLASQGCVKPLCDLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECE  454
            FL +QGC+ PLCDLL CPDPRI+TVCLEGLENILKVGEADK++G+N GIN+YAQ IDEC+
Sbjct  525  FLVTQGCIAPLCDLLACPDPRIITVCLEGLENILKVGEADKEMGLNGGINLYAQQIDECD  584

Query  453  GLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            GLDK+E+LQ HDNNEIYEKAVKILE+YW +ED++ NLP           F   QP +P
Sbjct  585  GLDKIESLQNHDNNEIYEKAVKILERYWTEEDDDENLP----------VFAGGQPTLP  632



>gb|KJB41861.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=453

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  302  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  361

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  362  NILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYW-VE  420

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG +Q  VP
Sbjct  421  DEDEALPTG-DASQPGFQFGGNQLPVP  446



>ref|XP_009606138.1| PREDICTED: importin subunit alpha [Nicotiana tomentosiformis]
Length=530

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+ +QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFEIKKEAAWAISNATSGGNQDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  439  NILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP   D    GF FG  +  +P
Sbjct  499  DDE-QLPSA-DAQHSGFNFGGGELPLP  523



>gb|KHN02923.1| Importin subunit alpha-1 [Glycine soja]
Length=530

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEA+WAISNATSGG+++QI++L SQGCVKPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQSAEFDIKKEASWAISNATSGGTHDQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEK VKILE YW +E
Sbjct  439  NILKVGEAEKSLGNTGDVNVYAQMIDEAEGLEKIENLQSHDNNEIYEKVVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G +  Q GF FGN++  VP
Sbjct  499  EDE-TLPSG-NGAQPGFNFGNNELPVP  523



>gb|KHG28859.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=534

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  443  NILKVGVAEKNLGHTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D +Q GF FG +Q  VP
Sbjct  503  EDEP-LPPG-DASQSGFQFGGNQLPVP  527



>ref|XP_010649543.1| PREDICTED: importin subunit alpha-1 isoform X2 [Vitis vinifera]
Length=509

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  361  AEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  420

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG +  +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  421  KVGEAEKTLGNSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  480

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D +Q GF FG +  +VP
Sbjct  481  -TLPSG-DGSQPGFQFGGNDVSVP  502



>ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=530

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG +EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAISNATSGGIHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKSLGNTGDVNEYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D  Q GF FGN++  VP
Sbjct  499  EDE-TLPSG-DGAQPGFNFGNNELPVP  523



>gb|KJB24393.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=535

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  384  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  444  NILKVGVAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  503

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D +Q GF FG +Q  VP
Sbjct  504  EDEP-LPPG-DASQSGFQFGGNQLPVP  528



>dbj|BAK07842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L  QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  143  AEFDIKKEAAWAISNATSGGTHDQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLENIL  202

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E++E
Sbjct  203  KVGEAEKNLGAGD-VNNYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDE  261

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FG+ Q +VP
Sbjct  262  V-MPSG-DNAQNGFNFGSQQNSVP  283



>gb|KJB24392.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=534

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  443  NILKVGVAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D +Q GF FG +Q  VP
Sbjct  503  EDEP-LPPG-DASQSGFQFGGNQLPVP  527



>ref|XP_009789105.1| PREDICTED: importin subunit alpha [Nicotiana sylvestris]
Length=532

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP   D    GF FG     +P
Sbjct  500  DDE-QLPSA-DAQHSGFNFGGGDLPLP  524



>ref|XP_010094336.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis]
Length=529

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+NEQI++L SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQQCIKPLCDLLLCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +  +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEK VKILE YW +E
Sbjct  438  NILKVGEAEKNLGNSGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKTVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D +Q GF FG +   VP
Sbjct  498  DDE-TLPPG-DGSQSGFRFGGNDLPVP  522



>ref|XP_008458386.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
 ref|XP_008458387.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
Length=530

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG N  +N+YAQMID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGTNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP      Q GF FG ++  VP
Sbjct  498  EDEA-LPTTDGGAQPGFRFGGNELPVP  523



>gb|KJB41862.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=535

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  384  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  444  NILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWV-E  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG +Q  VP
Sbjct  503  DEDEALPTG-DASQPGFQFGGNQLPVP  528



>gb|KHG01621.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
 gb|KJB41859.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41860.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41864.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41865.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=534

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  443  NILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWV-E  501

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG +Q  VP
Sbjct  502  DEDEALPTG-DASQPGFQFGGNQLPVP  527



>gb|AFW81447.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
 gb|AFW81448.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
Length=529

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  383  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  443  KVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  501

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  502  A-MPSG-DNPQNGFNFGN-QPSVP  522



>ref|XP_004150082.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
 ref|XP_004161385.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
 gb|KGN47403.1| hypothetical protein Csa_6G312550 [Cucumis sativus]
Length=530

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG N  +N+YAQMID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGTNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP      Q GF FG ++  VP
Sbjct  498  EDEA-LPATDGGAQPGFRFGGNELPVP  523



>ref|XP_006378029.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
 gb|ERP55826.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
Length=285

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+ PDPRIVTV LEGLE
Sbjct  82   LQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVSPDPRIVTVSLEGLE  141

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG +   N YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  142  NILKVGEAEKNLGNSGDANFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  201

Query  360  DEEPNLPDGVDENQQGFTFG  301
            D+E  LP G D  QQGF FG
Sbjct  202  DDE-TLPSG-DGAQQGFQFG  219



>ref|NP_001141568.1| uncharacterized protein LOC100273684 [Zea mays]
 gb|ACN28186.1| unknown [Zea mays]
 gb|ACN28383.1| unknown [Zea mays]
 gb|AFW77281.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
 gb|AFW77282.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
Length=528

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  442  KVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  501  A-MPSG-DNPQNGFNFGN-QPSVP  521



>gb|KHG28860.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=557

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  443  NILKVGVAEKNLGHTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D +Q GF FG +Q  VP
Sbjct  503  EDEP-LPPG-DASQSGFQFGGNQLPVP  527



>ref|XP_007031099.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 ref|XP_007031100.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11601.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11602.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
Length=529

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK  G   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  438  NILKVGEADKNQGNTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D +Q GF FG  + +VP
Sbjct  498  EDE-TMPPG-DASQTGFQFGPGEVHVP  522



>ref|XP_008350735.1| PREDICTED: importin subunit alpha-1b-like, partial [Malus domestica]
Length=239

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  87   LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  146

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EIYEKAVK+LE YW ++
Sbjct  147  NILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLED  206

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D+E  +P G D     F F GN  P VP
Sbjct  207  DDE-TMPPG-DAAPTTFNFGGNDVPTVP  232



>gb|AES65063.2| importin subunit alpha-1b [Medicago truncatula]
Length=530

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEA+K  G    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  439  NILKIGEAEKSFGNAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYW-LE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG +   VP
Sbjct  498  DEDETLPPG-DGSQPGFNFGGNDLPVP  523



>ref|XP_004977076.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Setaria 
italica]
Length=530

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+N+QI++L  QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  384  AEFDIKKEAAWAISNATSGGTNDQIKYLVGQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  443

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQ+ID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  444  KVGEAEKNLGAGD-VNVYAQLIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  502

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  503  A-MPSG-DNPQNGFNFGN-QPSVP  523



>emb|CDP17235.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              + EF+IKKEAAWAISNATSGGS+EQI++L SQ C+KPLCDLL+CPDPRIV+VCLEGLE
Sbjct  377  LQNGEFEIKKEAAWAISNATSGGSHEQIKYLVSQACIKPLCDLLVCPDPRIVSVCLEGLE  436

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG+   +N+YAQMID+ EGL+K+ENLQ+HDNN+IYEKAVKILE YW +E
Sbjct  437  NILKVGEAEKNLGITGDVNLYAQMIDDAEGLEKIENLQSHDNNDIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D++  +P G D +QQ F  G SQ +VP
Sbjct  497  DDD-TMPPG-DASQQSFQLGGSQISVP  521



>ref|XP_010259399.1| PREDICTED: importin subunit alpha-1 [Nelumbo nucifera]
Length=529

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  381  AEFDIKKEAAWAISNATSGGNHDQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  440

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG   G+N+YAQ+ID+ EGL+K+ENLQ HDN EIYEKAVKILE YW +E++E
Sbjct  441  KVGEAEKNLGNTGGVNLYAQLIDDAEGLEKIENLQNHDNTEIYEKAVKILETYWMEEEDE  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D +Q GF FG ++  VP
Sbjct  501  -TLPPG-DASQPGFRFGGNELPVP  522



>ref|XP_010231685.1| PREDICTED: importin subunit alpha-1b [Brachypodium distachyon]
Length=532

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 3/144 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  385  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENIL  444

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +ED+E
Sbjct  445  KVGEAEKNLGAGD-VNTYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEDDE  503

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G +  Q GF FGN Q +VP
Sbjct  504  A-MPTG-ENPQNGFNFGNQQNSVP  525



>ref|XP_008360253.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Malus domestica]
Length=485

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  335  LQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  394

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK+VKILE YW +E
Sbjct  395  NILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEE  453

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D +Q GF FG S+  VP
Sbjct  454  DEE-TLPAG-DGSQPGFRFGGSEVQVP  478



>ref|XP_004144766.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
 gb|KGN60977.1| hypothetical protein Csa_2G033320 [Cucumis sativus]
Length=529

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K      G+N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNTTNTGGVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D  Q GF FG  +P VP
Sbjct  498  EDE-TMPPGTDP-QAGFNFGGDRPVVP  522



>ref|XP_002440631.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
 gb|EES19061.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
Length=530

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  384  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  443

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYEKAVK+LE YW +E+++
Sbjct  444  KVGEAEKNLGGGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDD  502

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P G D  Q GF FGN QP+VP
Sbjct  503  A-MPSG-DNPQNGFNFGN-QPSVP  523



>ref|XP_007163337.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
 gb|ESW35331.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
Length=531

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQ++FL SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  380  LQNAEFDIKKEAAWAISNATSGGSHEQVKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE++K +   DG+N+Y  MID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  440  NILKVGESEKNVSNADGVNLYGAMIDDVEGLEKIENLQSHDNTEIYEKAVKILETYWMEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQ-PNVP  280
            D+E  +P G  +  QGF FG  + P+VP
Sbjct  500  DDE-TVPPG--DASQGFNFGGHKFPSVP  524



>ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula]
Length=561

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG++EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  410  LQNAEFDIKKEAAWALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  469

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEA+K  G    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  470  NILKIGEAEKSFGNAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYW-LE  528

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D +Q GF FG +   VP
Sbjct  529  DEDETLPPG-DGSQPGFNFGGNDLPVP  554



>ref|XP_002515324.1| importin alpha, putative [Ricinus communis]
 gb|EEF47308.1| importin alpha, putative [Ricinus communis]
Length=454

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  305  AEFEIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENIL  364

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG     N+YAQMIDE EGL+K+ENLQ+HDNN+IYEKAVKILE YW +EDE+
Sbjct  365  KVGEAEKNLGNTGDANLYAQMIDEAEGLEKIENLQSHDNNDIYEKAVKILETYWLEEDED  424

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              L    D +Q GF FG ++   P
Sbjct  425  EALAPA-DASQSGFHFGGNEVPAP  447



>ref|XP_009393195.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=530

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L SQGCVKPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGNHDQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG +  +N+YAQMI+E EGL+K+ENLQ+HDN EIYEKAVKILE YW +ED+ 
Sbjct  442  KVGEAEKNLGASGDVNLYAQMIEEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDA  501

Query  351  PNLPDGVDENQQGFTFGNSQPNV  283
              +P G D  Q GF FGN+  N 
Sbjct  502  --MPTG-DAAQTGFHFGNNGQNT  521



>gb|KJB49857.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
 gb|KJB49858.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
Length=534

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  443  NILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVED  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D  Q G  FG +Q  VP
Sbjct  503  EDEP-LPPG-DAAQSGLQFGGNQLPVP  527



>ref|XP_009369966.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK+VKILE YW +E
Sbjct  438  NILKVGEAEKAVG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D  Q GF FG S+  VP
Sbjct  497  DEE-TLPAG-DGTQPGFRFGGSEVQVP  521



>gb|KHG15238.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=534

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  383  LQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW ++
Sbjct  443  NILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVED  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++EP LP G D  Q G  FG +Q  VP
Sbjct  503  EDEP-LPLG-DAAQSGLQFGGNQLPVP  527



>gb|KDO87079.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=431

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  714  HAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENI  535
            +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLENI
Sbjct  281  NAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENI  340

Query  534  LKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDE  355
            LK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +EDE
Sbjct  341  LKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDE  400

Query  354  EPNLPDGVDENQQGFTFGNSQPNVPE  277
            +  LP G D  Q GF F  +   VP 
Sbjct  401  DEPLPPG-DATQAGFGFAGNGLPVPS  425



>ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEF+IKKEAAWAISNATSGG++EQI+ L ++GC+KPL DLL+CPDPRIVTVCLEGLE
Sbjct  378  LQTAEFEIKKEAAWAISNATSGGTHEQIKVLVTEGCIKPLSDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG N G N+YAQ+IDE +GL+K+ENLQTHDNNEIYEKAVKILE YW  E
Sbjct  438  NILKVGEAEKNLG-NSGTNLYAQLIDEADGLEKIENLQTHDNNEIYEKAVKILETYW-LE  495

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DE+  LP G D  Q GF FG + P VP
Sbjct  496  DEDETLPAG-DAAQPGFNFGGNGPQVP  521



>ref|XP_008360251.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Malus domestica]
Length=528

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK+VKILE YW +E
Sbjct  438  NILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D +Q GF FG S+  VP
Sbjct  497  DEE-TLPAG-DGSQPGFRFGGSEVQVP  521



>ref|XP_001760522.1| predicted protein [Physcomitrella patens]
 gb|EDQ74597.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS EQI++L +QGC+KPLCDLL CPDPRIVTV LEGLENIL
Sbjct  383  AEFDIKKEAAWAISNATSGGSPEQIKYLVTQGCIKPLCDLLTCPDPRIVTVSLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE +K LG + GIN+YA+ IDE EGL+K+ENLQTHDNNEIYEKAVKILE YW +EDE+
Sbjct  443  KVGEQEKDLGNSGGINLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDED  502

Query  351  PNLPDGVDENQQGFTFGNS  295
             N   G +   QGF FG S
Sbjct  503  QNFAPGTE--GQGFAFGTS  519



>ref|XP_006480039.1| PREDICTED: importin subunit alpha-like [Citrus sinensis]
 gb|KDO87073.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87074.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=529

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -3

Query  714  HAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENI  535
            +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLENI
Sbjct  379  NAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENI  438

Query  534  LKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDE  355
            LK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +EDE
Sbjct  439  LKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDE  498

Query  354  EPNLPDGVDENQQGFTFGNSQPNVP  280
            +  LP G D  Q GF F  +   VP
Sbjct  499  DEPLPPG-DATQAGFGFAGNGLPVP  522



>ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI+++  QGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHDQIKYIVGQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            K+GEA+K LG    +N YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E+++
Sbjct  442  KIGEAEKNLGATGAVNSYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWMEEEDD  501

Query  351  PNLPDGVDENQQGFTFGNS-QPNVP  280
              +P G D  Q GF FGNS Q  VP
Sbjct  502  A-MPTG-DAAQTGFQFGNSGQNTVP  524



>ref|NP_001234006.1| importin subunit alpha [Solanum lycopersicum]
 sp|O22478.2|IMA_SOLLC RecName: Full=Importin subunit alpha; AltName: Full=Karyopherin 
subunit alpha; Short=KAP alpha [Solanum lycopersicum]
 gb|AAC23722.1| importin alpha [Solanum lycopersicum]
Length=527

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 5/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  439  NILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++ P     V  N+  F FG +  ++P
Sbjct  499  EDVP-----VSLNEDQFEFGGADISLP  520



>ref|XP_008781168.1| PREDICTED: importin subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=536

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI +L SQGC+KPLCDLL+ PDPRIV VCLEGLE
Sbjct  382  LQHAEFDIKKEAAWAISNATSGGSDEQIHYLVSQGCIKPLCDLLVSPDPRIVIVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE +K+LG  DGIN+YAQ+I +CEGLDK+ENLQ H NNEIYEK +K+LE+YW +E
Sbjct  442  NILKVGETEKELGKTDGINLYAQLIYDCEGLDKIENLQGHGNNEIYEKTIKMLERYWLEE  501

Query  360  DEEPNLPDG-VDENQQGFTFGNSQPNVP  280
            ++E     G ++  +  F FG S+ ++P
Sbjct  502  EDEAQSARGSLEGTEHAFEFGVSKSSLP  529



>gb|EPS72677.1| impa2, partial [Genlisea aurea]
Length=211

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEF+IKKEAAWAISNATSGGS EQI+FL  QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  57   LQTAEFEIKKEAAWAISNATSGGSQEQIKFLVEQGCIKPLCDLLVCPDPRIVTVCLEGLE  116

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE++K  G +  +N++AQ++DE EGLDK+E LQ+HDNNEIYEKAVKILE YW ++
Sbjct  117  NILKVGESEKNQGNSGNVNVFAQLVDEAEGLDKIETLQSHDNNEIYEKAVKILEAYWLED  176

Query  360  DEEPNLPDGVDENQQ--GFTFGNSQPN-VP  280
            D+E  L  G D  QQ  GF FG    N VP
Sbjct  177  DDE-QLAAGDDNVQQQSGFNFGGGDDNGVP  205



>gb|KDO87077.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87078.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=488

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  714  HAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENI  535
            +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLENI
Sbjct  338  NAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENI  397

Query  534  LKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDE  355
            LK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +EDE
Sbjct  398  LKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDE  457

Query  354  EPNLPDGVDENQQGFTFGNSQPNVPE  277
            +  LP G D  Q GF F  +   VP 
Sbjct  458  DEPLPPG-DATQAGFGFAGNGLPVPS  482



>ref|XP_006407910.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
 gb|ESQ49363.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
Length=536

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI +L  QGC+KPLCDLLICPDPRI+TVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGSHDQIIYLVEQGCIKPLCDLLICPDPRIITVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGE++K LG     N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  442  NILKVGESEKTLGNTGETNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  501

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            EDEE     G D +Q GF FG +Q +VP
Sbjct  502  EDEETQQAPGGDGSQAGFQFGGNQASVP  529



>gb|EMT29219.1| Importin subunit alpha-1b [Aegilops tauschii]
Length=537

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  245  AEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENIL  304

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E++E
Sbjct  305  KVGEAEKNLGAGD-VNNYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDE  363

Query  351  PNLPDGVDENQQGFTFGNSQPNVPE  277
              +P G D  Q GF FG+ Q +VP 
Sbjct  364  -VMPSG-DNAQNGFNFGSQQNSVPS  386



>ref|XP_004158728.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus]
Length=529

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K       +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNTTNTGCVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D  Q GF FG  +P VP
Sbjct  498  EDE-TMPPGTDP-QAGFNFGGDRPVVP  522



>ref|XP_010024115.1| PREDICTED: importin subunit alpha-1a [Eucalyptus grandis]
 gb|KCW60545.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
 gb|KCW60546.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
Length=531

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVCQGCIKPLCDLLICPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVK+LE YW +E
Sbjct  439  NILKVGEAEKNLGGTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKLLETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            ++E   P+  D    G  F GN  P VP
Sbjct  499  EDEAMPPE--DSAHPGVPFGGNELPPVP  524



>ref|XP_008453860.1| PREDICTED: importin subunit alpha-1 [Cucumis melo]
Length=529

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K      G+N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNTTDTGGVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G    Q GF FG  +P VP
Sbjct  498  EDE-TMPPGTAP-QGGFNFGGDRPVVP  522



>gb|AII99829.1| importin alpha [Nicotiana tabacum]
Length=528

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 4/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQTAEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEK--ANTGGINFYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G DE Q GF FG +   +P
Sbjct  497  EDE-TLPAG-DETQAGFNFGGNDIQLP  521



>ref|XP_011092122.1| PREDICTED: importin subunit alpha-1 [Sesamum indicum]
Length=530

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFD+KKEAAWAISNATSGG++EQI++L SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDVKKEAAWAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+Y QMI++ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKNLGRTGDVNLYGQMIEDAEGLEKIENLQSHDNIEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFG  301
            D+EP  P G    QQGF FG
Sbjct  499  DDEPA-PPGDASQQQGFQFG  517



>ref|XP_009631847.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=529

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  383  AEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  443  KVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G DE Q GF FG +   +P
Sbjct  501  -TLPAG-DETQAGFNFGGNDIQLP  522



>ref|XP_004302255.1| PREDICTED: importin subunit alpha-1 [Fragaria vesca subsp. vesca]
Length=532

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 118/152 (78%), Gaps = 7/152 (5%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
             + AEFDIKKEAAWA+SNATSGGS++QI+ L + GC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  376  LSSAEFDIKKEAAWAVSNATSGGSHDQIKILVNHGCIKPLCDLLICPDPRIVTVCLEGLE  435

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW---  370
            NILKVGEA+K LGM  G+N++AQ IDE EGL+K+ENLQTHDN EIYEKAVK+LE YW   
Sbjct  436  NILKVGEAEKNLGMTGGVNLFAQAIDEAEGLEKIENLQTHDNAEIYEKAVKLLETYWLED  495

Query  369  --GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  280
              GDE   P   D       GF FG + P VP
Sbjct  496  DDGDETMPPG--DAATVPTGGFNFGGNAPTVP  525



>ref|XP_009796163.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  442  KVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  499

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G DE Q GF FG +   +P
Sbjct  500  -TLPAG-DETQAGFNFGGNDIQLP  521



>ref|XP_010548966.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=524

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              ++EFDIKKEAAWAISNATSGGS+EQI++L  QGC+KPLCDLL+CPDPRI+TVCLEGLE
Sbjct  373  LQNSEFDIKKEAAWAISNATSGGSHEQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLE  432

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +G    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  433  NILKVGEAEKTMGNTGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  492

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E + P   D + QGF FG ++  +P
Sbjct  493  EDEASPPG--DGSAQGFQFGGNEAPLP  517



>ref|XP_009414157.1| PREDICTED: importin subunit alpha-1a-like [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSG SNEQI +LASQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  383  LQHAEFDIKKEAAWAISNATSGSSNEQIHYLASQGCIKPLCDLLVCPDPRIVTVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE +K LG   G+N YAQ+IDECEGLDK+ENLQ HDNNEIYEK +K+LE+YW +E
Sbjct  443  NILKVGEIEKDLG-KCGVNPYAQLIDECEGLDKIENLQGHDNNEIYEKTIKLLERYWVEE  501

Query  360  DEEPNLPDGVDENQQGFT-FGNSQPNVP  280
            ++E     G  E  +  +    SQP+VP
Sbjct  502  EDEAQDALGSTEGAEHSSEVAISQPSVP  529



>ref|XP_009373267.1| PREDICTED: importin subunit alpha-1b [Pyrus x bretschneideri]
Length=530

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EIYEKAVK+LE YW ++
Sbjct  438  NILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLED  497

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D+E  +P G D     F F GN  P+VP
Sbjct  498  DDE-TMPPG-DAASTAFNFGGNDVPSVP  523



>ref|XP_009347771.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009347772.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK+VKILE YW +E
Sbjct  438  NILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D  Q G  FG S+  VP
Sbjct  497  DEE-TLPAG-DGTQPGLRFGGSEVQVP  521



>emb|CDO98799.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRI+ VCLEGLENIL
Sbjct  380  AEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIIAVCLEGLENIL  439

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE +K LG +  +N YAQ++DE EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  440  KVGEVEKSLGNSGDVNFYAQLVDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  499

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D  Q GF FG +   +P
Sbjct  500  -TLPAG-DGGQPGFNFGGNDMQLP  521



>ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
 gb|ESW26335.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
Length=529

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGG+++QI++L +QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  E
Sbjct  439  NILKVGEAEKSLGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWL-E  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQP  289
            DE+  LP G +  Q  F FG+  P
Sbjct  498  DEDETLPSG-EGAQPDFAFGSELP  520



>ref|XP_008781167.1| PREDICTED: importin subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=567

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGGS+EQI +L SQGC+KPLCDLL+ PDPRIV VCLEGLE
Sbjct  413  LQHAEFDIKKEAAWAISNATSGGSDEQIHYLVSQGCIKPLCDLLVSPDPRIVIVCLEGLE  472

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE +K+LG  DGIN+YAQ+I +CEGLDK+ENLQ H NNEIYEK +K+LE+YW +E
Sbjct  473  NILKVGETEKELGKTDGINLYAQLIYDCEGLDKIENLQGHGNNEIYEKTIKMLERYWLEE  532

Query  360  DEEPNLPDG-VDENQQGFTFGNSQPNVP  280
            ++E     G ++  +  F FG S+ ++P
Sbjct  533  EDEAQSARGSLEGTEHAFEFGVSKSSLP  560



>gb|ABM05488.1| Impa2 [Nicotiana benthamiana]
Length=529

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  383  AEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  443  KVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDE  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G DE Q GF FG +   +P
Sbjct  501  -TLPAG-DEAQAGFNFGGNDIQLP  522



>ref|XP_001773629.1| predicted protein [Physcomitrella patens]
 gb|EDQ61517.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLL CPDPRIVTV LEGLENIL
Sbjct  383  AEFDIKKEAAWAISNATSGGSHDQIKYLVTQGCIKPLCDLLTCPDPRIVTVSLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE +K LG + GIN+YA+ IDE EGL+K+ENLQTHDNNEIYEKAVKILE YW +EDE+
Sbjct  443  KVGEQEKDLGQSGGINLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDED  502

Query  351  PNLPDGVDENQQGFTFGNS  295
             N   G +   Q F FG+S
Sbjct  503  SNAAPGTE--GQTFAFGSS  519



>ref|XP_008345591.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Malus domestica]
Length=524

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  372  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  431

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EIYEKAVK+LE YW ++
Sbjct  432  NILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLED  491

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D+E  +P G D     F F GN  P VP
Sbjct  492  DDE-TMPPG-DAAPAAFNFGGNDVPTVP  517



>ref|XP_009612538.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=528

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+NEQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG+ +  LG    IN+YAQMID+ EG++K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGDVE-NLGEAGNINVYAQMIDDAEGIEKIENLQSHDNQEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D  QQGF FG    +VP
Sbjct  497  DDE-TMPPG-DAPQQGFQFGGGNVSVP  521



>ref|XP_007222489.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
 gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
Length=529

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+ EQI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNAGNTGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D +Q GF FG ++  VP
Sbjct  498  DDE-TLPSG-DGSQPGFHFGGNELQVP  522



>ref|XP_002274422.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CAN75951.1| hypothetical protein VITISV_028605 [Vitis vinifera]
 emb|CBI36918.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+++QI+ L SQGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGTHDQIKLLVSQGCIKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK LG  D +N +AQ ID+ +GL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEADKSLGHTD-VNQFAQAIDDADGLEKIENLQSHDNTEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            DEEP LP G D +Q  F F GN  P VP
Sbjct  497  DEEP-LPPG-DASQSEFHFGGNDHPPVP  522



>ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera]
 emb|CBI39567.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI++L SQ  +KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQASIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGSTREVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFG  301
            ++E  +P G D +Q GF FG
Sbjct  498  EDE-TMPPG-DSSQPGFRFG  515



>emb|CDO98800.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRI+ VCLEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIIAVCLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE +K LG +  +N YAQ+IDE EGL+K+E+LQ+HDNNEIYEKAVKILE YW +E++E
Sbjct  442  KVGEVEKSLGHSGDVNFYAQLIDEAEGLEKIEHLQSHDNNEIYEKAVKILETYWLEEEDE  501

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              LP G D  Q GF FG +   +P
Sbjct  502  -TLPAG-DGGQPGFNFGGNDMQLP  523



>ref|XP_009338212.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=530

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EIYEKAVK+LE YW ++
Sbjct  438  NILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLED  497

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D+E  +P G D     F F GN  P VP
Sbjct  498  DDE-TMPPG-DAAPAAFNFVGNDVPTVP  523



>ref|XP_001763761.1| predicted protein [Physcomitrella patens]
 gb|EDQ71403.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWA+SNATSGG++EQI+ L +QGC+KPLCDLL CPDPRIVTV LEGLENIL
Sbjct  382  AEFDIKKEAAWAVSNATSGGTSEQIKHLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE DK  G N+G+NIYA+ IDE EGL+K+ENLQTHDNNEIYEKAVKILE YW +EDE+
Sbjct  442  KVGEQDKDSGNNNGVNIYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDED  501

Query  351  PNLPDGVDENQQGFTFGNS  295
             N+  G +   Q F FG+S
Sbjct  502  QNVAPGTE--GQNFAFGSS  518



>ref|XP_008388495.1| PREDICTED: importin subunit alpha-1b-like [Malus domestica]
Length=530

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EIYEKAVK+LE YW ++
Sbjct  438  NILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLED  497

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D+E  +P G D     F F GN  P VP
Sbjct  498  DDE-TMPPG-DAAPTTFNFGGNDVPTVP  523



>ref|XP_007031098.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
 gb|EOY11600.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
Length=599

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK  G   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYEKAVK+LE YW +E
Sbjct  438  NILKVGEADKNQGNTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFG  301
            ++E  +P G D +Q GF FG
Sbjct  498  EDE-TMPPG-DASQTGFQFG  515



>ref|XP_001778004.1| predicted protein [Physcomitrella patens]
 gb|EDQ57217.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL CPDPRIVTV LEGLENIL
Sbjct  385  AEFDIKKEAAWAISNATSGGTHDQIKYLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENIL  444

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE +K LG   GIN YA+ IDE EGL+K+ENLQTHDNNEIYEKAVKILE YW +EDEE
Sbjct  445  KVGEQEKDLGKTGGINEYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDEE  504

Query  351  PNLPDGVDENQQGFTFGNS  295
             N   G D   Q F FG+S
Sbjct  505  QNTAPGTD--GQSFAFGSS  521



>ref|XP_008223291.1| PREDICTED: importin subunit alpha-1-like [Prunus mume]
Length=529

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG+ EQI++L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N++AQ+ID+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNAGNTGEVNLFAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  LP G D +Q GF FG ++  VP
Sbjct  498  DDE-TLPSG-DGSQPGFHFGGNELQVP  522



>gb|KHG14170.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=385

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL CPDPRI+TVCLEGLE
Sbjct  224  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLACPDPRIITVCLEGLE  283

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K +G  +  N  AQ+I++ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  284  NILKVGEAEKAVGAGE-FNYCAQLIEDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  342

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D  QQ F FG +   VP
Sbjct  343  DEE-TLPPG-DGTQQSFYFGGNDVKVP  367



>ref|XP_010043209.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043210.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043211.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 gb|KCW85236.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
 gb|KCW85237.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
Length=530

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS+EQI+FL +QGCVKPLCDLLICPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHEQIKFLVNQGCVKPLCDLLICPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N+YAQM+++ EGL+K+E+LQ+HDNNEIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGNTGDVNVYAQMVEDVEGLEKIESLQSHDNNEIYEKAVKILEAYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTF-GNSQPNVP  280
            D++  +P G D  Q    F GN+ P +P
Sbjct  498  DDD-AMPPG-DAPQPDMQFGGNNLPPMP  523



>gb|AIU34461.1| putative importin subunit alpha-2, partial [Taraxacum brevicorniculatum]
Length=531

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG+NEQI++L +QGC+KPLCDLL CPDPRIVTVCLEGLE
Sbjct  380  LQTAEFDIKKEAAWAISNATSGGNNEQIKYLVAQGCIKPLCDLLACPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE +K  G +  +N YAQ+IDE EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  440  NILKVGEIEKNSGQSGDVNFYAQLIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  499

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  + D   + Q GF FG +   +P
Sbjct  500  EDEA-VGDAAGQGQPGFNFGGNNVQLP  525



>ref|XP_009402512.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS++QI+FL  QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQSAEFDIKKEAAWAISNATSGGSHDQIKFLVDQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K      G+N+YAQMIDE EGL+K+ENLQ+HDN EIYEKAVKILE +W +E
Sbjct  439  NILKVGEAEKNQVTTGGVNVYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETFWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNV  283
            +++  +P G D    GF FGN+  N 
Sbjct  499  EDDA-MPTG-DAAPTGFHFGNNGQNT  522



>gb|EYU46779.1| hypothetical protein MIMGU_mgv1a0058492mg, partial [Erythranthe 
guttata]
Length=364

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEF+IKKEAAWA+SNATSGG+N+QI+FL  +GC+KPLCDLL+CPDPRIVTV LEGLE
Sbjct  213  LQTAEFEIKKEAAWALSNATSGGTNDQIKFLVREGCIKPLCDLLVCPDPRIVTVSLEGLE  272

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEADK  G    +N++AQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  273  NILKVGEADKSQGNTGDVNVFAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  332

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+   L  G D +Q GF FG S   VP
Sbjct  333  DDG-ELASG-DASQSGFNFGGSDLPVP  357



>gb|AGZ15387.1| importin alpha [Phaseolus vulgaris]
Length=532

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AE DIKKEAAWAISNAT GGS+EQ++FL SQGC+KPLCDLLICPDPRIVTVCLEGLENIL
Sbjct  383  AEVDIKKEAAWAISNATPGGSHEQVKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENIL  442

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE++K +   DG+N+Y  M D+ EGL+K+ENLQ+HDN EIYEKAVKILE YW +ED+E
Sbjct  443  KVGESEKNVSNADGVNLYGAMFDDVEGLEKIENLQSHDNTEIYEKAVKILETYWMEEDDE  502

Query  351  PNLPDGVDENQQGFTFGNSQ-PNVP  280
              +P G D  Q GF FG  + P+VP
Sbjct  503  -TVPPG-DAFQSGFDFGGHKFPSVP  525



>ref|XP_008340751.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=529

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPDPRIVTVCLEG E
Sbjct  378  LQHAEFDIKKEAAWAISNATSGGTADQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGXE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G +  +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYEK+VKILE YW +E
Sbjct  438  NILKVGEAEKAAGNSGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D  QQG  F  ++  VP
Sbjct  498  DEE-TLPAG-DGTQQGIRFEGNEVQVP  522



>ref|XP_009401503.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=528

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CPDPRI+TVCLEGLENIL
Sbjct  381  AEFEIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLLCPDPRIITVCLEGLENIL  440

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGEA+K LG+  G N YAQ+I++ EGLDK+EN Q+HDN EIYEK+VKILE YW +E+++
Sbjct  441  KVGEAEKNLGVPGGTNPYAQLIEDAEGLDKIENFQSHDNTEIYEKSVKILETYWLEEEDD  500

Query  351  PNLPDGVDENQQGFTFGNSQPNVP  280
              +P   D  Q GF FGN+  +VP
Sbjct  501  A-MPG--DTTQTGFDFGNNDQSVP  521



>ref|XP_010546997.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=535

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI+++  QGCVKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  382  LQNAEFDIKKEAAWAISNATSGGSHDQIKYMVEQGCVKPLCDLLVCPDPRIITVCLEGLE  441

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILKVGEA+K LG +   N YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  +
Sbjct  442  NILKVGEAEKNLGHSGDTNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  501

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E+  LP G D +Q GF FG +Q  VP
Sbjct  502  DEEDETLPPG-DGSQPGFQFGGNQVPVP  528



>ref|XP_009763482.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+NEQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGTNEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVG+ +  LG    IN+YAQMID+ +G++K+ENLQ+HDN EIYEKAVKILE YW +E
Sbjct  438  NILKVGDVE-NLGEAGNINVYAQMIDDADGIEKIENLQSHDNQEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  +P G D   QGF FG    +VP
Sbjct  497  DDE-TMPPG-DATHQGFQFGGGNVSVP  521



>emb|CDY34430.1| BnaC01g22030D [Brassica napus]
Length=530

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGSADQIKYMVDQGVVKPLCDLLVCPDPRIITVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G     N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKVTGNTGDANYYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G DE+ QGF FG S    P
Sbjct  499  EDE-TLPPG-DESAQGFQFGGSDAAAP  523



>ref|XP_011079596.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+++QI+FL  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGTSDQIKFLVREGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N+YAQMID  EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNQGNTGDVNVYAQMIDSAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  L  G D  Q GF FG     VP
Sbjct  498  EDE-QLVSG-DAPQSGFNFGGGDLPVP  522



>ref|XP_009146474.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
 emb|CDY32215.1| BnaA01g17690D [Brassica napus]
Length=530

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  379  LQNAEFDIKKEAAWAVSNATSGGSADQIKYMVDQGVVKPLCDLLVCPDPRIITVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G     N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  439  NILKVGEAEKVTGNTGDANYYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G DE+ QGF FG S    P
Sbjct  499  EDE-TLPPG-DESAQGFQFGGSDAAAP  523



>ref|XP_010489893.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=544

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = -3

Query  672  SNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENILKVGEADKKLGMND  493
            SNATSGGS+EQI++L +QGC+KPLCDLLICPDPRIVTVCLEGLENILKV EADK++G+ND
Sbjct  406  SNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEADKEMGLND  465

Query  492  GINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQ  316
            G+N+YA +I+E +GLDK+ENLQ+HDNNEIYEKAVKILE+YW +++EE  L DG +EN QQ
Sbjct  466  GVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEEQILQDGGNENSQQ  525

Query  315  GFTFGNSQPNVP  280
             F FG +QP  P
Sbjct  526  TFNFGTNQPAAP  537



>ref|XP_011082432.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+N+QI+ L  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFEIKKEAAWAISNATSGGTNDQIKLLVREGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N++AQMID+ +GL+K+ENLQ+HDNNEIYEKAVK+LE YW +E
Sbjct  438  NILKVGEAEKNQGNTGDVNVFAQMIDDAQGLEKIENLQSHDNNEIYEKAVKVLETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  L  G D  Q GF FG     VP
Sbjct  498  DDE-QLVSG-DTQQSGFNFGGGDLPVP  522



>ref|XP_010558435.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=526

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 5/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE +K  G    +N Y Q+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  438  NILKVGETEKNSGR---VNYYTQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  494

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            +E+  +P G D +Q GF FG +Q ++P
Sbjct  495  EED-TVPPG-DGSQPGFEFGGNQVHIP  519



>ref|XP_011041680.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
Length=538

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  385  LQNAEFEIKKEAAWAISNATSGGSHEQIKFLVDQGCIKPLCDLLICPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEA K LG     N+Y QMI++ EGL+K+ENLQ+HDNNEIYEKAVKILE YW  D
Sbjct  445  NILKVGEAKKNLGNTGNANLYTQMIEDVEGLEKIENLQSHDNNEIYEKAVKILETYWVED  504

Query  363  EDEEPNLPDGVDENQQGFTFGNSQ  292
             D+    P G D +Q GF FG ++
Sbjct  505  GDDFEAFPPG-DASQSGFQFGGTE  527



>gb|AAM96997.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15476.1| unknown protein [Arabidopsis thaliana]
Length=314

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS +QI+++  QG VKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  162  LQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLE  221

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  222  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  281

Query  360  DEEPNLPDGVDENQQGFTFG  301
            ++E  LP G D + QGF FG
Sbjct  282  EDE-TLPPG-DPSAQGFQFG  299



>ref|XP_006355841.1| PREDICTED: importin subunit alpha-like [Solanum tuberosum]
Length=527

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 5/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAW ISNATSGG+++QI+FL SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  379  LQNAEFEIKKEAAWGISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  438

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYEKAVKILE YW   
Sbjct  439  NILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWL--  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
             EE ++   + E+Q  F FG +  ++P
Sbjct  497  -EEEDVQVSLIEDQ--FEFGGADISLP  520



>ref|XP_002519264.1| importin alpha, putative [Ricinus communis]
 gb|EEF43128.1| importin alpha, putative [Ricinus communis]
Length=453

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 127/148 (86%), Gaps = 5/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF++KKEAAWAISNATSGGS EQI++L SQGC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  302  LQNAEFEVKKEAAWAISNATSGGSREQIQYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  361

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILK+GE +K+ G N  +N+YAQ+ID+C+GLDK+ENLQ+HDN+EIYEKAVKILEKYW  +
Sbjct  362  NILKIGETEKESG-NTTVNMYAQLIDDCDGLDKIENLQSHDNHEIYEKAVKILEKYWIEE  420

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            E+E+ N+   +D +    +FG +QP++P
Sbjct  421  EEEDQNI---IDASNGDLSFGTNQPSIP  445



>ref|XP_006355403.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006355404.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Solanum 
tuberosum]
Length=529

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 4/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS+EQI+FL SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQTAEFDIKKEAAWAISNATSGGSHEQIKFLVSQNCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K     +GIN YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  440  NILKVGEAEK--ANTEGINYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D  Q  F FG +   +P
Sbjct  498  EDE-TVPAG-DGAQNEFNFGGNDIQLP  522



>ref|XP_010434881.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010440203.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010449846.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D   QGF FG +   +P
Sbjct  503  EDE-TLPPG-DAAAQGFQFGGTDAAIP  527



>ref|XP_004228994.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318783.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318786.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318791.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
Length=530

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 4/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGGS+EQI+FL SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  381  LQTAEFDIKKEAAWAISNATSGGSHEQIKFLVSQNCIKPLCDLLVCPDPRIVTVCLEGLE  440

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K     +GIN YAQ+ID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  441  NILKVGEAEK--ANTEGINYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  498

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +P G D  Q  F FG +   +P
Sbjct  499  EDE-TVPAG-DGAQNEFNFGGNDIQLP  523



>ref|XP_002320318.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
 gb|EEE98633.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
Length=538

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICPDPRIVTVCLEGLE
Sbjct  385  LQNAEFEIKKEAAWAISNATSGGSHEQIKFLVDQGCIKPLCDLLICPDPRIVTVCLEGLE  444

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWG-D  364
            NILKVGEA K LG     N+Y QMI++ EGL+K+ENLQ+HDNNEIYEKAVKILE +W  D
Sbjct  445  NILKVGEAKKNLGNTGNANLYTQMIEDVEGLEKIENLQSHDNNEIYEKAVKILETFWVED  504

Query  363  EDEEPNLPDGVDENQQGFTFGNSQ  292
             D+    P G D +Q GF FG ++
Sbjct  505  GDDFEAFPPG-DASQSGFQFGGTE  527



>ref|XP_010024770.1| PREDICTED: importin subunit alpha-1 [Eucalyptus grandis]
 gb|KCW61262.1| hypothetical protein EUGRSUZ_H04025 [Eucalyptus grandis]
Length=523

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS++QI+++ SQGC+KPLCDLL+CPDPRIVTVCLE LE
Sbjct  374  LQNAEFDIKKEAAWAISNATSGGSHDQIKYIVSQGCIKPLCDLLVCPDPRIVTVCLEALE  433

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILK+G+A+K+ G N G N+YA+MID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  434  NILKIGQAEKECG-NTGDNVYARMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEE  492

Query  360  DEEPNLPDGVDENQQGFTFG  301
            ++E  +P G D  Q GF FG
Sbjct  493  EDE-IVPPG-DNTQPGFNFG  510



>ref|NP_171769.1| importin alpha isoform 6 [Arabidopsis thaliana]
 sp|Q9FWY7.1|IMPA6_ARATH RecName: Full=Importin subunit alpha-6; Short=IMPa-6 [Arabidopsis 
thaliana]
 gb|AAG10631.1|AC022521_9 Putative importin alpha subunit [Arabidopsis thaliana]
 gb|AAL49825.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AAM20077.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AEE27458.1| importin alpha isoform 6 [Arabidopsis thaliana]
Length=538

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = -3

Query  708  EFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENILK  529
            EF+IKKEA WAISNATSGG+++QI+FL SQGC++PLCDLL CPDPR+VTV LEGLENILK
Sbjct  386  EFEIKKEAVWAISNATSGGNHDQIKFLVSQGCIRPLCDLLPCPDPRVVTVTLEGLENILK  445

Query  528  VGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEEP  349
            VGEA+K LG     N+YAQMI++ +GLDK+ENLQ+HDNNEIYEKAVKILE YW  +DEE 
Sbjct  446  VGEAEKNLGNTGNDNLYAQMIEDADGLDKIENLQSHDNNEIYEKAVKILESYWAADDEEE  505

Query  348  NLPDGVD--ENQQ--GFTFGNSQPNVP  280
            ++  GVD  EN Q  GF FGN   N P
Sbjct  506  DI-GGVDAPENVQSSGFQFGNQSGNAP  531



>ref|NP_973743.1| importin alpha isoform 6 [Arabidopsis thaliana]
 gb|AEE27459.1| importin alpha isoform 6 [Arabidopsis thaliana]
Length=539

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = -3

Query  708  EFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENILK  529
            EF+IKKEA WAISNATSGG+++QI+FL SQGC++PLCDLL CPDPR+VTV LEGLENILK
Sbjct  387  EFEIKKEAVWAISNATSGGNHDQIKFLVSQGCIRPLCDLLPCPDPRVVTVTLEGLENILK  446

Query  528  VGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEEP  349
            VGEA+K LG     N+YAQMI++ +GLDK+ENLQ+HDNNEIYEKAVKILE YW  +DEE 
Sbjct  447  VGEAEKNLGNTGNDNLYAQMIEDADGLDKIENLQSHDNNEIYEKAVKILESYWAADDEEE  506

Query  348  NLPDGVD--ENQQ--GFTFGNSQPNVP  280
            ++  GVD  EN Q  GF FGN   N P
Sbjct  507  DI-GGVDAPENVQSSGFQFGNQSGNAP  532



>ref|XP_001773628.1| predicted protein [Physcomitrella patens]
 gb|EDQ61516.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGG+ EQI+FL +QGC+KPLCDLL CPDPRIVTV LEGLENIL
Sbjct  382  AEFDIKKEAAWAISNATSGGTPEQIKFLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENIL  441

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVGE  K  G N  +N+YA+ IDE EGL+K+ENLQTHDNNEIYEKAVKILE YW +EDE+
Sbjct  442  KVGEQVKDSGSNGDVNLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDED  501

Query  351  PNLPDGVDENQQGFTFGNSQPN  286
             N    V E  Q F FG+S P+
Sbjct  502  QNTAP-VTEG-QNFAFGSSNPS  521



>gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens]
Length=529

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEF+IKKEAAWAISNATSGG+++QI+FL  +GC+KPLCDLL+ PDPRIVTVCLEGLE
Sbjct  378  LQSAEFEIKKEAAWAISNATSGGTSDQIKFLVREGCIKPLCDLLVSPDPRIVTVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K LG    +N++AQMID+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKNLGNTGDVNVFAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  +    D  Q GF FG  +  VP
Sbjct  498  EDEQLVSS--DGPQAGFNFGGGELPVP  522



>gb|KJB28705.1| hypothetical protein B456_005G065400 [Gossypium raimondii]
Length=528

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGG++EQI++L S+GC+KPLCDLL CPDPRI+TVCLEGLE
Sbjct  378  LQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSEGCIKPLCDLLACPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G  +  N  AQ+I++ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  438  NILKVGEAEKAAGAGE-FNYCAQLIEDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  496

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            DEE  LP G D  QQ F FG +   VP
Sbjct  497  DEE-TLPPG-DGTQQNFHFGGNDVKVP  521



>ref|XP_009107883.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
Length=534

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  503  EDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>emb|CDY22779.1| BnaA08g06090D [Brassica napus]
Length=534

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  503  EDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>emb|CDY52043.1| BnaC08g48070D [Brassica napus]
Length=534

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  503  EDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlisea aurea]
Length=535

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEF+IKKEAAWAISNATSGG+ +QI+FL  +GC+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  384  LQNAEFEIKKEAAWAISNATSGGTPDQIKFLVGEGCIKPLCDLLVCPDPRIVTVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGE++K  G    +N++AQMIDE EGL+K+E+LQ HDNNEIYEK VKILE YW +E
Sbjct  444  NILKVGESEKNQGNTGDVNVFAQMIDEAEGLEKIESLQNHDNNEIYEKVVKILETYWLEE  503

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            D+E  L  G D  Q GF FG     VP
Sbjct  504  DDE-QLASG-DAQQSGFNFGGGDNAVP  528



>gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum]
Length=529

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
               AEFDIKKEAAWAISNATSGG++EQI+FL SQ C+KPLCDLL+CPDPRIVTVCLEGLE
Sbjct  380  LQSAEFDIKKEAAWAISNATSGGTHEQIKFLVSQNCIKPLCDLLVCPDPRIVTVCLEGLE  439

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYEKAVKILE YW +E
Sbjct  440  NILKVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEE  497

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D  Q  F FG +   +P
Sbjct  498  EDE-TLPAG-DGTQNEFNFGGNDIQLP  522



>emb|CDY09716.1| BnaC07g33450D [Brassica napus]
Length=535

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  384  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLE  443

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  444  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  503

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  504  EDE-TLPHG-DGSAQGFQFGGNDAAAP  528



>gb|KDP27954.1| hypothetical protein JCGZ_19034 [Jatropha curcas]
Length=527

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 121/148 (82%), Gaps = 5/148 (3%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              HAEF++KKEAAWAISNATSGG+ EQI+ L S+GC+KPLCDLL CPDPRI+TVCLEGLE
Sbjct  378  LQHAEFEVKKEAAWAISNATSGGTQEQIQHLVSRGCIKPLCDLLACPDPRIITVCLEGLE  437

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYW-GD  364
            NILK+GE DK+ G N  +N+Y  MI++C+GLDK+ENLQ HDN EIYEK VKILE+YW  +
Sbjct  438  NILKIGETDKESG-NTQVNVYRHMIEDCDGLDKIENLQNHDNQEIYEKVVKILERYWIEE  496

Query  363  EDEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ED + ++ DG+D +    +FG +QP++P
Sbjct  497  EDPDQDIADGIDGS---LSFGTNQPSLP  521



>gb|AFW79686.1| importin alpha-1b subunit, mRNA [Zea mays]
Length=328

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  711  AEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLENIL  532
            AEFDIKKEAAWAISNATSGGS+EQI++L S+GC+KPLCDLL+CPDPRIVTVCLEGLENIL
Sbjct  179  AEFDIKKEAAWAISNATSGGSHEQIKYLVSEGCIKPLCDLLVCPDPRIVTVCLEGLENIL  238

Query  531  KVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEE  352
            KVG+ DK +G     N+ AQMIDE EGL+K+ENLQ+HDNNEIYEKAVK+LE YW +E+++
Sbjct  239  KVGQHDKTMGATGDTNVLAQMIDEAEGLEKIENLQSHDNNEIYEKAVKLLETYWMEEEDD  298



>ref|XP_006414387.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
 gb|ESQ55840.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
Length=534

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  503  EDEA-LPPG-DGSAQGFQFGGNDAAAP  527



>ref|XP_009136744.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
 emb|CDX90544.1| BnaA03g42370D [Brassica napus]
Length=540

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICPDPRI+TVCLEGLE
Sbjct  389  LQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLE  448

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  449  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  508

Query  360  DEEPNLPDGVDENQQGFTFGNSQPNVP  280
            ++E  LP G D + QGF FG +    P
Sbjct  509  EDE-TLPHG-DGSAQGFQFGGNDAAAP  533



>gb|AAK32824.1|AF361811_1 AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAL31160.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=535

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = -3

Query  720  FNHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPDPRIVTVCLEGLE  541
              +AEFDIKKEAAWAISNATSGGS +QI+++  QG VKPLCDLL+CPDPRI+TVCLEGLE
Sbjct  383  LQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLE  442

Query  540  NILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEKAVKILEKYWGDE  361
            NILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYEKAVKILE YW +E
Sbjct  443  NILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEE  502

Query  360  DEEPNLPDGVDENQQGFTFG  301
            ++E  LP G D + QGF FG
Sbjct  503  EDE-TLPPG-DPSAQGFQFG  520



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440