BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032G08

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97272.1|  unnamed protein product                                345   2e-115   Coffea canephora [robusta coffee]
ref|XP_011092506.1|  PREDICTED: mitotic checkpoint protein BUB3.1       343   1e-114   
ref|XP_009590366.1|  PREDICTED: mitotic checkpoint protein BUB3.1       342   3e-114   Nicotiana tomentosiformis
ref|XP_009777463.1|  PREDICTED: mitotic checkpoint protein BUB3.1       342   3e-114   Nicotiana sylvestris
gb|EYU39062.1|  hypothetical protein MIMGU_mgv1a009456mg                340   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_004230702.1|  PREDICTED: mitotic checkpoint protein BUB3.1       340   3e-113   Solanum lycopersicum
ref|XP_007201242.1|  hypothetical protein PRUPE_ppa008206mg             339   4e-113   Prunus persica
gb|KJB32263.1|  hypothetical protein B456_005G232100                    337   5e-113   Gossypium raimondii
ref|XP_002527504.1|  mitotic checkpoint protein bub3, putative          339   5e-113   Ricinus communis
ref|XP_008382226.1|  PREDICTED: mitotic checkpoint protein BUB3.2       339   6e-113   
ref|XP_006422834.1|  hypothetical protein CICLE_v10028761mg             339   7e-113   Citrus clementina [clementine]
ref|XP_009347116.1|  PREDICTED: mitotic checkpoint protein BUB3.2       338   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_008454389.1|  PREDICTED: mitotic checkpoint protein BUB3.2       338   1e-112   Cucumis melo [Oriental melon]
ref|XP_006346313.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    338   1e-112   Solanum tuberosum [potatoes]
ref|XP_008364436.1|  PREDICTED: mitotic checkpoint protein BUB3.2       338   1e-112   Malus domestica [apple tree]
ref|XP_002264472.1|  PREDICTED: mitotic checkpoint protein BUB3.2       338   2e-112   Vitis vinifera
ref|XP_007042628.1|  Transducin/WD40 repeat-like superfamily protein    338   2e-112   Theobroma cacao [chocolate]
ref|XP_004156860.1|  PREDICTED: mitotic checkpoint protein BUB3-like    337   2e-112   
ref|XP_009335381.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    337   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_004289802.1|  PREDICTED: mitotic checkpoint protein BUB3.2       337   3e-112   Fragaria vesca subsp. vesca
gb|ABK21756.1|  unknown                                                 336   6e-112   Picea sitchensis
gb|KCW55112.1|  hypothetical protein EUGRSUZ_I01072                     337   6e-112   Eucalyptus grandis [rose gum]
gb|KJB79447.1|  hypothetical protein B456_013G050200                    334   8e-112   Gossypium raimondii
ref|XP_008787173.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    335   2e-111   Phoenix dactylifera
ref|XP_010277064.1|  PREDICTED: mitotic checkpoint protein BUB3.2       335   2e-111   Nelumbo nucifera [Indian lotus]
gb|KJB32261.1|  hypothetical protein B456_005G232100                    335   3e-111   Gossypium raimondii
gb|KJB32260.1|  hypothetical protein B456_005G232100                    334   4e-111   Gossypium raimondii
ref|XP_010099611.1|  Mitotic checkpoint protein                         334   5e-111   Morus notabilis
ref|XP_010030628.1|  PREDICTED: mitotic checkpoint protein BUB3.2       337   5e-111   Eucalyptus grandis [rose gum]
ref|XP_010541847.1|  PREDICTED: mitotic checkpoint protein BUB3.2       333   8e-111   Tarenaya hassleriana [spider flower]
gb|KJB79445.1|  hypothetical protein B456_013G050200                    333   9e-111   Gossypium raimondii
ref|XP_006422835.1|  hypothetical protein CICLE_v10028761mg             333   1e-110   
ref|XP_010243393.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    331   1e-110   
ref|XP_011001892.1|  PREDICTED: mitotic checkpoint protein BUB3.1       333   2e-110   Populus euphratica
gb|KDP44484.1|  hypothetical protein JCGZ_16317                         333   2e-110   Jatropha curcas
gb|KJB79448.1|  hypothetical protein B456_013G050200                    332   2e-110   Gossypium raimondii
ref|XP_004152275.1|  PREDICTED: mitotic checkpoint protein BUB3-like    332   2e-110   
gb|KHG11458.1|  Bub3                                                    332   2e-110   Gossypium arboreum [tree cotton]
ref|XP_010243391.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    332   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_002300265.2|  WD-40 repeat family protein                        331   7e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010687353.1|  PREDICTED: mitotic checkpoint protein BUB3.1       331   8e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009107249.1|  PREDICTED: mitotic checkpoint protein BUB3.2       331   9e-110   Brassica rapa
emb|CDY59371.1|  BnaA08g29630D                                          331   1e-109   Brassica napus [oilseed rape]
ref|XP_002891542.1|  hypothetical protein ARALYDRAFT_474121             330   1e-109   
ref|XP_006393203.1|  hypothetical protein EUTSA_v10011632mg             330   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_002313908.2|  WD-40 repeat family protein                        330   1e-109   Populus trichocarpa [western balsam poplar]
ref|XP_002970095.1|  hypothetical protein SELMODRAFT_146851             330   1e-109   Selaginella moellendorffii
ref|XP_010479422.1|  PREDICTED: mitotic checkpoint protein BUB3.2       330   1e-109   Camelina sativa [gold-of-pleasure]
ref|NP_175413.1|  cell cycle arrest protein BUB3                        330   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088067.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    330   2e-109   Sesamum indicum [beniseed]
gb|KFK35968.1|  hypothetical protein AALP_AA4G061300                    330   3e-109   Arabis alpina [alpine rockcress]
ref|XP_006298078.1|  hypothetical protein CARUB_v10014121mg             330   3e-109   Capsella rubella
emb|CDY03579.1|  BnaC03g68380D                                          329   4e-109   
ref|XP_006305280.1|  hypothetical protein CARUB_v10009656mg             328   9e-109   
ref|XP_010942824.1|  PREDICTED: mitotic checkpoint protein BUB3.1       328   1e-108   Elaeis guineensis
ref|XP_003536585.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    328   1e-108   Glycine max [soybeans]
ref|XP_003610622.1|  Mitotic checkpoint protein BUB3                    328   1e-108   Medicago truncatula
ref|XP_010461841.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    328   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010556011.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    328   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_009111676.1|  PREDICTED: mitotic checkpoint protein BUB3.1       327   3e-108   Brassica rapa
emb|CDX95434.1|  BnaC01g33260D                                          327   3e-108   
ref|NP_566644.1|  cell cycle arrest protein BUB3                        327   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883194.1|  hypothetical protein ARALYDRAFT_898343             327   4e-108   Arabidopsis lyrata subsp. lyrata
ref|XP_009396041.1|  PREDICTED: mitotic checkpoint protein BUB3.2       327   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849345.1|  hypothetical protein AMTR_s00164p00065390          327   5e-108   Amborella trichopoda
gb|KHN42322.1|  Mitotic checkpoint protein BUB3                         326   5e-108   Glycine soja [wild soybean]
ref|XP_010500544.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    326   8e-108   Camelina sativa [gold-of-pleasure]
ref|XP_007143105.1|  hypothetical protein PHAVU_007G044000g             326   9e-108   Phaseolus vulgaris [French bean]
ref|XP_003555986.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    324   3e-107   Glycine max [soybeans]
ref|XP_010487904.1|  PREDICTED: mitotic checkpoint protein BUB3.1       323   6e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010507823.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    322   3e-106   Camelina sativa [gold-of-pleasure]
ref|XP_001764716.1|  predicted protein                                  322   3e-106   
ref|XP_010466109.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    322   4e-106   Camelina sativa [gold-of-pleasure]
gb|EPS71625.1|  hypothetical protein M569_03130                         321   4e-106   Genlisea aurea
gb|KHN06798.1|  Mitotic checkpoint protein BUB3                         322   4e-106   Glycine soja [wild soybean]
ref|XP_004511310.1|  PREDICTED: mitotic checkpoint protein BUB3-like    321   5e-106   Cicer arietinum [garbanzo]
ref|NP_001239974.1|  uncharacterized protein LOC100820541               320   2e-105   Glycine max [soybeans]
gb|EYU37574.1|  hypothetical protein MIMGU_mgv1a009424mg                319   4e-105   Erythranthe guttata [common monkey flower]
ref|XP_007143112.1|  hypothetical protein PHAVU_007G044700g             318   8e-105   Phaseolus vulgaris [French bean]
ref|XP_006406483.1|  hypothetical protein EUTSA_v10021448mg             313   1e-104   
emb|CAN82065.1|  hypothetical protein VITISV_008011                     318   4e-104   Vitis vinifera
ref|XP_006651529.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    316   4e-104   
ref|NP_001050471.1|  Os03g0448600                                       316   5e-104   
gb|EEC75559.1|  hypothetical protein OsI_12223                          316   6e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001149777.1|  LOC100283404                                       316   7e-104   Zea mays [maize]
gb|ACG48694.1|  mitotic checkpoint protein BUB3                         315   1e-103   Zea mays [maize]
ref|XP_002436452.1|  hypothetical protein SORBIDRAFT_10g002920          315   1e-103   Sorghum bicolor [broomcorn]
ref|XP_003562373.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    315   2e-103   Brachypodium distachyon [annual false brome]
gb|ACF78394.1|  unknown                                                 313   7e-103   Zea mays [maize]
gb|KJB79446.1|  hypothetical protein B456_013G050200                    309   1e-101   Gossypium raimondii
gb|AFK38016.1|  unknown                                                 295   3e-98    Lotus japonicus
gb|EEE67502.1|  hypothetical protein OsJ_24938                          275   5e-88    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175281.1|  Os07g0588500                                       275   1e-87    
ref|XP_003560020.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    273   7e-87    
ref|XP_004989752.1|  mitotic checkpoint protein BUB3                    255   2e-80    Salpingoeca rosetta
gb|KHN42317.1|  Mitotic checkpoint protein BUB3                         249   2e-78    Glycine soja [wild soybean]
ref|XP_005842151.1|  hypothetical protein GUITHDRAFT_62815              247   4e-77    Guillardia theta CCMP2712
gb|ESA02941.1|  hypothetical protein GLOINDRAFT_67599                   247   5e-77    
ref|XP_005648737.1|  WD40 repeat-like protein                           244   7e-76    Coccomyxa subellipsoidea C-169
ref|XP_003291452.1|  WD40 repeat-containing protein                     239   7e-74    Dictyostelium purpureum
gb|KFH73401.1|  cell cycle arrest protein BUB3                          238   2e-73    Mortierella verticillata NRRL 6337
ref|XP_011401461.1|  Mitotic checkpoint protein BUB3                    236   9e-73    Auxenochlorella protothecoides
ref|XP_001635419.1|  predicted protein                                  234   5e-72    Nematostella vectensis
ref|XP_009067387.1|  hypothetical protein LOTGIDRAFT_223691             233   1e-71    Lottia gigantea
dbj|GAM25293.1|  hypothetical protein SAMD00019534_084680               232   2e-71    Acytostelium subglobosum LB1
gb|EFA83564.1|  WD40 repeat-containing protein                          231   3e-71    Heterostelium album PN500
ref|XP_629851.1|  WD40 repeat-containing protein                        231   9e-71    Dictyostelium discoideum AX4
ref|XP_780636.1|  PREDICTED: mitotic checkpoint protein BUB3-like...    231   9e-71    Strongylocentrotus purpuratus [purple urchin]
ref|XP_004561256.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    230   2e-70    Maylandia zebra
ref|XP_005736525.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    229   2e-70    Pundamilia nyererei
ref|XP_005736526.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    229   3e-70    Pundamilia nyererei
ref|XP_003441831.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    229   3e-70    Oreochromis niloticus
ref|XP_007570331.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    227   3e-69    Poecilia formosa
ref|XP_007570323.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    227   3e-69    Poecilia formosa
ref|XP_005794721.1|  PREDICTED: mitotic checkpoint protein BUB3-like    226   3e-69    
ref|XP_011486560.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    226   5e-69    Oryzias latipes [Japanese rice fish]
ref|XP_004080489.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    226   6e-69    Oryzias latipes [Japanese rice fish]
ref|XP_003961201.1|  PREDICTED: mitotic checkpoint protein BUB3-like    226   6e-69    
ref|XP_008312803.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    226   7e-69    
ref|XP_010738643.1|  PREDICTED: mitotic checkpoint protein BUB3         226   7e-69    Larimichthys crocea [croceine croaker]
ref|XP_008312802.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    225   9e-69    Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_991272.1|  mitotic checkpoint protein BUB3                       225   9e-69    Danio rerio [leopard danio]
gb|KGB40918.1|  Mitotic checkpoint protein BUB3                         223   1e-68    Schistosoma haematobium
ref|XP_008312801.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    225   1e-68    
ref|XP_008288658.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    225   1e-68    Stegastes partitus
ref|XP_005169562.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    225   1e-68    Danio rerio [leopard danio]
ref|XP_008288659.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    225   1e-68    Stegastes partitus
emb|CDS14344.1|  hypothetical protein LRAMOSA06514                      224   2e-68    Lichtheimia ramosa
gb|ACO09248.1|  Mitotic checkpoint protein BUB3                         224   3e-68    Osmerus mordax
ref|XP_010779383.1|  PREDICTED: mitotic checkpoint protein BUB3         224   3e-68    Notothenia coriiceps [yellowbelly rockcod]
emb|CAX73050.1|  budding uninhibited by benzimidazoles 3 homolog        220   4e-68    Schistosoma japonicum
ref|XP_002608311.1|  hypothetical protein BRAFLDRAFT_125481             224   4e-68    Branchiostoma floridae
gb|AAH83205.1|  Bub3 protein                                            224   4e-68    Danio rerio [leopard danio]
gb|ADD24391.1|  Mitotic checkpoint protein BUB3                         224   5e-68    Lepeophtheirus salmonis
ref|XP_009167510.1|  hypothetical protein T265_04491                    224   5e-68    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006507334.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   5e-68    Mus musculus [mouse]
emb|CBN81549.1|  Mitotic checkpoint protein BUB3                        223   6e-68    Dicentrarchus labrax [European sea bass]
dbj|GAA55215.1|  cell cycle arrest protein BUB3                         224   7e-68    Clonorchis sinensis [oriental liver fluke]
ref|XP_005851317.1|  hypothetical protein CHLNCDRAFT_33942              224   8e-68    Chlorella variabilis
ref|XP_002957572.1|  hypothetical protein VOLCADRAFT_102432             223   9e-68    Volvox carteri f. nagariensis
emb|CDH56797.1|  mitotic checkpoint protein bub3                        223   1e-67    Lichtheimia corymbifera JMRC:FSU:9682
gb|EMP42210.1|  Mitotic checkpoint protein BUB3                         220   1e-67    Chelonia mydas [green seaturtle]
emb|CDH56796.1|  mitotic checkpoint protein bub3                        223   1e-67    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005637878.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-67    
gb|ELU09330.1|  hypothetical protein CAPTEDRAFT_21337                   222   2e-67    Capitella teleta
gb|EPY78224.1|  budding uninhibited by benzimidazoles 3-like protein    220   2e-67    Camelus ferus
ref|XP_004617862.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-67    Sorex araneus [Eurasian shrew]
ref|XP_852616.1|  PREDICTED: mitotic checkpoint protein BUB3 isof...    219   2e-67    
ref|XP_006630480.1|  PREDICTED: mitotic checkpoint protein BUB3-like    222   2e-67    Lepisosteus oculatus
emb|CBN75238.1|  WD-40 repeat family protein / mitotic checkpoint...    221   2e-67    Ectocarpus siliculosus
ref|XP_006755006.1|  PREDICTED: mitotic checkpoint protein BUB3         219   2e-67    Myotis davidii
ref|XP_011433685.1|  PREDICTED: mitotic checkpoint protein BUB3-like    222   2e-67    Crassostrea gigas
emb|CCD81559.1|  putative mitotic checkpoint protein bub3               223   2e-67    Schistosoma mansoni
ref|XP_004617861.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   3e-67    Sorex araneus [Eurasian shrew]
ref|XP_009872370.1|  PREDICTED: mitotic checkpoint protein BUB3         217   3e-67    Apaloderma vittatum
gb|KFP78208.1|  Mitotic checkpoint protein BUB3                         217   3e-67    Apaloderma vittatum
ref|XP_010867226.1|  PREDICTED: mitotic checkpoint protein BUB3         221   4e-67    Esox lucius
gb|EWC47909.1|  hypothetical protein DRE_02791                          221   6e-67    Drechslerella stenobrocha 248
ref|XP_004680435.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   6e-67    Condylura cristata
ref|XP_002409045.1|  mRNA export protein, putative                      221   6e-67    Ixodes scapularis [blacklegged tick]
ref|XP_006008249.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    221   7e-67    
ref|XP_006008248.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    222   7e-67    Latimeria chalumnae
gb|ACO12446.1|  Mitotic checkpoint protein BUB3                         221   7e-67    Lepeophtheirus salmonis
ref|XP_005154550.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   7e-67    Melopsittacus undulatus
ref|XP_007053122.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    220   9e-67    
ref|XP_004350568.1|  WD40 repeat-containing protein                     221   1e-66    Cavenderia fasciculata
ref|XP_006080476.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Bubalus bubalis [domestic water buffalo]
gb|EPQ16815.1|  Mitotic checkpoint protein BUB3                         219   1e-66    Myotis brandtii
ref|XP_007260981.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    
ref|XP_010633595.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Fukomys damarensis [Damara mole rat]
gb|EAW49287.1|  BUB3 budding uninhibited by benzimidazoles 3 homo...    220   1e-66    Homo sapiens [man]
ref|XP_007260980.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Astyanax mexicanus [blind cave fish]
ref|XP_002756721.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Callithrix jacchus [common marmoset]
ref|XP_004374979.1|  PREDICTED: mitotic checkpoint protein BUB3         220   1e-66    Trichechus manatus latirostris
ref|XP_003755337.1|  PREDICTED: mitotic checkpoint protein BUB3         220   1e-66    Sarcophilus harrisii
ref|XP_010597524.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    220   1e-66    Loxodonta africana [African bush elephant]
ref|XP_005602229.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Equus caballus [domestic horse]
ref|XP_004625654.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Octodon degus
ref|NP_033904.2|  mitotic checkpoint protein BUB3                       220   1e-66    Mus musculus [mouse]
ref|XP_004438950.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   1e-66    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ELK36834.1|  Mitotic checkpoint protein BUB3                         218   1e-66    Myotis davidii
ref|XP_004474644.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Dasypus novemcinctus
ref|XP_005351448.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Microtus ochrogaster [prairie voles]
gb|AAX43869.1|  BUB3 budding uninhibited by benzimidazoles 3-like       219   2e-66    synthetic construct
ref|XP_006188783.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    
ref|XP_002109375.1|  hypothetical protein TRIADDRAFT_53336              219   2e-66    Trichoplax adhaerens
gb|EHH65091.1|  hypothetical protein EGM_18435                          219   2e-66    Macaca fascicularis [crab eating macaque]
ref|XP_010633604.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Fukomys damarensis [Damara mole rat]
ref|NP_004716.1|  mitotic checkpoint protein BUB3 isoform a             219   2e-66    Homo sapiens [man]
ref|XP_004625653.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Octodon degus
ref|XP_003734599.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Callithrix jacchus [common marmoset]
ref|XP_004438949.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005351447.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    
ref|XP_005880912.1|  PREDICTED: mitotic checkpoint protein BUB3         219   2e-66    
ref|XP_006879938.1|  PREDICTED: mitotic checkpoint protein BUB3         219   2e-66    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004020302.1|  PREDICTED: mitotic checkpoint protein BUB3         219   2e-66    
ref|XP_007519725.1|  PREDICTED: mitotic checkpoint protein BUB3         219   2e-66    Erinaceus europaeus [common hedgehog]
gb|KFO37637.1|  Mitotic checkpoint protein BUB3                         220   2e-66    Fukomys damarensis [Damara mole rat]
ref|XP_006267668.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   2e-66    
ref|XP_004356556.1|  WD domain, Gbeta repeat-containing protein         219   2e-66    Acanthamoeba castellanii str. Neff
ref|XP_010633579.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    220   3e-66    Fukomys damarensis [Damara mole rat]
ref|XP_008825474.1|  PREDICTED: mitotic checkpoint protein BUB3         219   3e-66    Nannospalax galili
ref|XP_006267669.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   3e-66    
ref|XP_005305938.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   3e-66    Chrysemys picta bellii
ref|XP_008154368.1|  PREDICTED: mitotic checkpoint protein BUB3         219   3e-66    
ref|XP_011111935.1|  hypothetical protein H072_6136                     219   3e-66    
ref|XP_005305939.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   3e-66    Chrysemys picta bellii
ref|XP_005305937.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   3e-66    
ref|XP_004579810.1|  PREDICTED: mitotic checkpoint protein BUB3         219   4e-66    Ochotona princeps [southern American pika]
ref|XP_001512314.2|  PREDICTED: mitotic checkpoint protein BUB3         219   4e-66    
ref|XP_002738187.1|  PREDICTED: mitotic checkpoint protein BUB3-like    218   4e-66    Saccoglossus kowalevskii
ref|XP_004659326.1|  PREDICTED: mitotic checkpoint protein BUB3         219   4e-66    Jaculus jaculus
ref|XP_004680433.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   4e-66    Condylura cristata
gb|KFU86042.1|  Mitotic checkpoint protein BUB3                         216   5e-66    Chaetura pelagica
ref|XP_010007114.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    216   5e-66    Chaetura pelagica
ref|XP_006136163.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    218   5e-66    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_002722642.2|  PREDICTED: mitotic checkpoint protein BUB3         218   5e-66    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006136164.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    218   6e-66    Pelodiscus sinensis [Chinese softshell turtle]
gb|KFM75540.1|  Mitotic checkpoint protein BUB3                         218   7e-66    Stegodyphus mimosarum
ref|XP_006675919.1|  hypothetical protein BATDEDRAFT_84472              218   7e-66    Batrachochytrium dendrobatidis JAM81
ref|XP_006025193.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   8e-66    
ref|XP_006025194.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    219   9e-66    
ref|NP_001007498.1|  BUB3 mitotic checkpoint protein                    217   1e-65    
ref|NP_001083768.1|  mitotic checkpoint protein BUB3                    217   1e-65    Xenopus laevis [clawed frog]
gb|AAK12629.1|AF119790_1  WD repeat protein Bub3                        217   1e-65    Xenopus laevis [clawed frog]
gb|AAD38038.1|AF149822_1  mitotic checkpoint protein BUB3               217   2e-65    Mus musculus [mouse]
ref|XP_001698657.1|  WD40 repeat protein                                218   2e-65    Chlamydomonas reinhardtii
ref|XP_005048890.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Ficedula albicollis
ref|XP_002192609.2|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    
ref|XP_005505842.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Columba livia [carrier pigeon]
ref|XP_008926745.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    
ref|XP_005494903.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Zonotrichia albicollis
ref|XP_007420850.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Python bivittatus
ref|XP_007420849.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Python bivittatus
ref|XP_005232503.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Falco peregrinus [peregrine]
ref|XP_001367606.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Monodelphis domestica
ref|NP_001006506.1|  mitotic checkpoint protein BUB3                    217   2e-65    Gallus gallus [bantam]
ref|XP_009668841.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Struthio camelus australis
emb|CAJ81358.1|  BUB3 budding uninhibited by benzimidazoles 3 hom...    217   2e-65    Xenopus tropicalis [western clawed frog]
gb|EMC88322.1|  Mitotic checkpoint protein BUB3                         217   2e-65    
ref|XP_008489974.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Calypte anna
gb|KFM06687.1|  Mitotic checkpoint protein BUB3                         217   2e-65    Aptenodytes forsteri
gb|KFV79058.1|  Mitotic checkpoint protein BUB3                         217   2e-65    Struthio camelus australis
gb|KFW84791.1|  Mitotic checkpoint protein BUB3                         217   2e-65    Manacus vitellinus
ref|XP_008947573.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Merops nubicus
ref|XP_005154549.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    216   2e-65    Melopsittacus undulatus
ref|XP_010713168.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Meleagris gallopavo [common turkey]
ref|XP_005023232.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Anas platyrhynchos [duck]
ref|XP_009668840.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    217   2e-65    Struthio camelus australis
ref|XP_006867487.1|  PREDICTED: mitotic checkpoint protein BUB3         217   2e-65    Chrysochloris asiatica
gb|AAB39606.1|  WD40-repeat type I transmembrane protein A72.5          214   2e-65    Mus musculus [mouse]
gb|KFQ16715.1|  Mitotic checkpoint protein BUB3                         216   2e-65    Merops nubicus
ref|XP_005023233.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    216   2e-65    Anas platyrhynchos [duck]
gb|KFO94368.1|  Mitotic checkpoint protein BUB3                         216   3e-65    Buceros rhinoceros silvestris
ref|XP_010209860.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    216   3e-65    Tinamus guttatus
ref|XP_003218630.1|  PREDICTED: mitotic checkpoint protein BUB3         216   3e-65    Anolis carolinensis [Carolina anole]
ref|XP_010141872.1|  PREDICTED: mitotic checkpoint protein BUB3         216   3e-65    Buceros rhinoceros silvestris
ref|XP_010209861.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    216   3e-65    Tinamus guttatus
ref|XP_004622520.1|  PREDICTED: mitotic checkpoint protein BUB3-like    212   3e-65    
gb|KFQ35683.1|  Mitotic checkpoint protein BUB3                         216   3e-65    Mesitornis unicolor
gb|KGL75167.1|  Mitotic checkpoint protein BUB3                         216   4e-65    Tinamus guttatus
ref|XP_010182810.1|  PREDICTED: mitotic checkpoint protein BUB3         216   4e-65    Mesitornis unicolor
ref|XP_005089574.1|  PREDICTED: mitotic checkpoint protein BUB3-like    216   4e-65    Aplysia californica
gb|ETE69240.1|  Mitotic checkpoint protein BUB3                         216   5e-65    Ophiophagus hannah
ref|XP_002431216.1|  mitotic checkpoint protein BUB3, putative          216   5e-65    Pediculus humanus corporis [human body lice]
ref|XP_004700939.1|  PREDICTED: mitotic checkpoint protein BUB3         216   6e-65    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011124258.1|  hypothetical protein AOL_s00097g123                216   7e-65    Arthrobotrys oligospora ATCC 24927
ref|NP_001125579.1|  mitotic checkpoint protein BUB3                    215   7e-65    Pongo abelii [orang utan]
ref|XP_007902124.1|  PREDICTED: mitotic checkpoint protein BUB3         215   8e-65    Callorhinchus milii [Australian ghost shark]
gb|KFV05300.1|  Mitotic checkpoint protein BUB3                         215   8e-65    Pterocles gutturalis
ref|XP_010085772.1|  PREDICTED: mitotic checkpoint protein BUB3         215   8e-65    Pterocles gutturalis
ref|XP_002837803.1|  hypothetical protein                               215   1e-64    Tuber melanosporum Mel28
ref|XP_004751814.1|  PREDICTED: mitotic checkpoint protein BUB3         215   1e-64    
ref|XP_004349076.1|  testis mitotic checkpoint BUB3                     215   1e-64    Capsaspora owczarzaki ATCC 30864
ref|XP_003746497.1|  PREDICTED: mitotic checkpoint protein BUB3-like    214   2e-64    Galendromus occidentalis
gb|ENN76425.1|  hypothetical protein YQE_07086                          213   3e-64    Dendroctonus ponderosae
gb|ACD13595.1|  mitotic checkpoint protein                              214   4e-64    Penaeus monodon [giant tiger prawn]
ref|XP_005853641.1|  cell cycle arrest protein BUB3                     213   6e-64    Nannochloropsis gaditana CCMP526
gb|EWM25818.1|  mitotic checkpoint protein bub3                         213   7e-64    Nannochloropsis gaditana
gb|AEE62023.1|  unknown                                                 212   2e-63    
ref|XP_970295.1|  PREDICTED: mitotic checkpoint protein BUB3            212   2e-63    
ref|XP_002902392.1|  mitotic checkpoint protein, putative               209   2e-63    
gb|ELK11851.1|  Mitotic checkpoint protein BUB3                         219   2e-63    
gb|ELW69702.1|  Mitotic checkpoint protein BUB3                         218   4e-63    
ref|XP_001745113.1|  hypothetical protein                               210   1e-62    
gb|KDR15933.1|  Mitotic checkpoint protein BUB3                         210   1e-62    
ref|XP_008892507.1|  hypothetical protein PPTG_02927                    209   2e-62    
gb|EFX90203.1|  hypothetical protein DAPPUDRAFT_310020                  209   2e-62    
gb|ETO77978.1|  hypothetical protein F444_06912                         209   2e-62    
gb|ETI49245.1|  hypothetical protein F443_06845                         208   4e-62    
gb|EIE82642.1|  hypothetical protein RO3G_07347                         206   9e-62    
emb|CEG73545.1|  hypothetical protein RMATCC62417_08906                 205   1e-61    
gb|EPZ32913.1|  hypothetical protein O9G_002831                         206   1e-61    
ref|XP_009032838.1|  hypothetical protein AURANDRAFT_4153               207   1e-61    
emb|CEJ04811.1|  hypothetical protein RMCBS344292_18763                 205   1e-61    
emb|CEG76502.1|  hypothetical protein RMATCC62417_11393                 205   1e-61    
emb|CCA17613.1|  mitotic checkpoint protein putative                    207   2e-61    
ref|XP_003384302.1|  PREDICTED: mitotic checkpoint protein BUB3-like    206   4e-61    
ref|XP_008344612.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    201   4e-61    
gb|EHJ78871.1|  putative BUB3 budding uninhibited by benzimidazol...    206   4e-61    
ref|XP_002502906.1|  predicted protein                                  206   5e-61    
ref|XP_005780788.1|  hypothetical protein EMIHUDRAFT_64104              206   5e-61    
ref|XP_005776026.1|  hypothetical protein EMIHUDRAFT_74365              206   6e-61    
emb|CDS26766.1|  15 kDa selenoprotein                                   206   7e-61    
emb|CEG76501.1|  hypothetical protein RMATCC62417_11393                 205   8e-61    
ref|XP_003061020.1|  predicted protein                                  205   1e-60    
emb|CDS20345.1|  mitotic checkpoint protein bub3                        205   1e-60    
emb|CDI98695.1|  mitotic checkpoint protein bub3                        205   2e-60    
gb|ETN62426.1|  mitotic checkpoint protein bub3                         204   2e-60    
ref|XP_004927396.1|  PREDICTED: mitotic checkpoint protein BUB3-like    204   3e-60    
ref|XP_008546185.1|  PREDICTED: mitotic checkpoint protein BUB3         203   5e-60    
ref|XP_001866784.1|  mitotic checkpoint protein BUB3                    202   6e-60    
emb|CCX31451.1|  Similar to Mitotic checkpoint protein BUB3; acc....    203   7e-60    
ref|XP_007872152.1|  hypothetical protein PNEG_00281                    202   8e-60    
ref|XP_011174562.1|  PREDICTED: mitotic checkpoint protein BUB3         199   1e-59    
ref|XP_011298128.1|  PREDICTED: mitotic checkpoint protein BUB3         202   1e-59    
emb|CCJ28532.1|  unnamed protein product                                202   1e-59    
gb|EDM11705.1|  budding uninhibited by benzimidazoles 3 homolog (...    196   2e-59    
ref|XP_393536.2|  PREDICTED: mitotic checkpoint protein BUB3            201   2e-59    
ref|XP_003393260.1|  PREDICTED: mitotic checkpoint protein BUB3-like    201   2e-59    
gb|EUB59833.1|  Mitotic checkpoint protein BUB3                         206   3e-59    
ref|XP_001758191.1|  predicted protein                                  201   3e-59    
ref|XP_011265368.1|  PREDICTED: mitotic checkpoint protein BUB3         200   6e-59    
ref|XP_003706037.1|  PREDICTED: mitotic checkpoint protein BUB3-like    201   6e-59    
ref|XP_011050868.1|  PREDICTED: mitotic checkpoint protein BUB3         200   7e-59    
ref|XP_011352277.1|  PREDICTED: mitotic checkpoint protein BUB3         200   7e-59    
ref|XP_001607033.1|  PREDICTED: mitotic checkpoint protein BUB3         200   8e-59    
ref|XP_001658374.1|  AAEL007469-PA                                      199   1e-58    
gb|EPB85009.1|  hypothetical protein HMPREF1544_08212                   199   1e-58    
ref|XP_011499082.1|  PREDICTED: mitotic checkpoint protein BUB3         199   1e-58    
ref|XP_002129118.1|  PREDICTED: mitotic checkpoint protein BUB3-like    199   2e-58    
ref|XP_001947199.1|  PREDICTED: mitotic checkpoint protein BUB3         199   2e-58    
ref|XP_011137881.1|  PREDICTED: mitotic checkpoint protein BUB3         199   2e-58    
gb|KFB47336.1|  AGAP010544-PA-like protein                              198   4e-58    
ref|XP_008478721.1|  PREDICTED: mitotic checkpoint protein BUB3         198   5e-58    
emb|CCI39543.1|  unnamed protein product                                198   5e-58    
emb|CEP12087.1|  hypothetical protein                                   197   6e-58    
gb|ETN62481.1|  mitotic checkpoint protein bub3                         197   8e-58    
gb|KFB42019.1|  AGAP010544-PA-like protein                              197   1e-57    
dbj|GAD94782.1|  nuclear pore complex subunit, putative                 197   2e-57    
ref|XP_007776320.1|  cell cycle arrest protein BUB3                     196   3e-57    
gb|KDQ09640.1|  hypothetical protein BOTBODRAFT_58543                   196   3e-57    
ref|XP_001771348.1|  predicted protein                                  196   3e-57    
ref|XP_009012296.1|  hypothetical protein HELRODRAFT_156412             194   4e-57    
dbj|GAN04134.1|  mitotic checkpoint protein BUB3-like                   202   5e-57    
gb|AAO66553.1|  putative mitotic checkpoint protein, 5'-partial         187   1e-56    
ref|XP_314512.3|  AGAP010544-PA                                         194   1e-56    
ref|XP_010466187.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    187   2e-56    
ref|XP_010466185.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    187   3e-56    
dbj|GAM34754.1|  hypothetical protein TCE0_015r02535                    194   3e-56    
ref|XP_008609881.1|  hypothetical protein SDRG_05915                    193   4e-56    
ref|XP_008874272.1|  hypothetical protein H310_09861                    193   4e-56    
ref|XP_001240063.1|  hypothetical protein CIMG_09684                    193   6e-56    
emb|CDW57621.1|  Mitotic checkpoint protein BUB3                        200   9e-56    
gb|AAG51772.1|AC079674_5  mitotic checkpoint protein, 3' partial;...    189   9e-56    
gb|EPS32958.1|  hypothetical protein PDE_07919                          192   1e-55    
gb|KDO20653.1|  hypothetical protein SPRG_13406                         191   1e-55    
gb|KFD69769.1|  hypothetical protein M514_11791                         199   2e-55    
ref|XP_003837472.1|  similar to mitotic checkpoint protein BUB3         192   2e-55    
gb|KFD47333.1|  hypothetical protein M513_11791                         199   2e-55    
gb|KDR67963.1|  hypothetical protein GALMADRAFT_257481                  191   2e-55    
ref|XP_008716388.1|  hypothetical protein HMPREF1541_03818              192   2e-55    
ref|XP_009841384.1|  hypothetical protein H257_15093                    191   2e-55    
ref|XP_011210437.1|  PREDICTED: mitotic checkpoint protein BUB3         191   2e-55    
gb|EFW21095.1|  spindle assembly checkpoint protein SLDB                192   2e-55    
ref|XP_011184683.1|  PREDICTED: mitotic checkpoint protein BUB3         191   2e-55    
gb|EAS28480.3|  nuclear pore complex subunit                            192   2e-55    
ref|XP_001798957.1|  hypothetical protein SNOG_08648                    188   3e-55    
gb|AFW85916.1|  hypothetical protein ZEAMMB73_533080                    188   4e-55    
ref|XP_004521190.1|  PREDICTED: mitotic checkpoint protein BUB3-like    190   6e-55    
ref|XP_008487741.1|  PREDICTED: mitotic checkpoint protein BUB3-like    184   7e-55    
ref|XP_002621713.1|  nuclear pore complex subunit                       191   8e-55    
ref|XP_001268166.1|  nuclear pore complex subunit, putative             190   8e-55    
gb|EEQ91810.1|  nuclear pore complex subunit                            191   1e-54    
gb|EGE81116.1|  nuclear pore complex subunit                            191   1e-54    
ref|XP_002487265.1|  nuclear pore complex subunit, putative             190   1e-54    
gb|ABK24912.1|  unknown                                                 189   1e-54    
ref|XP_005185274.1|  PREDICTED: mitotic checkpoint protein BUB3         189   1e-54    
gb|ETO19043.1|  hypothetical protein RFI_18194                          191   1e-54    
ref|XP_007853389.1|  mitotic checkpoint protein                         189   1e-54    
ref|XP_007682640.1|  hypothetical protein COCMIDRAFT_598                189   2e-54    
gb|EUN27286.1|  hypothetical protein COCVIDRAFT_37602                   189   2e-54    
ref|XP_007695027.1|  hypothetical protein COCSADRAFT_177491             189   2e-54    
gb|KFY27260.1|  hypothetical protein V491_00974                         189   2e-54    
gb|EMS68235.1|  Mitotic checkpoint protein BUB3                         184   2e-54    
ref|XP_007351004.1|  WD40 repeat-like protein                           188   2e-54    
ref|XP_008025544.1|  hypothetical protein SETTUDRAFT_178915             189   2e-54    
ref|XP_003069162.1|  Mitotic checkpoint protein BUB3, putative          184   2e-54    
ref|XP_007711065.1|  hypothetical protein COCCADRAFT_25294              189   2e-54    
ref|XP_002145286.1|  nuclear pore complex subunit, putative             189   2e-54    
ref|XP_001211551.1|  hypothetical protein ATEG_02373                    189   2e-54    
gb|EKG16570.1|  hypothetical protein MPH_06151                          189   3e-54    
ref|XP_006463599.1|  hypothetical protein AGABI2DRAFT_194378            188   4e-54    
gb|KII87964.1|  hypothetical protein PLICRDRAFT_162888                  188   4e-54    
ref|XP_001539471.1|  hypothetical protein HCAG_04938                    184   4e-54    
gb|EYE96399.1|  WD40 repeat-like protein                                188   4e-54    
ref|XP_660043.1|  hypothetical protein AN2439.2                         188   4e-54    
gb|AAC39458.1|  spindle assembly checkpoint protein SLDB                188   4e-54    
ref|XP_002847375.1|  mitotic checkpoint protein BUB3                    188   4e-54    
gb|EER43705.1|  spindle assembly checkpoint protein SLDB                189   4e-54    
gb|EHK98715.1|  putative Mitotic checkpoint protein BUB3                185   4e-54    
ref|XP_001878543.1|  predicted protein                                  187   5e-54    
ref|XP_750950.1|  nuclear pore complex subunit                          188   5e-54    
emb|CBY21932.1|  unnamed protein product                                187   5e-54    
gb|KEY75962.1|  nuclear pore complex subunit                            188   6e-54    
ref|XP_001939374.1|  mitotic checkpoint protein BUB3                    187   6e-54    
gb|EDP49636.1|  nuclear pore complex subunit, putative                  188   6e-54    
ref|XP_010760573.1|  hypothetical protein PADG_11857                    188   7e-54    
gb|KFZ00787.1|  hypothetical protein V501_10463                         187   7e-54    
gb|KIK03821.1|  hypothetical protein K443DRAFT_461558                   187   7e-54    
ref|XP_003306254.1|  hypothetical protein PTT_19370                     187   8e-54    
ref|XP_001258187.1|  nuclear pore complex subunit, putative             188   8e-54    
ref|XP_003027427.1|  hypothetical protein SCHCODRAFT_86026              187   8e-54    
gb|KIY66429.1|  WD40 repeat-like protein                                187   8e-54    
gb|ELR09595.1|  hypothetical protein GMDG_04089                         187   8e-54    
ref|XP_002793011.1|  mitotic checkpoint protein BUB3                    188   9e-54    
emb|CCM05854.1|  predicted protein                                      186   1e-53    
ref|XP_007334343.1|  hypothetical protein AGABI1DRAFT_116607            186   1e-53    
gb|EHA19308.1|  hypothetical protein ASPNIDRAFT_38727                   187   1e-53    
gb|KJA26686.1|  hypothetical protein HYPSUDRAFT_198938                  186   1e-53    
emb|CAK48281.1|  unnamed protein product                                187   2e-53    
ref|XP_006693888.1|  hypothetical protein CTHT_0034550                  187   2e-53    
emb|CCA72958.1|  related to GLE2-required for nuclear pore comple...    186   2e-53    
dbj|GAA84140.1|  nuclear pore complex subunit                           187   2e-53    
ref|XP_001394052.2|  nuclear pore complex subunit                       187   2e-53    
ref|XP_009524649.1|  hypothetical protein PHYSODRAFT_345772             187   2e-53    
ref|XP_003885873.1|  hypothetical protein NCLIV_062730                  186   2e-53    
gb|EGC50013.1|  spindle assembly checkpoint protein SLDB                187   2e-53    
ref|XP_008041777.1|  WD40 repeat-like protein                           185   3e-53    
ref|XP_007301637.1|  WD40 repeat-like protein                           185   3e-53    
gb|KIL59099.1|  hypothetical protein M378DRAFT_169744                   185   5e-53    
ref|XP_007589272.1|  putative nuclear pore complex subunit protein      185   6e-53    
ref|XP_007368929.1|  WD40 repeat-like protein                           184   6e-53    
ref|XP_008084291.1|  WD40 repeat-like protein                           185   7e-53    
gb|EEH05581.1|  spindle assembly checkpoint protein SLDB                186   7e-53    
ref|XP_001820783.1|  nuclear pore complex subunit                       185   9e-53    
ref|XP_007404536.1|  hypothetical protein MELLADRAFT_32755              185   9e-53    
gb|KIK55445.1|  hypothetical protein GYMLUDRAFT_47839                   184   9e-53    
gb|KIM84438.1|  hypothetical protein PILCRDRAFT_6108                    184   1e-52    
gb|AAD21971.1|  WD-40 repeat protein                                    184   1e-52    
ref|XP_007786124.1|  hypothetical protein EPUS_09177                    184   1e-52    
ref|XP_002098566.1|  GE10441                                            183   2e-52    
ref|XP_009267270.1|  Mitotic checkpoint protein BUB3                    179   2e-52    
ref|NP_477381.1|  Bub3, isoform A                                       183   2e-52    
ref|XP_002366977.1|  mitotic checkpoint protein BUB3, putative          184   2e-52    
ref|XP_002037219.1|  GM12232                                            183   2e-52    
ref|XP_008883648.1|  mitotic checkpoint protein, BUB3 family protein    183   2e-52    
gb|KIM26668.1|  hypothetical protein M408DRAFT_330444                   183   2e-52    
ref|XP_003019759.1|  hypothetical protein TRV_06182                     183   2e-52    
ref|XP_003011015.1|  hypothetical protein ARB_02747                     183   2e-52    
gb|EGE08021.1|  nuclear pore complex subunit                            184   3e-52    
ref|XP_003231204.1|  nuclear pore complex subunit                       184   3e-52    
ref|XP_011324864.1|  hypothetical protein FGSG_06219                    183   3e-52    
emb|CEF87018.1|  unnamed protein product                                183   3e-52    
gb|EGD95624.1|  nuclear pore complex subunit                            183   3e-52    
ref|XP_009253973.1|  hypothetical protein FPSE_02579                    183   4e-52    
ref|XP_007314228.1|  hypothetical protein SERLADRAFT_379618             182   4e-52    
ref|XP_001964758.1|  GF22876                                            182   4e-52    
gb|ENH69103.1|  Mitotic checkpoint protein BUB3                         183   4e-52    
emb|CDO71027.1|  hypothetical protein BN946_scf184844.g31               182   1e-51    
emb|CCU74706.1|  putative mitotic checkpoint protein BUB3               182   1e-51    
gb|EPQ62183.1|  Component of the nuclear pore complex                   182   1e-51    
gb|EZF31414.1|  hypothetical protein H101_04968                         182   1e-51    
gb|ESZ89838.1|  mitotic checkpoint protein BUB3                         182   1e-51    
gb|EGU85691.1|  hypothetical protein FOXB_03837                         182   1e-51    
gb|EWY96718.1|  cell cycle arrest protein BUB3                          182   1e-51    
gb|EMT60595.1|  Mitotic checkpoint protein BUB3                         182   1e-51    
gb|EWG45366.1|  cell cycle arrest protein BUB3                          182   1e-51    
gb|EXK92734.1|  cell cycle arrest protein BUB3                          182   1e-51    
emb|CCT65072.1|  related to GLE2-required for nuclear pore comple...    182   1e-51    
gb|EMT22272.1|  hypothetical protein F775_32007                         184   1e-51    
gb|KFY63547.1|  hypothetical protein V496_03855                         190   1e-51    
gb|KFY05355.1|  hypothetical protein O988_00055                         190   1e-51    
gb|KFY66195.1|  hypothetical protein V497_01037                         190   2e-51    
gb|KFZ14350.1|  hypothetical protein V502_06134                         190   2e-51    
gb|KFY83700.1|  hypothetical protein V500_09968                         189   2e-51    
gb|KFX90644.1|  hypothetical protein V490_06352                         190   2e-51    
gb|KIJ59972.1|  hypothetical protein HYDPIDRAFT_32701                   181   2e-51    
gb|EKV15814.1|  Nuclear pore complex subunit, putative                  181   2e-51    
gb|KFY34095.1|  hypothetical protein V494_07057                         189   2e-51    
gb|KIJ29057.1|  hypothetical protein M422DRAFT_37087                    181   2e-51    
gb|KIW86147.1|  hypothetical protein Z517_01541                         181   2e-51    
gb|KIL92745.1|  cell cycle arrest protein bub3                          181   2e-51    
ref|XP_003045931.1|  predicted protein                                  181   2e-51    
gb|KDN70298.1|  putative WD domain-containing protein                   181   3e-51    
gb|KIO01416.1|  hypothetical protein M404DRAFT_1003112                  180   3e-51    
ref|XP_003660355.1|  hypothetical protein MYCTH_2298566                 181   3e-51    
ref|XP_003175960.1|  mitotic checkpoint protein BUB3                    181   3e-51    
gb|ETN75602.1|  WD domain, G-beta repeat protein                        181   3e-51    
gb|KHJ30435.1|  putative mitotic checkpoint protein bub3                181   3e-51    
gb|KIW33627.1|  hypothetical protein PV07_00463                         181   3e-51    
gb|KFY06915.1|  hypothetical protein V492_07627                         189   3e-51    
emb|CDM31380.1|  WD40/YVTN repeat-like-containing domain                181   3e-51    
gb|KIK95471.1|  hypothetical protein PAXRUDRAFT_380581                  180   4e-51    
emb|CCE28146.1|  related to GLE2-required for nuclear pore comple...    181   4e-51    
gb|KFY75037.1|  hypothetical protein V499_04959                         189   4e-51    
ref|XP_007261994.1|  WD40 repeat-like protein                           180   4e-51    
ref|XP_002569032.1|  Pc21g20450                                         181   5e-51    
gb|KIP03100.1|  hypothetical protein PHLGIDRAFT_111262                  180   5e-51    
gb|KIJ11703.1|  hypothetical protein PAXINDRAFT_171655                  179   5e-51    



>emb|CDO97272.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAGRD+VYPVN+IAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEAGQSKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG+LLAVA+SYT+EEGDKPHEPD IFVRSVNEVE+KPKPKVLP
Sbjct  278  YQYSKYPTSIAALSFSRDGKLLAVASSYTYEEGDKPHEPDAIFVRSVNEVEIKPKPKVLP  337

Query  136  NAAT  125
            N +T
Sbjct  338  NPST  341



>ref|XP_011092506.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Sesamum indicum]
 ref|XP_011092507.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Sesamum indicum]
Length=342

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  219  LSEAGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY+KYP S+AALSFSRDGRLLAVA+SYT+EEGDK HEPD IFVRSVNEVEVKPKPK LP
Sbjct  279  YQYTKYPTSIAALSFSRDGRLLAVASSYTYEEGDKDHEPDAIFVRSVNEVEVKPKPKALP  338

Query  136  NAAT  125
            N AT
Sbjct  339  NPAT  342



>ref|XP_009590366.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Nicotiana tomentosiformis]
Length=340

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRK+EAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEAGQSKKYAFKCHRKTEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY KYP+S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD I VRSVNEVEVKPKPKVLP
Sbjct  277  YQYPKYPSSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIIVRSVNEVEVKPKPKVLP  336

Query  136  NAAT  125
            N A+
Sbjct  337  NPAS  340



>ref|XP_009777463.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Nicotiana sylvestris]
Length=340

 Score =   342 bits (877),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRK+EAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEAGQSKKYAFKCHRKTEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY KYP+S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD I VRSVNEVEVKPKPKVLP
Sbjct  277  YQYPKYPSSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIIVRSVNEVEVKPKPKVLP  336

Query  136  NAAT  125
            N  T
Sbjct  337  NPTT  340



>gb|EYU39062.1| hypothetical protein MIMGU_mgv1a009456mg [Erythranthe guttata]
Length=341

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQ+KKYAFKCHRKSEAG D+V+PVNAIAFHPIYGTFATGGCDGYVN+WDGNNKKRL
Sbjct  218  LSEAGQTKKYAFKCHRKSEAGTDIVHPVNAIAFHPIYGTFATGGCDGYVNMWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVNEVEVKPKPKVLP
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVNEVEVKPKPKVLP  337

Query  136  NAAT  125
            + AT
Sbjct  338  SPAT  341



>ref|XP_004230702.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Solanum lycopersicum]
Length=340

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNM+Q EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNVYDLRNMNQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+GQSKKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSESGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY KYP+SVAALSFSRDG+LLAVA+SYTFEEG+KPHEPD IFVRSVNEVEVKPKPKVLP
Sbjct  277  YQYPKYPSSVAALSFSRDGKLLAVASSYTFEEGEKPHEPDAIFVRSVNEVEVKPKPKVLP  336

Query  136  NAAT  125
            N  +
Sbjct  337  NPTS  340



>ref|XP_007201242.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica]
 ref|XP_008236327.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Prunus mume]
 gb|EMJ02441.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica]
Length=341

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDSIFVRSVNEIEVKPKPKVYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>gb|KJB32263.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=268

 Score =   337 bits (863),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  85   LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  144

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  145  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  204

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEGDK HEPD IFVRSVNE+EVKPKPKV P
Sbjct  205  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGDKAHEPDAIFVRSVNEIEVKPKPKVYP  264

Query  136  N  134
            N
Sbjct  265  N  265



>ref|XP_002527504.1| mitotic checkpoint protein bub3, putative [Ricinus communis]
 gb|EEF34902.1| mitotic checkpoint protein bub3, putative [Ricinus communis]
Length=342

 Score =   339 bits (870),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKVLP
Sbjct  279  YQYSKYPSSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDSIFVRSVNEIEVKPKPKVLP  338

Query  136  N  134
            N
Sbjct  339  N  339



>ref|XP_008382226.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Malus domestica]
Length=341

 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVNE+EVKPKPK  P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVNEIEVKPKPKAYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>ref|XP_006422834.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 ref|XP_006486924.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Citrus sinensis]
 gb|ESR36074.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 gb|KDO57878.1| hypothetical protein CISIN_1g019384mg [Citrus sinensis]
Length=342

 Score =   339 bits (869),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPK  P
Sbjct  279  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKAYP  338

Query  136  N  134
            N
Sbjct  339  N  339



>ref|XP_009347116.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Pyrus x bretschneideri]
Length=341

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYT+EEGDKPHEPD IF+RSVNE+EVKPKPK  P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFIRSVNEIEVKPKPKAYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>ref|XP_008454389.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Cucumis melo]
Length=341

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  PSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD I+VRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIYVRSVNEIEVKPKPKVYP  337

Query  136  NAAT  125
            N +T
Sbjct  338  NPST  341



>ref|XP_006346313.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Solanum tuberosum]
Length=340

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNM+Q EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNVYDLRNMNQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+GQSKKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSESGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY KYP+SVAALSFSRDG+LLAVA+SYTFEEG+KPHEPD I+VRSVNEVEVKPKPKVLP
Sbjct  277  YQYPKYPSSVAALSFSRDGKLLAVASSYTFEEGEKPHEPDAIYVRSVNEVEVKPKPKVLP  336

Query  136  NAAT  125
            N  +
Sbjct  337  NPTS  340



>ref|XP_008364436.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Malus domestica]
Length=341

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>ref|XP_002264472.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Vitis vinifera]
 emb|CBI22464.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFF+
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFE  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+SVAALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKVLP
Sbjct  278  YQYSKYPSSVAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEMEVKPKPKVLP  337



>ref|XP_007042628.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOX98459.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=342

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  279  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  338

Query  136  N  134
            N
Sbjct  339  N  339



>ref|XP_004156860.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cucumis sativus]
 gb|KGN52771.1| hypothetical protein Csa_4G000900 [Cucumis sativus]
Length=341

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  PSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEGDKPHEPD I+VRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIYVRSVNEIEVKPKPKVYP  337

Query  136  NAAT  125
            N  T
Sbjct  338  NPPT  341



>ref|XP_009335381.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Pyrus x bretschneideri]
Length=341

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>ref|XP_004289802.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQTKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVR+VNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRNVNEIEVKPKPKVYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>gb|ABK21756.1| unknown [Picea sitchensis]
 gb|ABK22148.1| unknown [Picea sitchensis]
Length=342

 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR++NVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  160  LVVATAGRNINVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  219

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  220  LSEAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  279

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVN
Sbjct  280  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVN  327



>gb|KCW55112.1| hypothetical protein EUGRSUZ_I01072, partial [Eucalyptus grandis]
Length=375

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  192  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  251

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  252  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  311

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAV +SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  312  YQYSKYPTSIAALSFSRDGRLLAVGSSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  371

Query  136  N  134
            N
Sbjct  372  N  372



>gb|KJB79447.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=294

 Score =   334 bits (857),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR VNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  111  LVVATAGRQVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  170

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  171  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  230

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  231  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRSVNEIEVKPKPKVYP  290

Query  136  N  134
            N
Sbjct  291  N  291



>ref|XP_008787173.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3.1-like 
[Phoenix dactylifera]
Length=344

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  161  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAG+D VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  221  LSEAGQSKKYAFKCHRKSEAGKDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGD PHEPD IFVR+VN
Sbjct  281  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDTPHEPDAIFVRNVN  328



>ref|XP_010277064.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Nelumbo nucifera]
Length=341

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQ+RESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQKRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHP+YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPVYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQY+KYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD I+VRSVN
Sbjct  278  YQYTKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIYVRSVN  325



>gb|KJB32261.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=342

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEGDK HEPD IFVRSVNE+EVKPKPKV P
Sbjct  279  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGDKAHEPDAIFVRSVNEIEVKPKPKVYP  338

Query  136  N  134
            N
Sbjct  339  N  339



>gb|KJB32260.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=341

 Score =   334 bits (857),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEGDK HEPD IFVRSVN
Sbjct  279  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGDKAHEPDAIFVRSVN  326



>ref|XP_010099611.1| Mitotic checkpoint protein [Morus notabilis]
 gb|EXB80042.1| Mitotic checkpoint protein [Morus notabilis]
Length=338

 Score =   334 bits (856),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVR VNE+EVKPKPKVLP
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRGVNEIEVKPKPKVLP  337

Query  136  N  134
            +
Sbjct  338  S  338



>ref|XP_010030628.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Eucalyptus grandis]
Length=426

 Score =   337 bits (864),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  243  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  302

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  303  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  362

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAV +SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  363  YQYSKYPTSIAALSFSRDGRLLAVGSSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  422

Query  136  N  134
            N
Sbjct  423  N  423



>ref|XP_010541847.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Tarenaya hassleriana]
Length=339

 Score =   333 bits (855),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            +VVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  VVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEATQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+SVAALSFSRDGRLLAVA+SYTFEEGDK HEPD IFVRSVNE+EVKPKPK  P
Sbjct  276  YQYSKYPSSVAALSFSRDGRLLAVASSYTFEEGDKKHEPDAIFVRSVNEIEVKPKPKAYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>gb|KJB79445.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
 gb|KJB79449.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=341

 Score =   333 bits (855),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR VNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRQVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRSVNEIEVKPKPKVYP  337

Query  136  N  134
            N
Sbjct  338  N  338



>ref|XP_006422835.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 gb|ESR36075.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
Length=344

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 175/183 (96%), Gaps = 2/183 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKY--AFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKK  323
            LSEA Q+KKY  AFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKK
Sbjct  219  LSEASQAKKYIYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKK  278

Query  322  RLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkV  143
            RLYQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPK 
Sbjct  279  RLYQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKA  338

Query  142  LPN  134
             PN
Sbjct  339  YPN  341



>ref|XP_010243393.1| PREDICTED: mitotic checkpoint protein BUB3.2 isoform X2 [Nelumbo 
nucifera]
Length=300

 Score =   331 bits (849),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQ+RESSLK+QTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  119  LVVATAGRHVNVYDLRNMSQPEQKRESSLKHQTRCVRCYPNGTGFALSSVEGRVAMEFFD  178

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHP+YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  179  LSEAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPVYGTFATGGCDGYVNVWDGNNKKRL  238

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQY+KYP S+AALSFSRDGRLLAVA+SYTFEEGD+PHEPD IFVRS+N
Sbjct  239  YQYTKYPTSIAALSFSRDGRLLAVASSYTFEEGDRPHEPDAIFVRSIN  286



>ref|XP_011001892.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Populus euphratica]
Length=342

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG++N+WDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFINIWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP+S+AALSFSRDG LLAVA+SYT+EEGDKPHEPD IFVRSVN
Sbjct  279  YQYSKYPSSIAALSFSRDGSLLAVASSYTYEEGDKPHEPDAIFVRSVN  326



>gb|KDP44484.1| hypothetical protein JCGZ_16317 [Jatropha curcas]
Length=342

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+S+AALSFSRDGRLLAVA+SYTFEEG+K HEPD IFVRSVNE+EVKPKPKV P
Sbjct  279  YQYSKYPSSIAALSFSRDGRLLAVASSYTFEEGEKVHEPDAIFVRSVNEIEVKPKPKVFP  338

Query  136  N  134
            N
Sbjct  339  N  339



>gb|KJB79448.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=312

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -3

Query  673  VVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDL  494
            VVATAGR VNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDL
Sbjct  130  VVATAGRQVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDL  189

Query  493  SEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRLY  314
            SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRLY
Sbjct  190  SEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRLY  249

Query  313  QYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLPN  134
            QYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVRSVNE+EVKPKPKV PN
Sbjct  250  QYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRSVNEIEVKPKPKVYPN  309



>ref|XP_004152275.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cucumis sativus]
Length=341

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGR +VYPV AIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  PSEASQAKKYAFKCHRKSEAGRGIVYPVTAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEGDKPHEPD I+VRSVNE+EVKPKPKV P
Sbjct  278  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIYVRSVNEIEVKPKPKVYP  337

Query  136  NAAT  125
            N  T
Sbjct  338  NPPT  341



>gb|KHG11458.1| Bub3 [Gossypium arboreum]
 gb|KHG11459.1| Bub3 [Gossypium arboreum]
Length=342

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR VNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRQVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            +SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  ISEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  279  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKPHEPDAIFVRSVNEIEVKPKPKVYP  338

Query  136  N  134
            N
Sbjct  339  N  339



>ref|XP_010243391.1| PREDICTED: mitotic checkpoint protein BUB3.1 isoform X1 [Nelumbo 
nucifera]
Length=339

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQ+RESSLK+QTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQKRESSLKHQTRCVRCYPNGTGFALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHP+YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPVYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQY+KYP S+AALSFSRDGRLLAVA+SYTFEEGD+PHEPD IFVRS+N
Sbjct  278  YQYTKYPTSIAALSFSRDGRLLAVASSYTFEEGDRPHEPDAIFVRSIN  325



>ref|XP_002300265.2| WD-40 repeat family protein [Populus trichocarpa]
 ref|XP_011030351.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Populus euphratica]
 ref|XP_011012431.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Populus euphratica]
 gb|EEE85070.2| WD-40 repeat family protein [Populus trichocarpa]
Length=342

 Score =   331 bits (849),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMS  EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSLPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  219  PSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+SVAALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVNE+EVKPKPK  P
Sbjct  279  YQYSKYPSSVAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVNEIEVKPKPKAYP  338

Query  136  N  134
            N
Sbjct  339  N  339



>ref|XP_010687353.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   331 bits (849),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            +VVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  VVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG VNVWDGNNKKRL
Sbjct  218  LSEAGQSKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGIVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQY KYP S++ALSFS+DGRLLAVA+SYT+EEG+KPHEPD IF+RSVN
Sbjct  278  YQYVKYPTSISALSFSKDGRLLAVASSYTYEEGEKPHEPDAIFIRSVN  325



>ref|XP_009107249.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Brassica rapa]
Length=339

 Score =   331 bits (848),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLA+A+SYTFEEGDKPHEPD IFVR+VNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAIASSYTFEEGDKPHEPDTIFVRNVNEIEVKPKPKVYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>emb|CDY59371.1| BnaA08g29630D [Brassica napus]
Length=339

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLA+A+SYTFEEGDKPHEPD IFVR+VNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAIASSYTFEEGDKPHEPDAIFVRNVNEIEVKPKPKVYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_002891542.1| hypothetical protein ARALYDRAFT_474121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67801.1| hypothetical protein ARALYDRAFT_474121 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_006393203.1| hypothetical protein EUTSA_v10011632mg [Eutrema salsugineum]
 gb|ESQ30489.1| hypothetical protein EUTSA_v10011632mg [Eutrema salsugineum]
Length=339

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVR+VNE+EVKPKPK  P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDAIFVRNVNEIEVKPKPKAYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_002313908.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE87863.2| WD-40 repeat family protein [Populus trichocarpa]
Length=342

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG++N+WDGNNKKRL
Sbjct  219  SSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFINIWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP+S+AALSFSRDG LLAVA+SYT+EEGDKPHEPD IFVRSVN
Sbjct  279  YQYSKYPSSIAALSFSRDGSLLAVASSYTYEEGDKPHEPDAIFVRSVN  326



>ref|XP_002970095.1| hypothetical protein SELMODRAFT_146851 [Selaginella moellendorffii]
 ref|XP_002985287.1| hypothetical protein SELMODRAFT_446198 [Selaginella moellendorffii]
 gb|EFJ13781.1| hypothetical protein SELMODRAFT_446198 [Selaginella moellendorffii]
 gb|EFJ29219.1| hypothetical protein SELMODRAFT_146851 [Selaginella moellendorffii]
Length=339

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRH+NVYDLRNMS+ EQ RESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHINVYDLRNMSRPEQERESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            +SEAGQ+KKYAFKCHR SEAGRD VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  216  MSEAGQAKKYAFKCHRNSEAGRDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYS+YP S+AALSFSRDGRLLA+A+SYTFEEG+KPHEPD IFVRS+N
Sbjct  276  YQYSRYPTSIAALSFSRDGRLLAIASSYTFEEGEKPHEPDAIFVRSIN  323



>ref|XP_010479422.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Camelina sativa]
Length=339

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNG+GYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGSGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLA+A+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAIASSYTFEEGDKPHEPDTIFVRSVNEIEVKPKPKVYP  335

Query  136  NAAT  125
            N A 
Sbjct  336  NRAV  339



>ref|NP_175413.1| cell cycle arrest protein BUB3  [Arabidopsis thaliana]
 sp|Q9C701.1|BUB32_ARATH RecName: Full=Mitotic checkpoint protein BUB3.2; AltName: Full=Protein 
BUDDING UNINHIBITED BY BENZYMIDAZOL 3.2 [Arabidopsis 
thaliana]
 gb|AAG60165.1|AC074110_3 mitotic checkpoint protein, putative [Arabidopsis thaliana]
 gb|AEE32490.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana]
Length=339

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_011088067.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Sesamum indicum]
Length=341

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRK+EAG+D+VYPVNAIAFHPIYGTFATGGCDGYVNVWDG+NKKRL
Sbjct  218  LSEAGQSKKYAFKCHRKTEAGKDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGDNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY KY  S+AALSFSRDGRLLAVA+SYT+E+GDKPH  D IFVRSVNEVEVKPKPK LP
Sbjct  278  YQYPKYTTSIAALSFSRDGRLLAVASSYTYEDGDKPHAVDAIFVRSVNEVEVKPKPKALP  337

Query  136  NAA  128
            N A
Sbjct  338  NLA  340



>gb|KFK35968.1| hypothetical protein AALP_AA4G061300 [Arabis alpina]
Length=339

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+RESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQKRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRK+E GRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKTEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVR+VNE+EVKPKPK  P
Sbjct  276  YQYSKYPTSVAALSFSRDGGLLAVASSYTFEEGDKPHEPDAIFVRNVNEIEVKPKPKAYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_006298078.1| hypothetical protein CARUB_v10014121mg [Capsella rubella]
 gb|EOA30976.1| hypothetical protein CARUB_v10014121mg [Capsella rubella]
Length=339

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S++ALSFSRDG+LLAVA+SYTFEEG+K HEP+ IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSHEPEAIFVRSVNEIEVKPKPKVYP  335

Query  136  NAA  128
            N A
Sbjct  336  NPA  338



>emb|CDY03579.1| BnaC03g68380D [Brassica napus]
Length=340

 Score =   329 bits (843),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNM+Q EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV+MEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMAQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  217  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLA+A+SYTFEEGDKPHEPD IFVR+VNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSIAALSFSRDGGLLAIASSYTFEEGDKPHEPDAIFVRNVNEIEVKPKPKVYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|XP_006305280.1| hypothetical protein CARUB_v10009656mg [Capsella rubella]
 gb|EOA38178.1| hypothetical protein CARUB_v10009656mg [Capsella rubella]
Length=339

 Score =   328 bits (841),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNG+GYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGSGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKVYP  335

Query  136  N  134
            N
Sbjct  336  N  336



>ref|XP_010942824.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Elaeis guineensis]
Length=343

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  160  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  219

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAG+D VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  220  LSEAGQSKKYAFKCHRKSEAGKDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  279

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEGD   EPD IFVR+VN
Sbjct  280  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDIAREPDAIFVRNVN  327



>ref|XP_003536585.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max]
Length=340

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEG K  E D IFVRSVNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGPKSQEQDAIFVRSVNEIEVKPKPKVYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|XP_003610622.1| Mitotic checkpoint protein BUB3 [Medicago truncatula]
 gb|AES93580.1| mitotic checkpoint protein BUB3 [Medicago truncatula]
Length=344

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYD+RNMS  EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  161  LVVATAGRHVNVYDMRNMSCPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNA+AFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  221  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAMAFHPIYGTFATGGCDGFVNVWDGNNKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+SVAALSFSRDGRLLAVA+SYTFEEG KPH+ D I+VRSVNE+EVKPKPK LP
Sbjct  281  YQYSKYPSSVAALSFSRDGRLLAVASSYTFEEGPKPHDQDAIYVRSVNEIEVKPKPKALP  340

Query  136  N  134
            N
Sbjct  341  N  341



>ref|XP_010461841.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Camelina sativa]
Length=339

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRN+SQ EQRRESSLKYQTRCVRCYP+G+GYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRNLSQPEQRRESSLKYQTRCVRCYPSGSGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE GRD+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDTIFVRSVNEIEVKPKPKVYP  335

Query  136  NAAT  125
            N A 
Sbjct  336  NRAV  339



>ref|XP_010556011.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Tarenaya hassleriana]
Length=339

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEATQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +SVAALSFSRDGRLLAVA+SYTFEEG+K HEPD I+VRSVN
Sbjct  276  YQYSKYRSSVAALSFSRDGRLLAVASSYTFEEGEKQHEPDAIYVRSVN  323



>ref|XP_009111676.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Brassica rapa]
 emb|CDY42193.1| BnaA01g26020D [Brassica napus]
Length=340

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVR YPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRSYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  217  LSEAAQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+S+AALSFSRDG+LLAVA+SYTFEEG+K HEP+ IFVR+VNE+EVKPKPK  P
Sbjct  277  YQYSKYPSSIAALSFSRDGQLLAVASSYTFEEGEKSHEPEAIFVRNVNEIEVKPKPKAYP  336

Query  136  NAA  128
            N A
Sbjct  337  NPA  339



>emb|CDX95434.1| BnaC01g33260D [Brassica napus]
Length=340

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVR YPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRSYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  217  LSEAAQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP+S+AALSFSRDG+LLAVA+SYTFEEG+K HEP+ IFVR+VNE+EVKPKPK  P
Sbjct  277  YQYSKYPSSIAALSFSRDGQLLAVASSYTFEEGEKSHEPEAIFVRNVNEIEVKPKPKAYP  336

Query  136  NAA  128
            N A
Sbjct  337  NPA  339



>ref|NP_566644.1| cell cycle arrest protein BUB3  [Arabidopsis thaliana]
 sp|Q9LJN8.1|BUB31_ARATH RecName: Full=Mitotic checkpoint protein BUB3.1; AltName: Full=Protein 
BUDDING UNINHIBITED BY BENZYMIDAZOL 3.1 [Arabidopsis 
thaliana]
 dbj|BAB02543.1| mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AAM64953.1| mitotic checkpoint protein, putative [Arabidopsis thaliana]
 gb|AAO42274.1| putative mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AAP04137.1| putative mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AEE76263.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana]
Length=340

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  217  LSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S++ALSFSRDG+LLAVA+SYTFEEG+K  EP+ IFVRSVNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEAIFVRSVNEIEVKPKPKVYP  336

Query  136  NAA  128
            N A
Sbjct  337  NPA  339



>ref|XP_002883194.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59453.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S++ALSFSRDG+LLAVA+SYTFEEG+K  EP+ IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEAIFVRSVNEIEVKPKPKVYP  335

Query  136  NAA  128
            N A
Sbjct  336  NPA  338



>ref|XP_009396041.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  219  LSEAAQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP S+AALSFSRDGR LAVA+SYTFEEGD  HEPD IFVR+VN
Sbjct  279  YQYSKYPTSIAALSFSRDGRQLAVASSYTFEEGDTLHEPDTIFVRNVN  326



>ref|XP_006849345.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda]
 gb|ERN10926.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda]
Length=342

 Score =   327 bits (837),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYD+RNMSQ EQRRESSLKYQTRCVRCYPNGTG+ALSSVEGRVAMEFFD
Sbjct  159  LVVATAGRHVNVYDVRNMSQPEQRRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LS+AGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  219  LSDAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYS+Y  S++ALSFSRDGRLLAVA+SYTFEEG+ PHEPD IFVRSVNE+EVK KPKVLP
Sbjct  279  YQYSRYRTSISALSFSRDGRLLAVASSYTFEEGEIPHEPDAIFVRSVNEIEVKQKPKVLP  338

Query  136  N  134
             
Sbjct  339  T  339



>gb|KHN42322.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=340

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFE+G K  E D IFVRSVNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEDGPKSQEQDAIFVRSVNEIEVKPKPKVYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|XP_010500544.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Camelina sativa]
Length=339

 Score =   326 bits (835),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLR MSQ EQRRESSLKYQTRCVRCYPNG+GYALSSVEGRV+MEFFD
Sbjct  156  LVVATAGRHVNIYDLRYMSQPEQRRESSLKYQTRCVRCYPNGSGYALSSVEGRVSMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSE G+D+VYPVNAIAFHPIYGTFA+GGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKSEDGKDIVYPVNAIAFHPIYGTFASGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDG LLAVA+SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPDTIFVRSVNEIEVKPKPKVYP  335

Query  136  NAAT  125
            N A 
Sbjct  336  NRAV  339



>ref|XP_007143105.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris]
 gb|ESW15099.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris]
Length=342

 Score =   326 bits (835),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 1/182 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+RESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQKRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKP-HEPDVIFVRSVNevevkpkpkVL  140
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEG K  +EPD IFVRSVNE+EVKPKPKV 
Sbjct  278  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGPKSNNEPDAIFVRSVNEIEVKPKPKVY  337

Query  139  PN  134
            PN
Sbjct  338  PN  339



>ref|XP_003555986.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max]
Length=340

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCV CYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVHCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFE+G K  E D IFVRSVNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEDGPKSQEQDAIFVRSVNEIEVKPKPKVYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|XP_010487904.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Camelina sativa]
Length=339

 Score =   323 bits (829),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRK+EAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKTEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S++ALSFSRDG+LLAVA+SYTFEEG+K  EP+ IFVR+VNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSSEPEAIFVRNVNEIEVKPKPKVYP  335

Query  136  NAA  128
            N A
Sbjct  336  NPA  338



>ref|XP_010507823.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Camelina sativa]
Length=339

 Score =   322 bits (824),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRK+EAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKTEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S++A SFSRDG+LLAVA+SYTFEEG+K +EP+ IFVR+VNE+EVKPKPKV P
Sbjct  276  YQYSKYPTSISAQSFSRDGQLLAVASSYTFEEGEKSYEPEAIFVRNVNEIEVKPKPKVYP  335

Query  136  NAA  128
            N A
Sbjct  336  NPA  338



>ref|XP_001764716.1| predicted protein [Physcomitrella patens]
 gb|EDQ70415.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   322 bits (824),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 2/170 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTG--YALSSVEGRVAMEF  503
            LVVATAGRH+ VYDLR+M Q EQ RESSLKYQTRCVRCYPNGTG  YALSSVEGRVAMEF
Sbjct  155  LVVATAGRHITVYDLRHMQQAEQIRESSLKYQTRCVRCYPNGTGMRYALSSVEGRVAMEF  214

Query  502  FDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKK  323
            FD+S+AGQ+KKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDGNNKK
Sbjct  215  FDMSDAGQAKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKK  274

Query  322  RLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            RLYQYS+YP SVAALSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSVN
Sbjct  275  RLYQYSRYPTSVAALSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVN  324



>ref|XP_010466109.1| PREDICTED: mitotic checkpoint protein BUB3.1-like isoform X1 
[Camelina sativa]
 ref|XP_010466111.1| PREDICTED: mitotic checkpoint protein BUB3.1-like isoform X2 
[Camelina sativa]
Length=340

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  156  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRK+EAGRD+VYPVN+IAFHPIYGTFATGGCDG+VN+WDGNNKKRL
Sbjct  216  LSEAAQAKKYAFKCHRKTEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKYP S++ALSFSRDG+LLAVA+SYTFEEG+K +EP+ IFVR+VN
Sbjct  276  YQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSYEPEAIFVRNVN  323



>gb|EPS71625.1| hypothetical protein M569_03130, partial [Genlisea aurea]
Length=328

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYD+RNMSQ EQRRESSLKYQTRCVRCYPNG GYALSSVEGRVAMEFFD
Sbjct  149  LVVATAGRHVNVYDIRNMSQPEQRRESSLKYQTRCVRCYPNGLGYALSSVEGRVAMEFFD  208

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEAGQSKKYAFKCHRKSEAG+D+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  209  LSEAGQSKKYAFKCHRKSEAGKDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  268

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
            YQYSKYP S+AALSFSRDG+LLAVA+SYT+E+G+K HE D IFVRSV
Sbjct  269  YQYSKYPTSIAALSFSRDGKLLAVASSYTYEDGEKYHEADGIFVRSV  315



>gb|KHN06798.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=340

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNM Q EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMYQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDG VNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGDVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP SVAALSFSRDGRLLAVA+SYTFEEG K  E D IFVRSVNE+EVKPKPKV P
Sbjct  277  YQYSKYPTSVAALSFSRDGRLLAVASSYTFEEGPKSQEQDAIFVRSVNEIEVKPKPKVYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|XP_004511310.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cicer arietinum]
Length=340

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMS  EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNVYDLRNMSIPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNA+AFHPIYGTFATGGCDG+VNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAMAFHPIYGTFATGGCDGFVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG K +E D I+VRSVNE+EVKPKPK  P
Sbjct  277  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGPKTNEQDAIYVRSVNEIEVKPKPKAYP  336

Query  136  N  134
            N
Sbjct  337  N  337



>ref|NP_001239974.1| uncharacterized protein LOC100820541 [Glycine max]
 gb|ACU23267.1| unknown [Glycine max]
Length=344

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 172/185 (93%), Gaps = 4/185 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  157  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  216

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL
Sbjct  217  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  276

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEE----GDKPHEPDVIFVRSVNevevkpkp  149
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEE    G K  E D I+VRSVNE+EVKPKP
Sbjct  277  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGPKAGTKADEQDAIYVRSVNEIEVKPKP  336

Query  148  kVLPN  134
            KV PN
Sbjct  337  KVYPN  341



>gb|EYU37574.1| hypothetical protein MIMGU_mgv1a009424mg [Erythranthe guttata]
Length=342

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYD+RNMSQ EQ+RESSLKYQTRCVRCYPNGTGYALSS+EGRVAME+FD
Sbjct  159  LVVATAGRHVNVYDIRNMSQPEQQRESSLKYQTRCVRCYPNGTGYALSSIEGRVAMEYFD  218

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA QSKKYAFKCHRKSE G+D+VYPVNAIA+HPIYGTFATGG DGYVNVWDG+NKKRL
Sbjct  219  LSEASQSKKYAFKCHRKSEGGKDIVYPVNAIAYHPIYGTFATGGGDGYVNVWDGSNKKRL  278

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQY+K P SVA+LSFSRDGRLLAVA+SYT+EEGDKPHEPD IFVRSV EVEVKPKPKVL 
Sbjct  279  YQYAKLPTSVASLSFSRDGRLLAVASSYTYEEGDKPHEPDAIFVRSVGEVEVKPKPKVLS  338

Query  136  NAA  128
            N A
Sbjct  339  NPA  341



>ref|XP_007143112.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris]
 gb|ESW15106.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris]
Length=345

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 173/185 (94%), Gaps = 4/185 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+RESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQKRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIA+HP+YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  218  LSEAIQAKKYAFKCHRKSEAGRDIVYPVNAIAYHPVYGTFATGGCDGYVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKP----HEPDVIFVRSVNevevkpkp  149
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG K      EPD I+VRSVNE+EVKPKP
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGPKTGLQFFEPDAIYVRSVNEIEVKPKP  337

Query  148  kVLPN  134
            KV PN
Sbjct  338  KVYPN  342



>ref|XP_006406483.1| hypothetical protein EUTSA_v10021448mg [Eutrema salsugineum]
 gb|ESQ47936.1| hypothetical protein EUTSA_v10021448mg [Eutrema salsugineum]
Length=231

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRH+NVYDLRNMSQ EQRRESSLKYQTRCVR YPNGTGYALSSVEGRVAMEFFD
Sbjct  48   LVVATAGRHINVYDLRNMSQPEQRRESSLKYQTRCVRSYPNGTGYALSSVEGRVAMEFFD  107

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SEA Q+KKYAFKCHRKSEAGRD+VY VNAIAFHPIYGTFATGGCDG+VN+WDG NKKRL
Sbjct  108  PSEAAQAKKYAFKCHRKSEAGRDIVYSVNAIAFHPIYGTFATGGCDGFVNIWDGTNKKRL  167

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            YQYSKY  S+AALSF+RDG+LLAVA+SYTFE+G+K HEP+ IFVRSVNE+EVKPKPK  P
Sbjct  168  YQYSKYLTSIAALSFNRDGQLLAVASSYTFEDGEKSHEPEAIFVRSVNEIEVKPKPKAYP  227

Query  136  NAA  128
            N A
Sbjct  228  NPA  230



>emb|CAN82065.1| hypothetical protein VITISV_008011 [Vitis vinifera]
Length=371

 Score =   318 bits (814),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 176/214 (82%), Gaps = 34/214 (16%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFF+
Sbjct  158  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFE  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPI------------------------  389
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHPI                        
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPINGRVAWHGSSGDGGQLVTFFGVCG  277

Query  388  ----------YGTFATGGCDGYVNVWDGNNKKRLYQYSKYPASVAALSFSRDGRLLAVAA  239
                       GTFATGGCDG+VNVWDGNNKKRLYQYSKYP+SVAALSFSRDGRLLAVA+
Sbjct  278  NGKLXWLLGGMGTFATGGCDGFVNVWDGNNKKRLYQYSKYPSSVAALSFSRDGRLLAVAS  337

Query  238  SYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLP  137
            SYTFEEGDKPHEPD IFVRSVNE+EVKPKPKVLP
Sbjct  338  SYTFEEGDKPHEPDAIFVRSVNEMEVKPKPKVLP  371



>ref|XP_006651529.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Oryza brachyantha]
Length=333

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  152  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  212  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  271

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+RSVN
Sbjct  272  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKSHEPDAIFIRSVN  319



>ref|NP_001050471.1| Os03g0448600 [Oryza sativa Japonica Group]
 gb|AAS01923.1| putative mitotic checkpoint protein [Oryza sativa Japonica Group]
 gb|ABF96947.1| Mitotic checkpoint protein BUB3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12385.1| Os03g0448600 [Oryza sativa Japonica Group]
 dbj|BAG99453.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59336.1| hypothetical protein OsJ_11417 [Oryza sativa Japonica Group]
Length=343

 Score =   316 bits (810),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  162  LVVATAGRHVNIYDLRNMSQHEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  221

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  222  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  281

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+RSVN
Sbjct  282  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKSHEPDAIFIRSVN  329



>gb|EEC75559.1| hypothetical protein OsI_12223 [Oryza sativa Indica Group]
Length=343

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  162  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  221

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  222  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  281

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+RSVN
Sbjct  282  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKSHEPDAIFIRSVN  329



>ref|NP_001149777.1| LOC100283404 [Zea mays]
 gb|ACF84850.1| unknown [Zea mays]
 gb|ACG36755.1| mitotic checkpoint protein BUB3 [Zea mays]
 gb|ACG37866.1| mitotic checkpoint protein BUB3 [Zea mays]
 gb|ACR35836.1| unknown [Zea mays]
 gb|AFW85917.1| mitotic checkpoint protein BUB3 [Zea mays]
Length=343

 Score =   316 bits (809),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  161  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  221  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+R+VN
Sbjct  281  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKTHEPDAIFIRTVN  328



>gb|ACG48694.1| mitotic checkpoint protein BUB3 [Zea mays]
Length=343

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  161  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  221  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+R+VN
Sbjct  281  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKTHEPDAIFIRTVN  328



>ref|XP_002436452.1| hypothetical protein SORBIDRAFT_10g002920 [Sorghum bicolor]
 gb|EER87819.1| hypothetical protein SORBIDRAFT_10g002920 [Sorghum bicolor]
Length=343

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  161  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  221  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+R+VN
Sbjct  281  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKTHEPDAIFIRTVN  328



>ref|XP_003562373.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Brachypodium 
distachyon]
Length=345

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SSLKYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  163  LVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  222

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSE+GRD VYPVNAIAFHPIYGTFATGGCDGYVNVWDG NKKRL
Sbjct  223  LSESAQSKKYAFKCHRKSESGRDTVYPVNAIAFHPIYGTFATGGCDGYVNVWDGTNKKRL  282

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG +LAVA+SYT+EEG+K HEPD IF+R VN
Sbjct  283  YQYSKYASSIAALSFSKDGHMLAVASSYTYEEGEKSHEPDAIFIRGVN  330



>gb|ACF78394.1| unknown [Zea mays]
Length=343

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQ+R+SS KYQTRCVRC+PNGTGYALSSVEGRV+MEFFD
Sbjct  161  LVVATAGRHVNIYDLRNMSQPEQKRDSSWKYQTRCVRCFPNGTGYALSSVEGRVSMEFFD  220

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSE+ QSKKYAFKCHRKSEAGRD VYPVNAIAFHPIYGTFATGGCDG+VNVWDG NKKRL
Sbjct  221  LSESAQSKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRL  280

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQYSKY +S+AALSFS+DG LLAVA+SYT+EEG+K HEPD IF+R+VN
Sbjct  281  YQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKTHEPDAIFIRTVN  328



>gb|KJB79446.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=313

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR VNVYDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  158  LVVATAGRQVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  217

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KKYAFKCHRKSEAGRD+VYPVNAIAFHP+YGTFATGGCDG+VNVWDGNNKKRL
Sbjct  218  LSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPVYGTFATGGCDGFVNVWDGNNKKRL  277

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKP  209
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEEG+KP
Sbjct  278  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGEKP  313



>gb|AFK38016.1| unknown [Lotus japonicus]
Length=167

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -3

Query  625  MSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAGQSKKYAFKCHRK  446
            MS  EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEA Q+KKYAFKCHRK
Sbjct  1    MSLPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRK  60

Query  445  SEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRLYQYSKYPASVAALSFSR  266
            SEAGRD VYPVNA+AFHPIYGTFATGGCDGYVNVWDGNNKKRLYQYSKYP S+AALSFSR
Sbjct  61   SEAGRDFVYPVNAMAFHPIYGTFATGGCDGYVNVWDGNNKKRLYQYSKYPTSIAALSFSR  120

Query  265  DGRLLAVAASYTFEEGDKPHEPDVIFVRSVNevevkpkpkVLPNAA  128
            DGRLLAVA+SYTFEEG KPHE D I+VRSVNE+EVKPKPKV PN A
Sbjct  121  DGRLLAVASSYTFEEGPKPHEKDAIYVRSVNEIEVKPKPKVYPNPA  166



>gb|EEE67502.1| hypothetical protein OsJ_24938 [Oryza sativa Japonica Group]
Length=323

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLR+MS+ EQ+RES L+YQTRCV+CYPNGTG+AL SVEGRVAMEF+D
Sbjct  133  LVVATAGRHVNVYDLRSMSRPEQQRESPLRYQTRCVQCYPNGTGFALGSVEGRVAMEFYD  192

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SE+   KKY+FKCHR  E G   VYPVNAI+FHP++GTFATGGCD +VN+WDG N+++L
Sbjct  193  QSESAPYKKYSFKCHRVPEDGETKVYPVNAISFHPVHGTFATGGCDRFVNLWDGANRRKL  252

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            +Q+ +YP+S+AALSFSRDGRLLAVA+SYT+EEGD PH PD IF+R VN
Sbjct  253  FQFPRYPSSIAALSFSRDGRLLAVASSYTYEEGDIPHPPDAIFIRDVN  300



>ref|NP_001175281.1| Os07g0588500 [Oryza sativa Japonica Group]
 dbj|BAC57743.1| putative mitotic checkpoint protein [Oryza sativa Japonica Group]
 dbj|BAH94009.1| Os07g0588500 [Oryza sativa Japonica Group]
Length=364

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLR+MS+ EQ+RES L+YQTRCV+CYPNGTG+AL SVEGRVAMEF+D
Sbjct  174  LVVATAGRHVNVYDLRSMSRPEQQRESPLRYQTRCVQCYPNGTGFALGSVEGRVAMEFYD  233

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SE+   KKY+FKCHR  E G   VYPVNAI+FHP++GTFATGGCD +VN+WDG N+++L
Sbjct  234  QSESAPYKKYSFKCHRVPEDGETKVYPVNAISFHPVHGTFATGGCDRFVNLWDGANRRKL  293

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            +Q+ +YP+S+AALSFSRDGRLLAVA+SYT+EEGD PH PD IF+R VN
Sbjct  294  FQFPRYPSSIAALSFSRDGRLLAVASSYTYEEGDIPHPPDAIFIRDVN  341



>ref|XP_003560020.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Brachypodium 
distachyon]
Length=357

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVNVYDLRNMS+ EQ+RES L++QTRCV CYPNGTG+AL SVEG++AMEFFD
Sbjct  172  LVVATAGRHVNVYDLRNMSEPEQQRESPLQHQTRCVECYPNGTGFALGSVEGKIAMEFFD  231

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SE+  SK Y FKCHR +E GR V YPVN   FHP++GTFATGGCDG+VNVWDG+ K+RL
Sbjct  232  QSESALSKSYVFKCHRLTEGGRRVAYPVNTSTFHPVFGTFATGGCDGFVNVWDGSWKRRL  291

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             QY +YP S+AALSF+RDG LLAVA+SYT+E G++PHEPD IF+R VN
Sbjct  292  IQYPRYPTSIAALSFNRDGSLLAVASSYTYEMGERPHEPDTIFIRDVN  339



>ref|XP_004989752.1| mitotic checkpoint protein BUB3 [Salpingoeca rosetta]
 gb|EGD78076.1| mitotic checkpoint protein BUB3 [Salpingoeca rosetta]
Length=323

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            ++V  AGRHV V++L NMS  EQRRESS+K+QTRC+R  P+  GY L+S+EGRVA+++ D
Sbjct  146  VIVGMAGRHVWVWNLNNMSAVEQRRESSVKFQTRCIRAMPDAQGYVLASIEGRVAVDYLD  205

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             SE+ Q +K+AFKCHR  E GRDV+YPVNA+AFHP +GTFATGGCDG VNVWDG N+KR+
Sbjct  206  PSESSQKRKFAFKCHRSKENGRDVIYPVNAVAFHPTFGTFATGGCDGLVNVWDGVNRKRV  265

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            YQ+ +YP S+A+LSF+ DG LLA+AASYT+EEGDKPH PD IF+R + 
Sbjct  266  YQFHEYPTSIASLSFNHDGSLLAIAASYTYEEGDKPHPPDAIFIRRIT  313



>gb|KHN42317.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=281

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 145/185 (78%), Gaps = 31/185 (17%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGRHVN+YDLRNMSQ EQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD
Sbjct  121  LVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  180

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
            LSEA Q+KK                           YGTFATGGCDGYVNVWDGNNKKRL
Sbjct  181  LSEASQAKK---------------------------YGTFATGGCDGYVNVWDGNNKKRL  213

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEE----GDKPHEPDVIFVRSVNevevkpkp  149
            YQYSKYP S+AALSFSRDGRLLAVA+SYTFEE    G K  E D I+VRSVNE+EVKPKP
Sbjct  214  YQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGPKAGTKADEQDAIYVRSVNEIEVKPKP  273

Query  148  kVLPN  134
            KV PN
Sbjct  274  KVYPN  278



>ref|XP_005842151.1| hypothetical protein GUITHDRAFT_62815 [Guillardia theta CCMP2712]
 gb|EKX55171.1| hypothetical protein GUITHDRAFT_62815 [Guillardia theta CCMP2712]
Length=329

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            +VV TA RHV +YD+RN+S+ EQ+ ESSLK+QTRC+RCYP+GTGYALSS+EGRVAME+FD
Sbjct  149  IVVGTASRHVWIYDVRNLSEPEQKAESSLKFQTRCIRCYPDGTGYALSSIEGRVAMEYFD  208

Query  496  LSEAGQSKKYAFKCHR-KSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKR  320
               A Q+KKYAFKCHR + E G D VYPVNA+AFHP YGTFATGGCDG V +WDG NKKR
Sbjct  209  PDAASQAKKYAFKCHRAQDEKGIDTVYPVNALAFHPTYGTFATGGCDGKVIMWDGQNKKR  268

Query  319  LYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            L     YP S+A+L+F+  G +LAVA+SYTFEEG+K   PD IF RSVN
Sbjct  269  LQAPWSYPTSIASLAFNPTGAMLAVASSYTFEEGEKDAPPDQIFFRSVN  317



>gb|ESA02941.1| hypothetical protein GLOINDRAFT_67599 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52975.1| Gle2p [Rhizophagus irregularis DAOM 197198w]
Length=332

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVATAGR   +YD+RNMS+  Q+RESSLK+ TRCV+C PN  GYA SS+EGRVA+EFFD
Sbjct  152  LVVATAGRQFFIYDIRNMSETIQKRESSLKFMTRCVKCMPNRQGYASSSIEGRVAVEFFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q++KYAFKCHRK   G D VYPVNA+AFHP +GTFA+GG DG VN+WDG NKKRL
Sbjct  212  PSPEAQARKYAFKCHRKVIDGVDTVYPVNALAFHPTHGTFASGGADGMVNIWDGFNKKRL  271

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             QY +YP S+A+L FSRDG+ LA+A+SYTFEEG+K H PD +F++ +N
Sbjct  272  RQYPQYPTSIASLDFSRDGQYLAIASSYTFEEGEKDHPPDSVFIKPIN  319



>ref|XP_005648737.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24193.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=334

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 142/170 (84%), Gaps = 2/170 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQ--XEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEF  503
            LVVAT+  H+ VYD+R +     EQ RESSL++QTRCVRCYP+GTG+A+SSVEGRVAME+
Sbjct  155  LVVATSSLHILVYDIRKLEAGLPEQERESSLRFQTRCVRCYPDGTGFAVSSVEGRVAMEY  214

Query  502  FDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKK  323
            FD SEAGQ++KYAFKCHR SEAG D V+PVN+IAFHP++GTFATGG DG VNVWDG NKK
Sbjct  215  FDQSEAGQTRKYAFKCHRSSEAGTDTVHPVNSIAFHPVHGTFATGGGDGTVNVWDGANKK  274

Query  322  RLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            RL Q   YP SV+A++FSR+G+ LAVA+SYT+E+G+K H  + I+VR ++
Sbjct  275  RLCQIQGYPTSVSAMAFSREGKYLAVASSYTWEQGEKEHPAEAIYVRHMS  324



>ref|XP_003291452.1| WD40 repeat-containing protein [Dictyostelium purpureum]
 gb|EGC32034.1| WD40 repeat-containing protein [Dictyostelium purpureum]
Length=334

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TA +++ ++D+R M    Q+RESS+KYQTRC+RC+ +G GYAL+SVEGR+AME+FD
Sbjct  154  LVVGTADKYITIFDIRKMDMPLQKRESSIKYQTRCIRCFTDGKGYALASVEGRIAMEYFD  213

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S A QSKKYAFKCHR +E G DVVYPVN IAF+PIYGTFATGGCD  V  WDG N+KRL
Sbjct  214  PSPAAQSKKYAFKCHRPNEGGVDVVYPVNCIAFNPIYGTFATGGCDKNVFFWDGANRKRL  273

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            +    YP S++++SF+ DG +LAVA+SYTFEEG+K H PD IF+  +N
Sbjct  274  HFLKTYPTSISSMSFNSDGNILAVASSYTFEEGEKDHPPDQIFIHHIN  321



>gb|KFH73401.1| cell cycle arrest protein BUB3 [Mortierella verticillata NRRL 
6337]
Length=343

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA AGRHV +YDLRNM +  QRRESSLKYQTR VRC  +G GYA SS+EGRVA+EFFD
Sbjct  153  LVVAMAGRHVFIYDLRNMKETLQRRESSLKYQTRMVRCMRDGLGYASSSIEGRVAVEFFD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q+KKYAFKCHR +  G + +YPVNA+A+HPI+GTFA+GG DG V +WDG NKKRL
Sbjct  213  PSAESQAKKYAFKCHRMTIDGTETIYPVNALAYHPIHGTFASGGSDGGVTLWDGFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             QY +YP SV++LS+S DG+ LAVA+SYT++EG+K H PD IF+RS++
Sbjct  273  RQYPRYPTSVSSLSWSCDGKTLAVASSYTYDEGEKDHAPDQIFLRSIS  320



>ref|XP_011401461.1| Mitotic checkpoint protein BUB3 [Auxenochlorella protothecoides]
 gb|KFM28446.1| Mitotic checkpoint protein BUB3 [Auxenochlorella protothecoides]
Length=339

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMS---QXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAME  506
            LVVATAGRH++V+DL  ++   + EQ RESSLK+QTRCVR YP+G+G+A +S+EGRVAME
Sbjct  156  LVVATAGRHIHVFDLTKLTNGVEPEQARESSLKHQTRCVRMYPDGSGFATASIEGRVAME  215

Query  505  FFDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNK  326
            +FDL +A Q+K+YAFKCHR SE GRDVV+PVN +AFH  +GTFATGGCDG V++WDG +K
Sbjct  216  YFDLGDA-QAKRYAFKCHRASEGGRDVVFPVNTLAFHQTHGTFATGGCDGVVSIWDGEHK  274

Query  325  KRLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
            KRL Q++ YP S+AAL+F+  G LLAVA+SYTFE+GD  H  D I++R V
Sbjct  275  KRLAQFTGYPTSIAALAFNLAGNLLAVASSYTFEKGDIEHPADSIYIRPV  324



>ref|XP_001635419.1| predicted protein [Nematostella vectensis]
 gb|EDO43356.1| predicted protein [Nematostella vectensis]
Length=326

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGR V V+DLRNM   +QRRESSLKYQTRC+RC+PN  GY LSS+EGRVA+E+FD
Sbjct  152  LVVGTAGRKVMVWDLRNMGYVQQRRESSLKYQTRCIRCFPNQQGYVLSSIEGRVAVEYFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KK+AFKCHR  +   + +YPVNAIAFH ++ TFATGG DG+VN+WDG NKKRL
Sbjct  212  PSPEVQKKKFAFKCHRTKDKEIEQIYPVNAIAFHNMHNTFATGGSDGFVNIWDGFNKKRL  271

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +EE +K H PD IF+R+V
Sbjct  272  CQFHRYPTSIASLAFSHDGSQLAIASSYMYEEDEKDHPPDAIFIRTV  318



>ref|XP_009067387.1| hypothetical protein LOTGIDRAFT_223691 [Lottia gigantea]
 gb|ESO81944.1| hypothetical protein LOTGIDRAFT_223691 [Lottia gigantea]
Length=327

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QR+ESSLKYQTRC+RC+PN  GY LSSVEGRVA+E+FD
Sbjct  151  LIVGTAGRRVLVWDLRNMGYVQQRKESSLKYQTRCIRCFPNKQGYVLSSVEGRVAVEYFD  210

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + +YPVNAIAFH  Y TFATGG DGYVN+WDG NKKRL
Sbjct  211  QSPEVQKKKYAFKCHRVKENGVESIYPVNAIAFHSQYNTFATGGSDGYVNIWDGFNKKRL  270

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEP-DVIFVRSVN  173
             Q+ KYP S+A+L+FS DG +LA+A+SY FE+G     P D IF+R+V+
Sbjct  271  CQFHKYPTSIASLAFSNDGSVLAIASSYMFEKGQLDETPEDEIFIRNVS  319



>dbj|GAM25293.1| hypothetical protein SAMD00019534_084680 [Acytostelium subglobosum 
LB1]
Length=326

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TA + + ++D RNMSQ  Q+RESS+K+QTRC+R + +GTGYAL+SVEGRV ME+FD
Sbjct  149  LVVGTADKMITIFDTRNMSQPVQKRESSIKFQTRCIRTFIDGTGYALASVEGRVGMEYFD  208

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
              E   +KKYAFKCHR +E G DVVYPVN + FHPIYGTFATGGCDG V  WDG N+KRL
Sbjct  209  PQEQA-AKKYAFKCHRANEGGVDVVYPVNVMTFHPIYGTFATGGCDGNVYYWDGQNRKRL  267

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            +    YP S++A+SFS DG  LAVA+SYT+EEG+K H  D IF+ +VN
Sbjct  268  FHLKHYPTSISAMSFSSDGTQLAVASSYTYEEGEKDHPNDQIFIHTVN  315



>gb|EFA83564.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=324

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TA + + ++D R M Q  Q+RESS+K+QTRC+R + +G+GYAL+SVEGR+ ME+FD
Sbjct  150  LVVGTADKMITIFDTRQMQQPVQKRESSIKFQTRCIRTFIDGSGYALASVEGRIGMEYFD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
              E  Q+KKYAFKCHR +EAG DVVYPVN IAFHPIYGTFATGGCDG V  WDG N+KRL
Sbjct  210  PKEQ-QAKKYAFKCHRANEAGVDVVYPVNTIAFHPIYGTFATGGCDGNVYYWDGQNRKRL  268

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            +    YP S++AL+F+ +G LLAVA+SYT+EEG+K H  D IF+ +VN
Sbjct  269  FHLKHYPTSISALAFNSEGNLLAVASSYTYEEGEKDHPNDQIFIHTVN  316



>ref|XP_629851.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54DM1.1|BUB3_DICDI RecName: Full=Mitotic checkpoint protein bub3 [Dictyostelium 
discoideum]
 gb|EAL61423.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=331

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LV+ TA ++V +YD R M    Q+RESS+KYQTRC+R + +G GYAL+SVEGR+AME+FD
Sbjct  155  LVIGTADKYVTIYDTRQMETHLQKRESSIKYQTRCIRTFTDGKGYALASVEGRIAMEYFD  214

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S A QSKKYAFKCHR +E+G DVVYPVN IAF+P YGTFATGGCD  V  WDG N+KRL
Sbjct  215  PSPAVQSKKYAFKCHRLTESGVDVVYPVNCIAFNPHYGTFATGGCDKNVFFWDGANRKRL  274

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
            +    YP S++++SF+ DG +LAVA+SYTFEEG+K H PD IF+ ++
Sbjct  275  HALKTYPTSISSMSFNTDGNILAVASSYTFEEGEKDHPPDQIFIHNI  321



>ref|XP_780636.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform 1 [Strongylocentrotus 
purpuratus]
Length=326

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PNG GY LSS+EGRVA+E+ D
Sbjct  151  LVVGTAGRKVLVWDLRNMGYVQQRRESSLKYQTRCIRSFPNGQGYVLSSIEGRVAVEYLD  210

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR    G + +YPVNAIAFH  + TFA+GGCDG+VN+WDG NKKRL
Sbjct  211  PSPEVQKKKYAFKCHRLKNDGVEQIYPVNAIAFHNRHNTFASGGCDGFVNIWDGFNKKRL  270

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+  YP S+++L+FS DG +LA+A+SYT+EEGD  H  D +F+R V+
Sbjct  271  CQFHCYPTSISSLAFSNDGSILAIASSYTYEEGDIEHPEDAVFIRKVS  318



>ref|XP_004561256.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Maylandia 
zebra]
 ref|XP_005471455.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005919597.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_006791133.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Neolamprologus 
brichardi]
Length=326

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY FE+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMFEKGDISHPEDAIFIRQVT  317



>ref|XP_005736525.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Pundamilia 
nyererei]
Length=326

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY FE+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMFEKGDISHPEDAIFIRQVT  317



>ref|XP_005736526.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Pundamilia 
nyererei]
Length=324

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY FE+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMFEKGDISHPEDAIFIRQVT  317



>ref|XP_003441831.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_004561257.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Maylandia 
zebra]
 ref|XP_005919598.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006791134.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Neolamprologus 
brichardi]
Length=324

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY FE+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMFEKGDISHPEDAIFIRQVT  317



>ref|XP_007570331.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Poecilia 
formosa]
 ref|XP_008435373.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Poecilia 
reticulata]
Length=324

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+FS DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFSNDGTMLAIASSYMHEKGDISHPEDAIFIRQVT  317



>ref|XP_007570323.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Poecilia 
formosa]
 ref|XP_008435372.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Poecilia 
reticulata]
Length=326

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+FS DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFSNDGTMLAIASSYMHEKGDISHPEDAIFIRQVT  317



>ref|XP_005794721.1| PREDICTED: mitotic checkpoint protein BUB3-like [Xiphophorus 
maculatus]
Length=324

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEEGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+FS DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFSNDGTMLAIASSYMHEKGDISHPEDAIFIRQVT  317



>ref|XP_011486560.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Oryzias 
latipes]
Length=324

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+FS DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFSNDGTMLAIASSYMQEKGDISHPEDAIFIRQVT  317



>ref|XP_004080489.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Oryzias 
latipes]
Length=326

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+FS DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFSNDGTMLAIASSYMQEKGDISHPEDAIFIRQVT  317



>ref|XP_003961201.1| PREDICTED: mitotic checkpoint protein BUB3-like [Takifugu rubripes]
Length=324

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMQEKGDISHPEDAIFIRQVT  317



>ref|XP_008312803.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Cynoglossus 
semilaevis]
Length=324

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMQEKGDISHPEDAIFIRQVT  317



>ref|XP_010738643.1| PREDICTED: mitotic checkpoint protein BUB3 [Larimichthys crocea]
Length=326

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+F+ DG +LA+A+SY  E+GD  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIASSYMHEKGDISHPEDAIFIRQV  316



>ref|XP_008312802.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Cynoglossus 
semilaevis]
Length=328

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+F+ DG +LA+AASY  E+GD  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMQEKGDISHPEDAIFIRQV  316



>ref|NP_991272.1| mitotic checkpoint protein BUB3 [Danio rerio]
 gb|AAQ91223.1| BUB3 budding uninhibited by benzimidazoles 3-like protein [Danio 
rerio]
Length=326

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP+S+A+LSFS DG LLA+A+SY  E GD  H  D +F+R V 
Sbjct  270  CQFHRYPSSIASLSFSTDGSLLAIASSYMQELGDVSHPADAVFIRQVT  317



>gb|KGB40918.1| Mitotic checkpoint protein BUB3 [Schistosoma haematobium]
Length=261

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGRHV ++DLR M    ++RESSL+YQTRC++C+PNG GY L S+EGR+A+E FD
Sbjct  60   LVVGTAGRHVLIWDLRQMHAPLEQRESSLRYQTRCIQCFPNGQGYILGSIEGRIAVEMFD  119

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E  ++ +YPV AIAFH  Y TFATGGCDG VN+WDG N+KRL
Sbjct  120  PSPEVQKKKYAFKCHRVKEGDKETIYPVIAIAFHQGYNTFATGGCDGIVNIWDGFNRKRL  179

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD-VIFVRSV  176
             Q SKYP S+++L+FS DG LLA+A+SY +E G   +EP+  I++RSV
Sbjct  180  AQLSKYPTSISSLAFSEDGNLLAIASSYMYERGPIENEPEPTIYIRSV  227



>ref|XP_008312801.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Cynoglossus 
semilaevis]
Length=329

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+F+ DG +LA+AASY  E+GD  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMQEKGDISHPEDAIFIRQV  316



>ref|XP_008288658.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Stegastes 
partitus]
Length=326

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIASSYMHEKGDIGHPEDAIFIRQVT  317



>ref|XP_005169562.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Danio 
rerio]
Length=338

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  162  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  221

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  222  PSLEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  281

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP+S+A+LSFS DG LLA+A+SY  E GD  H  D +F+R V 
Sbjct  282  CQFHRYPSSIASLSFSTDGSLLAIASSYMQELGDVSHPADAVFIRQVT  329



>ref|XP_008288659.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Stegastes 
partitus]
Length=324

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKEDGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+A+SY  E+GD  H  D IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIASSYMHEKGDIGHPEDAIFIRQVT  317



>emb|CDS14344.1| hypothetical protein LRAMOSA06514 [Absidia idahoensis var. thermophila]
Length=332

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R ++VYD+RNM + EQ RESSL+Y  +CVRC P+G GYA SS+EGRVA+E+FD
Sbjct  152  LVVAMANRQIHVYDIRNMDKPEQERESSLRYMLKCVRCMPDGQGYACSSIEGRVALEYFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             +EA QSKKYAFK HR+     +VVYPVNA+AFHPIYGTFA+GG D  V++WDG N+KR+
Sbjct  212  -AEA-QSKKYAFKSHRQVINDTEVVYPVNALAFHPIYGTFASGGSDCVVSIWDGVNRKRI  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP  +++LSFS DG++LAVA+SYTF+EG++ H PD IF++ +
Sbjct  270  KQFPRYPDEISSLSFSHDGKMLAVASSYTFDEGERDHSPDAIFIKHI  316



>gb|ACO09248.1| Mitotic checkpoint protein BUB3 [Osmerus mordax]
Length=324

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            ++V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  VIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY  E+GD  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGSTLAIASSYMQEQGDISHPEDAIFIRQV  316



>ref|XP_010779383.1| PREDICTED: mitotic checkpoint protein BUB3 [Notothenia coriiceps]
Length=324

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM    QRRESSLKYQTRC+R +PN  GYALSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVLQRRESSLKYQTRCIRAFPNKQGYALSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEIQKKKYAFKCHRLKEEGIEQVYPVNAISFHSIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+A+L+F+ DG +LA+AASY  E GD  H  + IF+R V 
Sbjct  270  CQFHRYPTSIASLAFNNDGTMLAIAASYMHERGDISHPENTIFIRQVT  317



>emb|CAX73050.1| budding uninhibited by benzimidazoles 3 homolog [Schistosoma 
japonicum]
Length=207

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGRHV ++DLR M    ++RESSL+YQTRC++C+PNG GY L S+EGR+A+E FD
Sbjct  8    LVVGTAGRHVLIWDLRQMHAPVEQRESSLRYQTRCIQCFPNGQGYILGSIEGRIAVEMFD  67

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             +   Q KKYAFKCHR  +  ++ +YPV AIAFH  Y TFATGGCDG VN+WDG N+KRL
Sbjct  68   PNPEVQKKKYAFKCHRVKDGDKETIYPVIAIAFHQGYNTFATGGCDGIVNIWDGFNRKRL  127

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD-VIFVRSV  176
             Q SKYP S+++L+FS DG +LA+A+SY +E G   +EP+  I++RSV
Sbjct  128  AQLSKYPTSISSLAFSEDGNMLAIASSYMYERGPIENEPEPTIYIRSV  175



>ref|XP_002608311.1| hypothetical protein BRAFLDRAFT_125481 [Branchiostoma floridae]
 gb|EEN64321.1| hypothetical protein BRAFLDRAFT_125481 [Branchiostoma floridae]
Length=334

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  154  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  213

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + +YPVNAIAFH ++ TFATGG DG+VN+WDG +KKRL
Sbjct  214  PSPEVQKKKYAFKCHRIKEDGIEKIYPVNAIAFHSMHNTFATGGSDGFVNIWDGFHKKRL  273

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG +LA+A+SY +EE D  H  D I++R+V
Sbjct  274  CQFHRYPTSIASLAFSHDGSVLAIASSYMYEELDVEHPEDAIYIRNV  320



>gb|AAH83205.1| Bub3 protein [Danio rerio]
Length=326

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G +  YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENGIEQAYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP+S+A+LSFS DG LLA+A+SY  E GD  H  D +F+R V 
Sbjct  270  CQFHRYPSSIASLSFSTDGSLLAIASSYMQELGDVSHPADAVFIRQVT  317



>gb|ADD24391.1| Mitotic checkpoint protein BUB3 [Lepeophtheirus salmonis]
Length=340

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 133/171 (78%), Gaps = 4/171 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LV+AT GR V V+D+RNMS  +Q+RESSLKYQTR + C+PN +GY LSS+EGRVA+E+ D
Sbjct  164  LVIATLGRKVWVWDIRNMSYVQQKRESSLKYQTRALGCFPNKSGYVLSSIEGRVAVEYLD  223

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G +V+YPVN IAFH  Y TFATGG DG VN+WDG+NKKRL
Sbjct  224  PSTDIQKKKYAFKCHRSKENGIEVIYPVNTIAFHKEYNTFATGGSDGLVNIWDGHNKKRL  283

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEG---DKPHEPDVIFVRSVN  173
             Q+ KYP S+A+L+FS DGR+LA+A+SY +EEG   D P E D I++R V+
Sbjct  284  CQFHKYPTSIASLTFSNDGRVLAIASSYMYEEGKPLDTPIE-DSIYIRHVS  333



>ref|XP_009167510.1| hypothetical protein T265_04491 [Opisthorchis viverrini]
 gb|KER28698.1| hypothetical protein T265_04491 [Opisthorchis viverrini]
Length=362

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGRHV ++DLR M    ++RESSL+YQTRC+RC+PNG GY L S+EGR+A+E FD
Sbjct  168  LVVGTAGRHVLIWDLRQMHAPVEQRESSLRYQTRCIRCFPNGQGYILGSIEGRIAVEMFD  227

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   +++YPV AIAFH  Y TFATGGCDG VN+WDG N+KRL
Sbjct  228  PSPEAQKKKYAFKCHRVKEENMEIIYPVTAIAFHQGYNTFATGGCDGIVNIWDGFNRKRL  287

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD-VIFVRSV  176
             Q +KYP S+++L+FS DG  LA+A+SY +E G    EP+  I+VRSV
Sbjct  288  AQLAKYPTSISSLAFSEDGHQLAIASSYMYERGQIEDEPEPTIYVRSV  335



>ref|XP_006507334.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Mus musculus]
Length=216

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  40   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  99

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  100  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  159

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  160  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  206



>emb|CBN81549.1| Mitotic checkpoint protein BUB3 [Dicentrarchus labrax]
Length=324

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEFQKKKYAFKCHRLKEDGIEHVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+F+ DG LLA+A+SY  E GD  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFNNDGTLLAIASSYMHEMGDINHPEDAIFIRQV  316



>dbj|GAA55215.1| cell cycle arrest protein BUB3 [Clonorchis sinensis]
Length=362

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGRHV ++DLR M    ++RESSL+YQTRC+RC+PNG GY L S+EGR+A+E FD
Sbjct  168  LVVGTAGRHVLIWDLRQMHAPVEQRESSLRYQTRCIRCFPNGQGYILGSIEGRIAVEMFD  227

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   +++YPV AIAFH  Y TFATGGCDG VN+WDG N+KRL
Sbjct  228  PSPEAQKKKYAFKCHRVKEENMEIIYPVTAIAFHQGYNTFATGGCDGIVNIWDGFNRKRL  287

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD-VIFVRSV  176
             Q +KYP S+++L+FS DG  LA+A+SY +E G    EP+  I+VRSV
Sbjct  288  AQLAKYPTSISSLAFSEDGHQLAIASSYMYERGQIEDEPEPTIYVRSV  335



>ref|XP_005851317.1| hypothetical protein CHLNCDRAFT_33942 [Chlorella variabilis]
 gb|EFN59215.1| hypothetical protein CHLNCDRAFT_33942 [Chlorella variabilis]
Length=352

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 138/187 (74%), Gaps = 20/187 (11%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMS--QXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEF  503
            LVVA +GRHV+++DLR +   Q EQRRESSLK+QTRCVRC  +G GYALSSVEGRVA EF
Sbjct  151  LVVAMSGRHVDIFDLRALQSGQPEQRRESSLKFQTRCVRCQADGRGYALSSVEGRVAWEF  210

Query  502  FDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGG----------C---  362
            FDL EA Q++KYAFKCHRK+E G+D+V+PVNAIAF+  +GTFATGG          C   
Sbjct  211  FDLDEATQARKYAFKCHRKNEGGKDLVFPVNAIAFNRPHGTFATGGKPQQQAPIPACRGS  270

Query  361  -----DGYVNVWDGNNKKRLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD  197
                 DG +N WDG +KKRL+Q + YP SVAAL+F+     LAVA+SYTFE+G++ H  D
Sbjct  271  AQQCGDGVINFWDGEHKKRLHQVAGYPTSVAALAFNGAATKLAVASSYTFEQGEREHPAD  330

Query  196  VIFVRSV  176
             IFVR V
Sbjct  331  AIFVRDV  337



>ref|XP_002957572.1| hypothetical protein VOLCADRAFT_102432 [Volvox carteri f. nagariensis]
 gb|EFJ41342.1| hypothetical protein VOLCADRAFT_102432 [Volvox carteri f. nagariensis]
Length=342

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 136/174 (78%), Gaps = 7/174 (4%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMS------QXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV  515
            LVV T+GRHV +YD+R ++        EQ RESSLK+QTR +  Y +G GYAL SVEGRV
Sbjct  155  LVVGTSGRHVLIYDIRRLAGGQGPEALEQHRESSLKFQTRSLAVYTDGRGYALGSVEGRV  214

Query  514  AMEFFDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDG  335
            AMEFFD ++A Q+ KYAFKCHR++E G+D VYPV++IAFH  YGTFATGG DG + +WDG
Sbjct  215  AMEFFDAADA-QANKYAFKCHRRNEGGKDTVYPVHSIAFHSGYGTFATGGGDGVICIWDG  273

Query  334  NNKKRLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             NKKRL+Q ++YP SVA++SFSR G +LAVAASY +E+G++ H PD I++R+V 
Sbjct  274  ENKKRLFQTARYPTSVASMSFSRTGEMLAVAASYAYEQGERDHPPDAIYLRAVQ  327



>emb|CDH56797.1| mitotic checkpoint protein bub3 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=332

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R ++VYD+RNM++ EQ+R SSL+Y  +CVRC P+G GYA SS+EGRVA+E+FD
Sbjct  152  LVVAMANREIHVYDIRNMNEPEQQRMSSLRYMLKCVRCMPDGQGYACSSIEGRVALEYFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             +EA QSKKYAFK HR+     +VVYPVNA+AFHPIYGTFA+GG D  V++WDG N+KR+
Sbjct  212  -AEA-QSKKYAFKSHRQVINDTEVVYPVNALAFHPIYGTFASGGSDCVVSIWDGVNRKRI  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP  +++LSFS DG++LAVA+SYTF+EG++ H PD IF++ +
Sbjct  270  KQFQRYPDEISSLSFSPDGKMLAVASSYTFDEGERDHSPDAIFIKHI  316



>gb|EMP42210.1| Mitotic checkpoint protein BUB3 [Chelonia mydas]
Length=244

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIAASYMYEMDDIEHPEDGIFIRQV  236



>emb|CDH56796.1| mitotic checkpoint protein bub3 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=332

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R ++VYD+RNM++ EQ+R SSL+Y  +CVRC P+G GYA SS+EGRVA+E+FD
Sbjct  152  LVVAMANREIHVYDIRNMNEPEQQRMSSLRYMLKCVRCMPDGQGYACSSIEGRVALEYFD  211

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             +EA QSKKYAFK HR+     +VVYPVNA+AFHPIYGTFA+GG D  V++WDG N+KR+
Sbjct  212  -AEA-QSKKYAFKSHRQVINDTEVVYPVNALAFHPIYGTFASGGSDCVVSIWDGVNRKRI  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP  +++LSFS DG++LAVA+SYTF+EG++ H PD IF++ +
Sbjct  270  KQFQRYPDEISSLSFSPDGKMLAVASSYTFDEGERDHSPDAIFIKHI  316



>ref|XP_005637878.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Canis 
lupus familiaris]
Length=246

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>gb|ELU09330.1| hypothetical protein CAPTEDRAFT_21337 [Capitella teleta]
Length=328

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LS++EGRVA+E+ D
Sbjct  153  LLVGTAGRKVLVWDLRNMGFVQQRRESSLKYQTRCIRAFPNKQGYVLSAIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + +YPVNAIAFH  Y TFATGG DGYVN+WDG NKKRL
Sbjct  213  PSAEVQKKKYAFKCHRIKEDGVEKIYPVNAIAFHSQYNTFATGGSDGYVNIWDGFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHE-PDVIFVRSVN  173
             Q  +YP+S+AALSFS DG++LA+A+SY +E+ +  +  PD I++R V+
Sbjct  273  CQLHRYPSSIAALSFSHDGQMLAIASSYMYEQDEMANTPPDTIYIRRVS  321



>gb|EPY78224.1| budding uninhibited by benzimidazoles 3-like protein [Camelus 
ferus]
Length=262

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  88   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  147

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  148  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  207

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  208  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  254



>ref|XP_004617862.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Sorex 
araneus]
Length=246

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSSDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_852616.1| PREDICTED: mitotic checkpoint protein BUB3 isoformX3 [Canis lupus 
familiaris]
 dbj|BAG56787.1| unnamed protein product [Homo sapiens]
Length=248

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_006630480.1| PREDICTED: mitotic checkpoint protein BUB3-like [Lepisosteus 
oculatus]
Length=324

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             Q+ +YP S+++L+FS DG  LA+A+SY  E+GD  H  D +++R V 
Sbjct  270  CQFHRYPTSISSLAFSNDGTTLAIASSYMHEQGDIEHPEDAVYIRQVT  317



>emb|CBN75238.1| WD-40 repeat family protein / mitotic checkpoint protein, putative 
[Ectocarpus siliculosus]
Length=290

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = -3

Query  673  VVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDL  494
            VV T+ RH+ VYD+R++++ EQRR SSLKYQTRCVR +P+  GYA+ SVEGRVA+E+FD 
Sbjct  118  VVGTSNRHIWVYDMRSLAEPEQRRVSSLKYQTRCVRIFPDQKGYAVGSVEGRVAVEYFDT  177

Query  493  SEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRLY  314
            S+  Q  KYAFKCHRK     D V+PVNA+AFHP+YGTFA+GGCD  VN+WDG NKKRL+
Sbjct  178  SKESQDNKYAFKCHRKG----DQVFPVNAMAFHPVYGTFASGGCDKMVNIWDGKNKKRLW  233

Query  313  QYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
            Q S Y   +++LSF+ DG  LA+A+SYTFE+G   H  D IFVR V
Sbjct  234  QSSAYNTGISSLSFNHDGTRLAIASSYTFEQGAIAHPKDQIFVRDV  279



>ref|XP_006755006.1| PREDICTED: mitotic checkpoint protein BUB3 [Myotis davidii]
Length=246

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_011433685.1| PREDICTED: mitotic checkpoint protein BUB3-like [Crassostrea 
gigas]
 gb|EKC21138.1| Mitotic checkpoint protein BUB3 [Crassostrea gigas]
Length=326

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGR + V+DLRNM   +QRRESSLKYQTRC+RC+PN  GY LSS+EGRVA+E+ D
Sbjct  150  LVVGTAGRRILVWDLRNMGYVQQRRESSLKYQTRCIRCFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q +KYAFKCHR  E G + +YPVNAIAFH  + TFA+GG DG+VN+WDG NKKRL
Sbjct  210  PSPEVQKRKYAFKCHRIKENGVEKIYPVNAIAFHTHHNTFASGGSDGFVNIWDGFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEP--DVIFVRSVN  173
             Q+ +YPA +A+L+FS DG +LA+A+SY + E D+P EP  DVI++R+V+
Sbjct  270  CQFHRYPAGIASLAFSPDGAVLAIASSYMY-ENDEPIEPVEDVIYIRNVS  318



>emb|CCD81559.1| putative mitotic checkpoint protein bub3 [Schistosoma mansoni]
Length=367

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TAGRHV ++DLR M    ++RESSL+YQTRC++C+PNG GY L S+EGR+A+E FD
Sbjct  167  LVVGTAGRHVLIWDLRQMHAPLEQRESSLRYQTRCIQCFPNGQGYILGSIEGRIAVEMFD  226

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E  ++ +YPV AIAFH  Y TFATGGCDG VN+WDG N+KRL
Sbjct  227  PSPEVQKKKYAFKCHRVKEGDKETIYPVIAIAFHQGYNTFATGGCDGIVNIWDGFNRKRL  286

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPD-VIFVRSV  176
             Q SKYP S+++L+FS DG LLA+A+SY +E G    EP+  I++RSV
Sbjct  287  AQLSKYPTSISSLAFSEDGNLLAIASSYMYERGPIETEPEPTIYIRSV  334



>ref|XP_004617861.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Sorex 
araneus]
Length=248

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSSDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_009872370.1| PREDICTED: mitotic checkpoint protein BUB3, partial [Apaloderma 
vittatum]
Length=185

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  11   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  70

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  71   PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  130

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  131  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  177



>gb|KFP78208.1| Mitotic checkpoint protein BUB3, partial [Apaloderma vittatum]
Length=185

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  12   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  71

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  72   PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  131

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  132  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  178



>ref|XP_010867226.1| PREDICTED: mitotic checkpoint protein BUB3 [Esox lucius]
Length=324

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTR +R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRAIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSQEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY  E+GD  H  D +F+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGSTLAIASSYMQEQGDINHPEDAVFIRQV  316



>gb|EWC47909.1| hypothetical protein DRE_02791 [Drechslerella stenobrocha 248]
Length=332

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 130/169 (77%), Gaps = 2/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R +++YDLRNM++  QRRESSLK+ TR VRC PNG GYA SS+EGRVA+EFFD
Sbjct  153  LVVAMASRSIHIYDLRNMAEPFQRRESSLKFMTRTVRCMPNGEGYASSSIEGRVAVEFFD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  QS+KYAFKCHR+ E   DVVYPVNA+AFHP YGTFA+GG DG V +WDG  K+RL
Sbjct  213  PSKESQSRKYAFKCHRQPEGDIDVVYPVNALAFHPTYGTFASGGGDGVVALWDGVAKRRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDK--PHEPDVIFVRSV  176
             QY KYPAS+AA+ FS DG+ LA+A+   FE+G +  P   + +FVR +
Sbjct  273  RQYQKYPASIAAMGFSSDGKYLAIASCNGFEDGKESVPSPDNKLFVREM  321



>ref|XP_004680435.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Condylura 
cristata]
Length=279

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_002409045.1| mRNA export protein, putative [Ixodes scapularis]
 gb|EEC02259.1| mRNA export protein, putative [Ixodes scapularis]
Length=339

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TA R V V+DLRNM   +QRR+S+LKYQTRC+RC+PN  G+ LSS+EGRVA+E+ D
Sbjct  163  LVVGTALRKVLVWDLRNMGYVKQRRDSNLKYQTRCIRCFPNQQGFVLSSIEGRVAVEYLD  222

Query  496  LSEAGQSKKYAFKCHR-KSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKR  320
             S   Q KKYAFKCHR K  AG +++YPVNAIAFH +Y TFATGG DG+VN+WDG NKKR
Sbjct  223  PSAEVQKKKYAFKCHRTKDSAGIELIYPVNAIAFHNLYNTFATGGSDGHVNIWDGFNKKR  282

Query  319  LYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGD-KPHEPDVIFVRSVN  173
            L Q+ KYP+S+AAL+FS DG LLA+ +S+ +EE D +   PD IFVR V 
Sbjct  283  LCQFHKYPSSIAALAFSHDGSLLAIGSSFLYEEDDVEVIPPDAIFVRRVT  332



>ref|XP_006008249.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Latimeria 
chalumnae]
Length=359

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  185  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  244

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  245  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  304

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E GD  H  D I++R V
Sbjct  305  CQFHRYPTSIASLAFSNDGSTLAIASSYMYEMGDIQHPEDAIYIRQV  351



>ref|XP_006008248.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Latimeria 
chalumnae]
Length=361

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  185  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  244

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  245  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  304

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E GD  H  D I++R V
Sbjct  305  CQFHRYPTSIASLAFSNDGSTLAIASSYMYEMGDIQHPEDAIYIRQV  351



>gb|ACO12446.1| Mitotic checkpoint protein BUB3 [Lepeophtheirus salmonis]
Length=340

 Score =   221 bits (563),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LV+AT GR V V+D+RNMS  +Q+RESSLKYQTR + C+PN +GY LSS+EGRVA+ + D
Sbjct  164  LVIATLGRKVWVWDIRNMSYVQQKRESSLKYQTRALGCFPNKSGYVLSSIEGRVAVGYLD  223

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G +V+YPVN IAFH  Y TFATGG DG VN+WDG+NKKRL
Sbjct  224  PSTDIQKKKYAFKCHRSKENGIEVIYPVNTIAFHKEYNTFATGGSDGLVNIWDGHNKKRL  283

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEG---DKPHEPDVIFVRSVN  173
             Q+ KYP S+A+L+FS DGR+LA+A+SY +EEG   D P E D I++R V+
Sbjct  284  CQFHKYPTSIASLTFSNDGRVLAIASSYMYEEGKPLDTPIE-DSIYIRHVS  333



>ref|XP_005154550.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Melopsittacus 
undulatus]
Length=216

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  40   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  99

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  100  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  159

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  160  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  206



>ref|XP_007053122.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3 
[Chelonia mydas]
Length=327

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D IF+R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIAASYMYEMDDIEHPEDGIFIRQV  319



>ref|XP_004350568.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG13860.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=342

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVV TA + V ++D R M    Q+RESS+KYQTRC+R + +G+GYAL+SVEGR+ ME+FD
Sbjct  165  LVVGTADKMVTIFDTRQMDTPFQKRESSIKYQTRCIRTFIDGSGYALASVEGRIGMEYFD  224

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
              +  Q+KKYAFKCHR +E   DVVYPVN+IAFHPIYGTFATGGCDG V  WDG N+KRL
Sbjct  225  -PKVQQAKKYAFKCHRATENSVDVVYPVNSIAFHPIYGTFATGGCDGNVYFWDGQNRKRL  283

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
            Y    YP S++ ++F+ DG  LAVA+SYT+EEG+K H  D I++  VN
Sbjct  284  YHLRHYPTSISTMAFNSDGTQLAVASSYTYEEGEKDHPNDQIYIHVVN  331



>ref|XP_006080476.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Bubalus 
bubalis]
Length=325

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>gb|EPQ16815.1| Mitotic checkpoint protein BUB3 [Myotis brandtii]
Length=317

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  143  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  202

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  203  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  262

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  263  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  309



>ref|XP_007260981.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Astyanax 
mexicanus]
Length=324

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +Y  S+A+L+FS DG L+A+A+SY  E+GD  H  D I++R V
Sbjct  270  CQFHRYSTSIASLAFSNDGSLVAIASSYMQEQGDISHPADAIYIRQV  316



>ref|XP_010633595.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Fukomys 
damarensis]
Length=330

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>gb|EAW49287.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_c [Homo sapiens]
 dbj|BAG72965.1| BUB3 budding uninhibited by benzimidazoles 3 homolog [synthetic 
construct]
 gb|EFB13014.1| hypothetical protein PANDA_017056 [Ailuropoda melanoleuca]
 gb|EGW10504.1| Mitotic checkpoint protein BUB3 [Cricetulus griseus]
 gb|EHA97530.1| Mitotic checkpoint protein BUB3 [Heterocephalus glaber]
 gb|ELR56861.1| Mitotic checkpoint protein BUB3 [Bos mutus]
Length=324

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_007260980.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Astyanax 
mexicanus]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E G + VYPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENGIEQVYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +Y  S+A+L+FS DG L+A+A+SY  E+GD  H  D I++R V
Sbjct  270  CQFHRYSTSIASLAFSNDGSLVAIASSYMQEQGDISHPADAIYIRQV  316



>ref|XP_002756721.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Callithrix 
jacchus]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004374979.1| PREDICTED: mitotic checkpoint protein BUB3 [Trichechus manatus 
latirostris]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_003755337.1| PREDICTED: mitotic checkpoint protein BUB3 [Sarcophilus harrisii]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_010597524.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3 
[Loxodonta africana]
Length=324

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_005602229.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Equus 
caballus]
 ref|XP_008536070.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Equus 
przewalskii]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004625654.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Octodon 
degus]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|NP_033904.2| mitotic checkpoint protein BUB3 [Mus musculus]
 ref|NP_001007794.1| mitotic checkpoint protein BUB3 isoform b [Homo sapiens]
 ref|NP_001069645.1| mitotic checkpoint protein BUB3 [Bos taurus]
 ref|NP_001041371.2| mitotic checkpoint protein BUB3 [Rattus norvegicus]
 ref|XP_001161122.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pan troglodytes]
 ref|XP_001928080.1| PREDICTED: mitotic checkpoint protein BUB3 isoformX2 [Sus scrofa]
 ref|XP_002927295.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Ailuropoda 
melanoleuca]
 ref|XP_003255109.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Nomascus 
leucogenys]
 ref|XP_003794128.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Otolemur 
garnettii]
 ref|XP_003816353.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pan paniscus]
 ref|XP_003904415.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Papio 
anubis]
 ref|XP_004050280.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004265787.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Orcinus 
orca]
 ref|XP_004416457.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004474647.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 4 [Dasypus 
novemcinctus]
 ref|XP_004680434.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Condylura 
cristata]
 ref|XP_004804683.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Mustela 
putorius furo]
 ref|XP_004876154.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004838822.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Heterocephalus 
glaber]
 ref|XP_003479869.2| PREDICTED: mitotic checkpoint protein BUB3 [Cavia porcellus]
 ref|XP_005088067.1| PREDICTED: mitotic checkpoint protein BUB3-like [Mesocricetus 
auratus]
 ref|XP_005402018.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005566729.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Macaca 
fascicularis]
 ref|XP_005602228.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Equus 
caballus]
 ref|XP_005698640.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Capra 
hircus]
 ref|XP_005895143.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bos mutus]
 ref|XP_005985537.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_006188784.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Camelus 
ferus]
 ref|XP_006207486.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Vicugna 
pacos]
 ref|XP_006507333.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Mus musculus]
 ref|XP_006912937.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pteropus 
alecto]
 ref|XP_006912938.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pteropus 
alecto]
 ref|XP_006977022.1| PREDICTED: mitotic checkpoint protein BUB3 [Peromyscus maniculatus 
bairdii]
 ref|XP_007073841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Panthera 
tigris altaica]
 ref|XP_007114002.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Physeter 
catodon]
 ref|XP_006080475.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Bubalus 
bubalis]
 ref|XP_007173322.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007451170.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Lipotes 
vexillifer]
 ref|XP_003510583.2| PREDICTED: mitotic checkpoint protein BUB3 [Cricetulus griseus]
 ref|XP_007628780.1| PREDICTED: mitotic checkpoint protein BUB3 [Cricetulus griseus]
 ref|XP_008068778.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Tarsius 
syrichta]
 ref|XP_008536069.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Equus 
przewalskii]
 ref|XP_008577755.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008683647.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Ursus 
maritimus]
 ref|XP_009244152.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pongo 
abelii]
 ref|XP_010355771.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Rhinopithecus 
roxellana]
 ref|XP_010633613.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Fukomys 
damarensis]
 ref|XP_010857477.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bison 
bison bison]
 ref|XP_010951235.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus bactrianus]
 ref|XP_010951242.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus bactrianus]
 ref|XP_010974334.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus dromedarius]
 ref|XP_010974335.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus dromedarius]
 ref|XP_011285906.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Felis 
catus]
 ref|XP_011363753.1| PREDICTED: mitotic checkpoint protein BUB3 [Pteropus vampyrus]
 ref|XP_011363754.1| PREDICTED: mitotic checkpoint protein BUB3 [Pteropus vampyrus]
 sp|Q1JQB2.1|BUB3_BOVIN RecName: Full=Mitotic checkpoint protein BUB3 [Bos taurus]
 sp|Q9WVA3.2|BUB3_MOUSE RecName: Full=Mitotic checkpoint protein BUB3; AltName: Full=WD 
repeat type I transmembrane protein A72.5 [Mus musculus]
 gb|AAC28439.1| testis mitotic checkpoint BUB3 [Homo sapiens]
 gb|AAH25089.1| Budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae) 
[Mus musculus]
 dbj|BAC40409.1| unnamed protein product [Mus musculus]
 gb|AAH99199.1| Budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae) 
[Rattus norvegicus]
 gb|AAI16091.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Bos 
taurus]
 gb|EAW49284.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_a [Homo sapiens]
 gb|ABQ13019.1| BUB3 budding uninhibited by benzimidazoles 3 [Bos taurus]
 gb|EDM11706.1| budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae), 
isoform CRA_b [Rattus norvegicus]
 tpg|DAA14656.1| TPA: mitotic checkpoint protein BUB3 [Bos taurus]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004438950.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Ceratotherium 
simum simum]
Length=326

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>gb|ELK36834.1| Mitotic checkpoint protein BUB3 [Myotis davidii]
Length=287

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  70   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  129

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  130  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  189

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  190  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  236



>ref|XP_004474644.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004474645.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004474646.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 3 [Dasypus 
novemcinctus]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_005351448.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Microtus 
ochrogaster]
Length=326

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDMEHPEDGIFIRQV  316



>gb|AAX43869.1| BUB3 budding uninhibited by benzimidazoles 3-like [synthetic 
construct]
Length=329

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_006188783.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Camelus 
ferus]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_002109375.1| hypothetical protein TRIADDRAFT_53336 [Trichoplax adhaerens]
 gb|EDV27541.1| hypothetical protein TRIADDRAFT_53336 [Trichoplax adhaerens]
Length=326

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TA R V V+DLRNM+  +QRRESSLKYQTRC+RC+PN  GY LSS+EGRVA+E+FD
Sbjct  151  LIVGTAARKVLVWDLRNMNFPQQRRESSLKYQTRCIRCFPNKQGYVLSSIEGRVAVEYFD  210

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q  KYAFKCHR  ++G ++++PVNAI+FH  Y TFATGG DG+VN+WDG NKKRL
Sbjct  211  PSPEIQKMKYAFKCHRVKDSGNEIIHPVNAISFHNGYNTFATGGSDGFVNIWDGFNKKRL  270

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEG-DKPHEPDVIFVRSVN  173
             Q+ +YP S+A+LSF+  G LLA+A+SY +EE  D+   PD I++R ++
Sbjct  271  CQFHRYPTSIASLSFNATGTLLAIASSYLYEEDKDESPAPDSIYIRRIS  319



>gb|EHH65091.1| hypothetical protein EGM_18435 [Macaca fascicularis]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_010633604.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Fukomys 
damarensis]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|NP_004716.1| mitotic checkpoint protein BUB3 isoform a [Homo sapiens]
 ref|NP_001253182.1| mitotic checkpoint protein BUB3 [Macaca mulatta]
 ref|XP_001161211.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pan troglodytes]
 ref|XP_003255108.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Nomascus 
leucogenys]
 ref|XP_001490096.3| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Equus 
caballus]
 ref|XP_003794127.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Otolemur 
garnettii]
 ref|XP_003816352.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pan paniscus]
 ref|XP_003904414.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Papio 
anubis]
 ref|XP_003922172.1| PREDICTED: mitotic checkpoint protein BUB3 [Saimiri boliviensis 
boliviensis]
 ref|XP_003994528.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Felis 
catus]
 ref|XP_004050279.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004265786.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Orcinus 
orca]
 ref|XP_004321909.1| PREDICTED: mitotic checkpoint protein BUB3-like [Tursiops truncatus]
 ref|XP_004416456.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004804682.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Mustela 
putorius furo]
 ref|XP_004876153.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004838821.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Heterocephalus 
glaber]
 ref|XP_005225912.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bos taurus]
 ref|XP_005320805.1| PREDICTED: mitotic checkpoint protein BUB3 [Ictidomys tridecemlineatus]
 ref|XP_005402017.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005566728.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Macaca 
fascicularis]
 ref|XP_005671576.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Sus scrofa]
 ref|XP_005671577.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Sus scrofa]
 ref|XP_005698639.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Capra 
hircus]
 ref|XP_005895142.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bos mutus]
 ref|XP_005985536.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_006207485.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Vicugna 
pacos]
 ref|XP_006143981.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Tupaia 
chinensis]
 ref|XP_006143982.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Tupaia 
chinensis]
 ref|XP_006143983.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Tupaia 
chinensis]
 ref|XP_007073840.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007114001.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Physeter 
catodon]
 ref|XP_006080473.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bubalus 
bubalis]
 ref|XP_006080474.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bubalus 
bubalis]
 ref|XP_007173320.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173321.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007451169.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007935003.1| PREDICTED: mitotic checkpoint protein BUB3 [Orycteropus afer 
afer]
 ref|XP_008068774.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Tarsius 
syrichta]
 ref|XP_008536067.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Equus 
przewalskii]
 ref|XP_008577754.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Galeopterus 
variegatus]
 ref|XP_008683640.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Ursus 
maritimus]
 ref|XP_010355762.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010857476.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bison 
bison bison]
 ref|XP_011233098.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_011285905.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Felis 
catus]
 sp|O43684.1|BUB3_HUMAN RecName: Full=Mitotic checkpoint protein BUB3 [Homo sapiens]
 gb|AAC28438.1| spleen mitotic checkpoint BUB3 [Homo sapiens]
 gb|AAC06258.1| mitotic checkpoint component Bub3 [Homo sapiens]
 gb|AAC36307.1| kinetochore protein BUB3 [Homo sapiens]
 gb|AAH05138.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Homo 
sapiens]
 gb|AAH22438.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Homo 
sapiens]
 gb|AAX32262.1| BUB3 budding uninhibited by benzimidazoles 3-like [synthetic 
construct]
 dbj|BAE91482.1| unnamed protein product [Macaca fascicularis]
 gb|EAW49285.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_b [Homo sapiens]
 gb|EAW49286.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_b [Homo sapiens]
 gb|ABM82778.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[synthetic construct]
 gb|ABM85968.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[synthetic construct]
 dbj|BAG35444.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20317.1| budding uninhibited by benzimidazoles 3 homolog [synthetic construct]
 gb|AIC50291.1| BUB3, partial [synthetic construct]
 gb|AIC55541.1| BUB3, partial [synthetic construct]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004625653.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Octodon 
degus]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_003734599.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Callithrix 
jacchus]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004438949.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Ceratotherium 
simum simum]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_005351447.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Microtus 
ochrogaster]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDMEHPEDGIFIRQV  316



>ref|XP_005880912.1| PREDICTED: mitotic checkpoint protein BUB3 [Myotis brandtii]
Length=326

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_006879938.1| PREDICTED: mitotic checkpoint protein BUB3 [Elephantulus edwardii]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTDHPEDGIFIRQV  316



>ref|XP_004020302.1| PREDICTED: mitotic checkpoint protein BUB3 [Ovis aries]
Length=328

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_007519725.1| PREDICTED: mitotic checkpoint protein BUB3 [Erinaceus europaeus]
Length=328

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSSDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>gb|KFO37637.1| Mitotic checkpoint protein BUB3 [Fukomys damarensis]
Length=356

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_006267668.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Alligator 
mississippiensis]
Length=326

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>ref|XP_004356556.1| WD domain, Gbeta repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR24656.1| WD domain, Gbeta repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
Length=329

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V  A R + V+DLRN++   ++R+SSLK+QTRCV+ +P+ TGYA +S+EGRVA+++F 
Sbjct  154  LIVGCADRQIWVWDLRNLNAPSEKRQSSLKFQTRCVKLFPDDTGYATASIEGRVAIDYF-  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q +KYAFKCHR +  G   V+PVN IAFHPI GTFATGGCDGYVNVWDG NKKRL
Sbjct  213  -SAEQQDRKYAFKCHRATIDGVHTVWPVNCIAFHPI-GTFATGGCDGYVNVWDGQNKKRL  270

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ KYP S+A+L FS DG+ LA+A+SYTFEEG++ H  D +FVR V
Sbjct  271  CQFHKYPTSIASLDFSSDGQYLAIASSYTFEEGERDHPLDQVFVRQV  317



>ref|XP_010633579.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Fukomys 
damarensis]
 ref|XP_010633587.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Fukomys 
damarensis]
Length=353

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_008825474.1| PREDICTED: mitotic checkpoint protein BUB3 [Nannospalax galili]
Length=328

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSSDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_006267669.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Alligator 
mississippiensis]
Length=324

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>ref|XP_005305938.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Chrysemys 
picta bellii]
Length=326

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>ref|XP_008154368.1| PREDICTED: mitotic checkpoint protein BUB3 [Eptesicus fuscus]
Length=328

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEHIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_011111935.1| hypothetical protein H072_6136 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40069.1| hypothetical protein H072_6136 [Dactylellina haptotyla CBS 200.50]
Length=333

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 131/169 (78%), Gaps = 2/169 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R +++YDLRNMS+  QRRESSLK+ TR VRC PNG GYA SS+EGRVA+EFFD
Sbjct  154  LVVAMASRSIHIYDLRNMSEPFQRRESSLKFMTRTVRCMPNGEGYASSSIEGRVAVEFFD  213

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S+  QS+KYAFKCHR+ E   DVVYPVNA++FHP YGTFA+GG DG V +WDG  K+RL
Sbjct  214  PSKESQSRKYAFKCHRQPEGDVDVVYPVNALSFHPQYGTFASGGGDGVVALWDGVAKRRL  273

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDK--PHEPDVIFVRSV  176
             QY KYPAS+AA+ FS DGR LA+A+   FE+G +   ++ + +F+R +
Sbjct  274  RQYPKYPASIAAMGFSHDGRYLAIASCNGFEDGKETVSNQENKLFIREM  322



>ref|XP_005305939.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Chrysemys 
picta bellii]
Length=324

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>ref|XP_005305937.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Chrysemys 
picta bellii]
Length=330

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  154  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  213

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  214  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  273

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  274  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  320



>ref|XP_004579810.1| PREDICTED: mitotic checkpoint protein BUB3 [Ochotona princeps]
Length=328

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLRENNIEQIYPVNAISFHSVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDMEHPEDGIFIRQV  316



>ref|XP_001512314.2| PREDICTED: mitotic checkpoint protein BUB3 [Ornithorhynchus anatinus]
Length=345

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  169  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  228

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  229  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  288

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  289  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  335



>ref|XP_002738187.1| PREDICTED: mitotic checkpoint protein BUB3-like [Saccoglossus 
kowalevskii]
Length=324

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V T+GR V V+DLRNM   +QRR+SSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTSGRKVLVWDLRNMGYVQQRRDSSLKYQTRCIRSFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q +KYAFKCHR    G + +YPVNAI+FH ++ TFATGG DG+VN+WDG NKKRL
Sbjct  210  PSPEIQKRKYAFKCHRLKVDGVEQIYPVNAISFHSVHNTFATGGSDGFVNIWDGFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+LSFS DG +LA+A+SY +E G++ H  D +++R V
Sbjct  270  CQFHRYPTSIASLSFSHDGSVLAIASSYMYELGEQEHPEDAVYIRKV  316



>ref|XP_004659326.1| PREDICTED: mitotic checkpoint protein BUB3 [Jaculus jaculus]
Length=328

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_004680433.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Condylura 
cristata]
Length=359

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>gb|KFU86042.1| Mitotic checkpoint protein BUB3, partial [Chaetura pelagica]
Length=258

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  85   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  144

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  145  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  204

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  205  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  251



>ref|XP_010007114.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3, 
partial [Chaetura pelagica]
Length=266

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  92   LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  151

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  152  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  211

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  212  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  258



>ref|XP_006136163.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pelodiscus 
sinensis]
Length=326

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>ref|XP_002722642.2| PREDICTED: mitotic checkpoint protein BUB3 [Oryctolagus cuniculus]
Length=328

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLRENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_006136164.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pelodiscus 
sinensis]
Length=324

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  316



>gb|KFM75540.1| Mitotic checkpoint protein BUB3, partial [Stegodyphus mimosarum]
Length=326

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DL+NM   +QRRESSLKYQTRC+RC+PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLQNMGYVQQRRESSLKYQTRCIRCFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHR-KSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKR  320
             S   Q KKYAFKCHR K  +G + +YPVN IAFH  Y TFATGG DG+VN+WDG NKKR
Sbjct  213  PSPEVQKKKYAFKCHRIKENSGVEFIYPVNTIAFHNGYNTFATGGSDGFVNIWDGFNKKR  272

Query  319  LYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
            L Q+ +YP  +++L+FS DG +LA+A+SY +E   K   PD I++R+V
Sbjct  273  LCQFHRYPTHISSLAFSPDGTILAIASSYIYEMDAKDVPPDAIYIRTV  320



>ref|XP_006675919.1| hypothetical protein BATDEDRAFT_84472 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82944.1| hypothetical protein BATDEDRAFT_84472 [Batrachochytrium dendrobatidis 
JAM81]
Length=336

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            LVVA A R + +YDLRNMS+  QRRESSLK+ TR V C PNG G+A  SVEGRVA+E+FD
Sbjct  155  LVVAMANRQIYIYDLRNMSETLQRRESSLKFMTRRVACTPNGDGFASCSVEGRVAVEYFD  214

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             +E  Q+K Y+FKCHR+   G D ++PVNA+A++  +GTFA+GG DG VN+WDG NKKR+
Sbjct  215  PAEEIQAKNYSFKCHRQVIDGVDTIFPVNALAYNSKHGTFASGGADGVVNIWDGLNKKRI  274

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             QY KYP S+++L+F+ DG LLAVA+SYT+EEG+K H  D I++RSV
Sbjct  275  KQYPKYPTSISSLAFNFDGSLLAVASSYTYEEGEKDHPVDSIYIRSV  321



>ref|XP_006025193.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Alligator 
sinensis]
Length=368

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  192  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  251

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  252  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  311

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  312  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  358



>ref|XP_006025194.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Alligator 
sinensis]
Length=366

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  192  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  251

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  252  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  311

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  312  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIFIRQV  358



>ref|NP_001007498.1| BUB3 mitotic checkpoint protein [Xenopus (Silurana) tropicalis]
 gb|AAH79934.1| bub3 protein [Xenopus (Silurana) tropicalis]
Length=324

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNA++FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGSTLAIAASYMYEMDDIDHPEDAIYIRQV  316



>ref|NP_001083768.1| mitotic checkpoint protein BUB3 [Xenopus laevis]
 sp|Q9YGY3.1|BUB3_XENLA RecName: Full=Mitotic checkpoint protein BUB3; Short=xbub3; AltName: 
Full=WD repeat protein Bub3 [Xenopus laevis]
 dbj|BAA34999.1| mitotic checkpoint [Xenopus laevis]
Length=330

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  156  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNA++FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  216  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D I++R V
Sbjct  276  CQFHRYPTSIASLAFSNDGSTLAIAASYMYEMDDIDHPEDAIYIRQV  322



>gb|AAK12629.1|AF119790_1 WD repeat protein Bub3 [Xenopus laevis]
 gb|AAH73086.1| Xbub3 protein [Xenopus laevis]
Length=324

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNA++FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGSTLAIAASYMYEMDDIDHPEDAIYIRQV  316



>gb|AAD38038.1|AF149822_1 mitotic checkpoint protein BUB3 [Mus musculus]
Length=326

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DL NM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLWNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|XP_001698657.1| WD40 repeat protein [Chlamydomonas reinhardtii]
 gb|EDO99339.1| WD40 repeat protein, partial [Chlamydomonas reinhardtii]
Length=339

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 134/174 (77%), Gaps = 7/174 (4%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNM------SQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRV  515
            LVVAT+GRH+ +YD+R +         EQ RESSLKYQTR V  Y +G GYA+ SVEGRV
Sbjct  158  LVVATSGRHILIYDIRKLVGGAAGEALEQHRESSLKYQTRSVAVYTDGRGYAVGSVEGRV  217

Query  514  AMEFFDLSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDG  335
            AMEFFD ++A Q+ KYAFKCHR++E G+DVVYPV++I FH  YGTFATGG DG + +WDG
Sbjct  218  AMEFFDAADA-QANKYAFKCHRRNEGGKDVVYPVHSITFHGGYGTFATGGGDGVICIWDG  276

Query  334  NNKKRLYQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSVN  173
             NKKRL Q ++YP+SVA++ FSR G +LAVA+SY +E+G++ H  D I++R+V 
Sbjct  277  ENKKRLSQTARYPSSVASMCFSRSGEMLAVASSYAYEQGERDHPADAIYIRAVQ  330



>ref|XP_005048890.1| PREDICTED: mitotic checkpoint protein BUB3 [Ficedula albicollis]
 ref|XP_005424560.1| PREDICTED: mitotic checkpoint protein BUB3 [Geospiza fortis]
 ref|XP_005528883.1| PREDICTED: mitotic checkpoint protein BUB3 [Pseudopodoces humilis]
 ref|XP_009085363.1| PREDICTED: mitotic checkpoint protein BUB3 [Serinus canaria]
 ref|XP_009276216.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009324149.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pygoscelis 
adeliae]
 ref|XP_009917389.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010406195.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Corvus 
cornix cornix]
 ref|XP_010580296.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Haliaeetus 
leucocephalus]
Length=329

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_002192609.2| PREDICTED: mitotic checkpoint protein BUB3 [Taeniopygia guttata]
 ref|XP_005505841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Columba 
livia]
Length=329

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_005505842.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Columba 
livia]
 ref|XP_009510307.1| PREDICTED: mitotic checkpoint protein BUB3 [Phalacrocorax carbo]
Length=327

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_008926745.1| PREDICTED: mitotic checkpoint protein BUB3 [Manacus vitellinus]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_005494903.1| PREDICTED: mitotic checkpoint protein BUB3 [Zonotrichia albicollis]
Length=329

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_007420850.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Python 
bivittatus]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_007420849.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Python 
bivittatus]
Length=326

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_005232503.1| PREDICTED: mitotic checkpoint protein BUB3 [Falco peregrinus]
 ref|XP_005439296.1| PREDICTED: mitotic checkpoint protein BUB3 [Falco cherrug]
 ref|XP_008638526.1| PREDICTED: mitotic checkpoint protein BUB3 [Corvus brachyrhynchos]
 ref|XP_009080642.1| PREDICTED: mitotic checkpoint protein BUB3 [Acanthisitta chloris]
 ref|XP_009276217.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Aptenodytes 
forsteri]
 ref|XP_009324150.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pygoscelis 
adeliae]
 ref|XP_009477791.1| PREDICTED: mitotic checkpoint protein BUB3 [Pelecanus crispus]
 ref|XP_009474028.1| PREDICTED: mitotic checkpoint protein BUB3 [Nipponia nippon]
 ref|XP_009558386.1| PREDICTED: mitotic checkpoint protein BUB3 [Cuculus canorus]
 ref|XP_009577954.1| PREDICTED: mitotic checkpoint protein BUB3 [Fulmarus glacialis]
 ref|XP_009639373.1| PREDICTED: mitotic checkpoint protein BUB3 [Egretta garzetta]
 ref|XP_009808573.1| PREDICTED: mitotic checkpoint protein BUB3 [Gavia stellata]
 ref|XP_009908701.1| PREDICTED: mitotic checkpoint protein BUB3 [Picoides pubescens]
 ref|XP_009891033.1| PREDICTED: mitotic checkpoint protein BUB3 [Charadrius vociferus]
 ref|XP_009917397.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009944065.1| PREDICTED: mitotic checkpoint protein BUB3 [Opisthocomus hoazin]
 ref|XP_009956315.1| PREDICTED: mitotic checkpoint protein BUB3 [Leptosomus discolor]
 ref|XP_010017165.1| PREDICTED: mitotic checkpoint protein BUB3 [Nestor notabilis]
 ref|XP_009989710.1| PREDICTED: mitotic checkpoint protein BUB3 [Tauraco erythrolophus]
 ref|XP_009966791.1| PREDICTED: mitotic checkpoint protein BUB3 [Tyto alba]
 ref|XP_010152829.1| PREDICTED: mitotic checkpoint protein BUB3 [Eurypyga helias]
 ref|XP_010116092.1| PREDICTED: mitotic checkpoint protein BUB3 [Chlamydotis macqueenii]
 ref|XP_010206162.1| PREDICTED: mitotic checkpoint protein BUB3 [Colius striatus]
 ref|XP_010294157.1| PREDICTED: mitotic checkpoint protein BUB3 [Phaethon lepturus]
 ref|XP_010307383.1| PREDICTED: mitotic checkpoint protein BUB3 [Balearica regulorum 
gibbericeps]
 ref|XP_010406204.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Corvus 
cornix cornix]
 ref|XP_010580297.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Haliaeetus 
leucocephalus]
Length=327

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_001367606.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Monodelphis 
domestica]
 ref|XP_007478912.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Monodelphis 
domestica]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAG    V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGHRFTVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQV  316



>ref|NP_001006506.1| mitotic checkpoint protein BUB3 [Gallus gallus]
 ref|XP_010713167.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Meleagris 
gallopavo]
 emb|CAG32680.1| hypothetical protein RCJMB04_32k7 [Gallus gallus]
Length=329

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_009668841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Struthio 
camelus australis]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>emb|CAJ81358.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[Xenopus (Silurana) tropicalis]
Length=330

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  156  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  215

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNA++FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  216  PSLEVQKKKYAFKCHRLKENNIEQIYPVNAVSFHNLHNTFATGGSDGFVNIWDPFNKKRL  275

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+AASY +E  D  H  D I++R V
Sbjct  276  CQFHRYPTSIASLAFSNDGSTLAIAASYMYEMDDIDHPEDAIYIRQV  322



>gb|EMC88322.1| Mitotic checkpoint protein BUB3 [Columba livia]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_008489974.1| PREDICTED: mitotic checkpoint protein BUB3 [Calypte anna]
 ref|XP_009698949.1| PREDICTED: mitotic checkpoint protein BUB3 [Cariama cristata]
Length=324

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>gb|KFM06687.1| Mitotic checkpoint protein BUB3, partial [Aptenodytes forsteri]
 gb|KFO06110.1| Mitotic checkpoint protein BUB3, partial [Balearica regulorum 
gibbericeps]
 gb|KFO64136.1| Mitotic checkpoint protein BUB3, partial [Corvus brachyrhynchos]
 gb|KFO75577.1| Mitotic checkpoint protein BUB3, partial [Cuculus canorus]
 gb|KFO99290.1| Mitotic checkpoint protein BUB3, partial [Calypte anna]
 gb|KFP17868.1| Mitotic checkpoint protein BUB3, partial [Egretta garzetta]
 gb|KFP27096.1| Mitotic checkpoint protein BUB3, partial [Colius striatus]
 gb|KFP34686.1| Mitotic checkpoint protein BUB3, partial [Chlamydotis macqueenii]
 gb|KFP50742.1| Mitotic checkpoint protein BUB3, partial [Cathartes aura]
 gb|KFP65262.1| Mitotic checkpoint protein BUB3, partial [Cariama cristata]
 gb|KFP72694.1| Mitotic checkpoint protein BUB3, partial [Acanthisitta chloris]
 gb|KFP96582.1| Mitotic checkpoint protein BUB3, partial [Haliaeetus albicilla]
 gb|KFQ15505.1| Mitotic checkpoint protein BUB3, partial [Leptosomus discolor]
 gb|KFQ53541.1| Mitotic checkpoint protein BUB3, partial [Nestor notabilis]
 gb|KFQ59646.1| Mitotic checkpoint protein BUB3, partial [Pelecanus crispus]
 gb|KFQ69989.1| Mitotic checkpoint protein BUB3, partial [Phaethon lepturus]
 gb|KFQ80157.1| Mitotic checkpoint protein BUB3, partial [Phoenicopterus ruber 
ruber]
 gb|KFQ92037.1| Mitotic checkpoint protein BUB3, partial [Nipponia nippon]
 gb|KFR05456.1| Mitotic checkpoint protein BUB3, partial [Opisthocomus hoazin]
 gb|KFV05939.1| Mitotic checkpoint protein BUB3, partial [Tauraco erythrolophus]
 gb|KFV52344.1| Mitotic checkpoint protein BUB3, partial [Gavia stellata]
 gb|KFV53214.1| Mitotic checkpoint protein BUB3, partial [Tyto alba]
 gb|KFV62881.1| Mitotic checkpoint protein BUB3, partial [Picoides pubescens]
 gb|KFV94398.1| Mitotic checkpoint protein BUB3, partial [Eurypyga helias]
 gb|KFW06516.1| Mitotic checkpoint protein BUB3, partial [Fulmarus glacialis]
 gb|KFW68420.1| Mitotic checkpoint protein BUB3, partial [Pygoscelis adeliae]
 gb|KFZ62516.1| Mitotic checkpoint protein BUB3, partial [Podiceps cristatus]
 gb|KGL99443.1| Mitotic checkpoint protein BUB3, partial [Charadrius vociferus]
Length=323

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>gb|KFV79058.1| Mitotic checkpoint protein BUB3, partial [Struthio camelus australis]
Length=323

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>gb|KFW84791.1| Mitotic checkpoint protein BUB3, partial [Manacus vitellinus]
Length=323

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_008947573.1| PREDICTED: mitotic checkpoint protein BUB3 [Merops nubicus]
Length=327

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSSDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_005154549.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Melopsittacus 
undulatus]
Length=321

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  147  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  206

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  207  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  266

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  267  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  313



>ref|XP_010713168.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Meleagris 
gallopavo]
Length=327

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  153  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  212

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  213  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  272

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  273  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  319



>ref|XP_005023232.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Anas platyrhynchos]
Length=326

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_009668840.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Struthio 
camelus australis]
Length=326

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH ++ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEIQKKKYAFKCHRLKENNIEQIYPVNAISFHNVHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D I++R V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDIEHPEDGIYIRQV  316



>ref|XP_006867487.1| PREDICTED: mitotic checkpoint protein BUB3 [Chrysochloris asiatica]
Length=328

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  676  LVVATAGRHVNVYDLRNMSQXEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFD  497
            L+V TAGR V V+DLRNM   +QRRESSLKYQTRC+R +PN  GY LSS+EGRVA+E+ D
Sbjct  150  LIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLD  209

Query  496  LSEAGQSKKYAFKCHRKSEAGRDVVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRL  317
             S   Q KKYAFKCHR  E   + +YPVNAI+FH I+ TFATGG DG+VN+WD  NKKRL
Sbjct  210  PSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRL  269

Query  316  YQYSKYPASVAALSFSRDGRLLAVAASYTFEEGDKPHEPDVIFVRSV  176
             Q+ +YP S+A+L+FS DG  LA+A+SY +E  D  H  D IF+  V
Sbjct  270  CQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFILQV  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240