BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032C12

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG13748.1|  Flavonol synthase/flavanone 3-hydroxylase               142   7e-37   Gossypium arboreum [tree cotton]
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782    144   2e-36   Phoenix dactylifera
gb|KJB07537.1|  hypothetical protein B456_001G028700                    142   8e-36   Gossypium raimondii
ref|XP_008357417.1|  PREDICTED: uncharacterized protein LOC103421160    139   8e-36   
ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346    142   1e-35   Nicotiana tomentosiformis
ref|XP_002516035.1|  conserved hypothetical protein                     142   1e-35   Ricinus communis
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889    142   2e-35   Vitis vinifera
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187    142   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774    141   2e-35   Sesamum indicum [beniseed]
ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259    141   2e-35   Nicotiana tomentosiformis
ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253    141   2e-35   Nicotiana sylvestris
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476    140   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943    140   4e-35   Eucalyptus grandis [rose gum]
ref|XP_008347634.1|  PREDICTED: uncharacterized protein LOC103410...    139   5e-35   
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039    140   5e-35   
gb|KDO79725.1|  hypothetical protein CISIN_1g011811mg                   138   9e-35   Citrus sinensis [apfelsine]
gb|KDP37239.1|  hypothetical protein JCGZ_06295                         139   1e-34   Jatropha curcas
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334    139   1e-34   Solanum tuberosum [potatoes]
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883    139   1e-34   Solanum lycopersicum
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500    139   1e-34   Elaeis guineensis
ref|XP_007161545.1|  hypothetical protein PHAVU_001G078400g             130   1e-34   Phaseolus vulgaris [French bean]
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179    139   2e-34   Prunus mume [ume]
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494    139   2e-34   Nicotiana sylvestris
gb|KDO79723.1|  hypothetical protein CISIN_1g011811mg                   138   2e-34   Citrus sinensis [apfelsine]
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg             139   2e-34   Citrus clementina [clementine]
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...    139   2e-34   
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818    139   2e-34   Elaeis guineensis
emb|CDP16156.1|  unnamed protein product                                139   2e-34   Coffea canephora [robusta coffee]
dbj|BAK01650.1|  predicted protein                                      138   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                  138   2e-34   
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437    138   3e-34   Citrus sinensis [apfelsine]
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041    138   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...    138   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...    138   3e-34   
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187    138   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg             137   4e-34   Capsella rubella
gb|AAY63998.1|  unknown                                                 135   6e-34   Brassica napus [oilseed rape]
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...    137   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329    137   8e-34   Oryza brachyantha
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312    137   8e-34   Populus euphratica
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg             137   8e-34   Prunus persica
gb|EEC84400.1|  hypothetical protein OsI_30977                          137   8e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein          137   1e-33   
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...    137   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP34212.1|  hypothetical protein JCGZ_07783                         136   1e-33   Jatropha curcas
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426             136   1e-33   
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g             136   1e-33   Phaseolus vulgaris [French bean]
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470    136   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002516571.1|  conserved hypothetical protein                     136   1e-33   
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...    136   1e-33   Solanum tuberosum [potatoes]
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...    136   1e-33   Solanum tuberosum [potatoes]
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700          136   2e-33   Amborella trichopoda
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...    136   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...    136   2e-33   Tarenaya hassleriana [spider flower]
gb|EEE69518.1|  hypothetical protein OsJ_28979                          136   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                       136   2e-33   
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein             135   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54849.1|  hypothetical protein B456_009G051700                    135   2e-33   Gossypium raimondii
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421    135   2e-33   Brachypodium distachyon [annual false brome]
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...    135   2e-33   Camelina sativa [gold-of-pleasure]
gb|KJB54846.1|  hypothetical protein B456_009G051700                    135   2e-33   Gossypium raimondii
gb|KHG04871.1|  hypothetical protein F383_28778                         135   2e-33   Gossypium arboreum [tree cotton]
emb|CDX77007.1|  BnaC04g38020D                                          135   3e-33   
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106    135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877    135   3e-33   Eucalyptus grandis [rose gum]
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686    135   3e-33   Brassica rapa
emb|CDY35338.1|  BnaA04g15090D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958    135   3e-33   Solanum lycopersicum
emb|CDP02034.1|  unnamed protein product                                135   3e-33   Coffea canephora [robusta coffee]
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756    135   3e-33   Eucalyptus grandis [rose gum]
ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g             135   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663    135   4e-33   Fragaria vesca subsp. vesca
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282    134   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN10230.1|  hypothetical protein glysoja_017834                     134   6e-33   Glycine soja [wild soybean]
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318    134   6e-33   Glycine max [soybeans]
gb|AAC42255.1|  hypothetical protein                                    137   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681    134   9e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079    134   9e-33   
gb|AEI98632.1|  hypothetical protein 111018.19                          134   9e-33   Coffea canephora [robusta coffee]
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784    134   1e-32   Glycine max [soybeans]
tpg|DAA61110.1|  TPA: hypothetical protein ZEAMMB73_890925              133   1e-32   
ref|XP_010109461.1|  hypothetical protein L484_001800                   134   1e-32   
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804    134   1e-32   Malus domestica [apple tree]
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912    134   1e-32   Vitis vinifera
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866    133   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137    132   3e-32   Populus euphratica
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...    132   3e-32   
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                  132   3e-32   
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510          132   3e-32   Sorghum bicolor [broomcorn]
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564    132   3e-32   Populus euphratica
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg                132   3e-32   Erythranthe guttata [common monkey flower]
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg                132   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666    132   4e-32   Populus euphratica
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056    132   4e-32   Setaria italica
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367    132   4e-32   Brassica rapa
emb|CDY70121.1|  BnaC03g72820D                                          132   4e-32   Brassica napus [oilseed rape]
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g             132   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...    132   5e-32   Populus euphratica
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...    132   6e-32   Populus euphratica
ref|XP_010667910.1|  PREDICTED: uncharacterized protein LOC104884...    130   6e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg             131   7e-32   Eutrema salsugineum [saltwater cress]
gb|KHN42580.1|  hypothetical protein glysoja_042801                     131   7e-32   Glycine soja [wild soybean]
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...    131   7e-32   Glycine max [soybeans]
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2              131   8e-32   
gb|EPS70854.1|  hypothetical protein M569_03904                         131   8e-32   Genlisea aurea
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg             131   9e-32   Prunus persica
gb|KHN41986.1|  hypothetical protein glysoja_003726                     126   1e-31   Glycine soja [wild soybean]
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...    131   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...    131   1e-31   
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...    131   1e-31   Glycine max [soybeans]
ref|XP_003537580.2|  PREDICTED: uncharacterized protein LOC100817312    126   1e-31   
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g             131   1e-31   
emb|CDX83221.1|  BnaA03g22850D                                          130   1e-31   
dbj|BAG89362.1|  unnamed protein product                                129   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528    130   1e-31   
gb|KDP37236.1|  hypothetical protein JCGZ_06292                         130   2e-31   Jatropha curcas
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714    130   2e-31   Cucumis melo [Oriental melon]
ref|XP_002521607.1|  conserved hypothetical protein                     130   2e-31   Ricinus communis
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984    130   2e-31   Phoenix dactylifera
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461    129   3e-31   
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608    129   3e-31   
gb|EAZ42610.1|  hypothetical protein OsJ_27176                          129   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361    129   3e-31   Nicotiana sylvestris
ref|XP_010113488.1|  hypothetical protein L484_026823                   129   3e-31   
gb|EEC83519.1|  hypothetical protein OsI_29108                          129   3e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...    129   4e-31   Malus domestica [apple tree]
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277    129   4e-31   
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...    129   4e-31   Malus domestica [apple tree]
ref|NP_001061719.1|  Os08g0389700                                       129   4e-31   
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...    129   5e-31   Pyrus x bretschneideri [bai li]
gb|KHN36120.1|  hypothetical protein glysoja_003243                     129   5e-31   Glycine soja [wild soybean]
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...    129   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870    129   5e-31   Eucalyptus grandis [rose gum]
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...    129   5e-31   Malus domestica [apple tree]
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441    129   6e-31   Glycine max [soybeans]
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...    129   6e-31   Malus domestica [apple tree]
ref|XP_008353719.1|  PREDICTED: uncharacterized protein LOC103417306    132   6e-31   
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...    129   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581    129   6e-31   Cicer arietinum [garbanzo]
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg             129   6e-31   Prunus persica
gb|KDO79523.1|  hypothetical protein CISIN_1g011797mg                   127   7e-31   Citrus sinensis [apfelsine]
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...    129   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781    129   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_010235081.1|  PREDICTED: uncharacterized protein LOC100846...    127   1e-30   Brachypodium distachyon [annual false brome]
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...    128   1e-30   
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...    128   1e-30   Eucalyptus grandis [rose gum]
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783    128   1e-30   
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783            128   1e-30   
ref|XP_003574413.1|  PREDICTED: uncharacterized protein LOC100846...    128   1e-30   Brachypodium distachyon [annual false brome]
gb|AET03944.2|  sulfite exporter TauE/SafE family protein               128   1e-30   Medicago truncatula
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548    128   1e-30   Solanum tuberosum [potatoes]
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155    128   1e-30   Solanum lycopersicum
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946    127   2e-30   Prunus mume [ume]
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                  127   2e-30   
ref|XP_009410875.1|  PREDICTED: uncharacterized protein LOC103992760    126   2e-30   
dbj|BAJ87419.1|  predicted protein                                      127   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK35007.1|  unknown                                                 127   2e-30   Medicago truncatula
gb|KDP38300.1|  hypothetical protein JCGZ_05186                         127   2e-30   Jatropha curcas
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg             127   2e-30   Citrus clementina [clementine]
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g             127   2e-30   Phaseolus vulgaris [French bean]
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                   127   2e-30   Citrus sinensis [apfelsine]
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075    127   2e-30   Prunus mume [ume]
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                   127   2e-30   Citrus sinensis [apfelsine]
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg             127   2e-30   
ref|XP_002516037.1|  conserved hypothetical protein                     127   3e-30   
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294...    127   3e-30   Fragaria vesca subsp. vesca
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748    127   3e-30   Glycine max [soybeans]
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945    127   3e-30   Prunus mume [ume]
ref|XP_011466694.1|  PREDICTED: uncharacterized protein LOC101294...    127   4e-30   Fragaria vesca subsp. vesca
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633    126   4e-30   Glycine max [soybeans]
gb|KJB40204.1|  hypothetical protein B456_007G050900                    126   4e-30   Gossypium raimondii
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186    126   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g             126   5e-30   Phaseolus vulgaris [French bean]
gb|ABC47842.1|  membrane protein-like protein                           126   6e-30   Glycine max [soybeans]
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...    125   7e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN32619.1|  hypothetical protein glysoja_022301                     126   7e-30   Glycine soja [wild soybean]
ref|XP_004504238.1|  PREDICTED: uncharacterized protein LOC101507523    125   7e-30   
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...    125   7e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003611976.1|  Membrane protein-like protein                      125   7e-30   Medicago truncatula
gb|ACJ86264.1|  unknown                                                 125   8e-30   Medicago truncatula
ref|XP_003629897.1|  hypothetical protein MTR_8g088080                  125   8e-30   
gb|EMT12794.1|  hypothetical protein F775_19997                         125   8e-30   
gb|KHM98753.1|  hypothetical protein glysoja_030806                     125   9e-30   Glycine soja [wild soybean]
gb|ACJ85296.1|  unknown                                                 125   9e-30   Medicago truncatula
gb|EPS70855.1|  hypothetical protein M569_03905                         125   1e-29   Genlisea aurea
ref|XP_010235080.1|  PREDICTED: uncharacterized protein LOC100846...    125   1e-29   
ref|XP_003636267.1|  Membrane protein-like protein                      118   1e-29   
ref|XP_003574412.1|  PREDICTED: uncharacterized protein LOC100846...    125   1e-29   
ref|XP_003611978.1|  Membrane protein-like protein                      118   1e-29   
gb|AES94936.2|  membrane-like protein, putative                         117   2e-29   Medicago truncatula
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g             125   2e-29   
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510    125   2e-29   Fragaria vesca subsp. vesca
gb|KJB43508.1|  hypothetical protein B456_007G203800                    124   2e-29   Gossypium raimondii
gb|KHG02837.1|  ATP synthase subunit delta                              124   2e-29   Gossypium arboreum [tree cotton]
ref|XP_011011436.1|  PREDICTED: uncharacterized protein LOC105116...    124   2e-29   Populus euphratica
gb|KJB43509.1|  hypothetical protein B456_007G203800                    124   3e-29   Gossypium raimondii
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...    124   3e-29   Populus euphratica
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...    124   3e-29   Populus euphratica
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...    124   5e-29   Cicer arietinum [garbanzo]
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...    124   5e-29   Cicer arietinum [garbanzo]
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...    123   6e-29   Cicer arietinum [garbanzo]
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...    123   6e-29   Cicer arietinum [garbanzo]
ref|XP_010254877.1|  PREDICTED: uncharacterized protein LOC104595...    122   6e-29   
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887    122   8e-29   Nelumbo nucifera [Indian lotus]
gb|ABR16333.1|  unknown                                                 122   1e-28   Picea sitchensis
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061    122   1e-28   Elaeis guineensis
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...    122   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...    121   3e-28   Nicotiana tomentosiformis
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...    121   3e-28   Nicotiana tomentosiformis
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...    120   4e-28   Nicotiana sylvestris
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...    120   5e-28   Nicotiana sylvestris
ref|XP_002516036.1|  conserved hypothetical protein                     120   7e-28   
ref|XP_010098073.1|  hypothetical protein L484_026205                   120   7e-28   
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...    120   9e-28   
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749    120   9e-28   
gb|KHN06458.1|  hypothetical protein glysoja_010802                     119   9e-28   Glycine soja [wild soybean]
ref|XP_008670142.1|  PREDICTED: uncharacterized protein LOC103647377    119   9e-28   
ref|XP_002460083.1|  hypothetical protein SORBIDRAFT_02g022500          119   1e-27   
ref|XP_006580197.1|  PREDICTED: uncharacterized protein LOC100818778    119   1e-27   Glycine max [soybeans]
ref|XP_003532779.1|  PREDICTED: uncharacterized protein LOC100801788    119   1e-27   Glycine max [soybeans]
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g             119   1e-27   
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg             119   1e-27   Citrus clementina [clementine]
ref|XP_004959391.1|  PREDICTED: uncharacterized protein LOC101762929    119   2e-27   
tpg|DAA39926.1|  TPA: hypothetical protein ZEAMMB73_327447              119   2e-27   
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g             118   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_007159526.1|  hypothetical protein PHAVU_002G244900g             118   3e-27   Phaseolus vulgaris [French bean]
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg             118   4e-27   Citrus clementina [clementine]
gb|KDO56902.1|  hypothetical protein CISIN_1g0116821mg                  117   4e-27   Citrus sinensis [apfelsine]
gb|KDO56900.1|  hypothetical protein CISIN_1g0116821mg                  117   5e-27   Citrus sinensis [apfelsine]
gb|KDO56901.1|  hypothetical protein CISIN_1g0116821mg                  117   5e-27   Citrus sinensis [apfelsine]
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g             117   6e-27   Phaseolus vulgaris [French bean]
ref|XP_007159525.1|  hypothetical protein PHAVU_002G244800g             116   6e-27   Phaseolus vulgaris [French bean]
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061    117   6e-27   Vitis vinifera
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...    117   7e-27   Citrus sinensis [apfelsine]
gb|AET04372.2|  sulfite exporter TauE/SafE family protein               117   7e-27   Medicago truncatula
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...    117   8e-27   Citrus sinensis [apfelsine]
gb|AAL27555.1|AF420410_1  hypothetical protein                          114   8e-27   Musa acuminata AAA Group [Cavendish banana]
gb|AEI72271.1|  hypothetical protein                                    116   1e-26   Citrus trifoliata [hardy orange]
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...    117   1e-26   Solanum tuberosum [potatoes]
ref|XP_007159524.1|  hypothetical protein PHAVU_002G244800g             116   1e-26   Phaseolus vulgaris [French bean]
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...    116   1e-26   Nicotiana tomentosiformis
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291...    116   1e-26   Fragaria vesca subsp. vesca
ref|XP_011466685.1|  PREDICTED: uncharacterized protein LOC101291...    116   1e-26   Fragaria vesca subsp. vesca
ref|XP_006585192.1|  PREDICTED: uncharacterized protein LOC100801244    115   2e-26   Glycine max [soybeans]
gb|KHN48050.1|  hypothetical protein glysoja_015520                     115   2e-26   Glycine soja [wild soybean]
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838    116   2e-26   Populus euphratica
ref|XP_006580862.1|  PREDICTED: uncharacterized protein LOC100818240    115   3e-26   
gb|EMS53169.1|  hypothetical protein TRIUR3_09961                       117   4e-26   Triticum urartu
ref|XP_002516570.1|  conserved hypothetical protein                     115   4e-26   Ricinus communis
ref|XP_010314287.1|  PREDICTED: uncharacterized protein LOC101268...    115   4e-26   Solanum lycopersicum
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135    115   4e-26   Populus euphratica
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...    115   5e-26   
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796    114   7e-26   
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864    114   9e-26   
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...    114   1e-25   
ref|XP_008380919.1|  PREDICTED: uncharacterized protein LOC103443803    113   2e-25   
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...    113   2e-25   Solanum tuberosum [potatoes]
ref|XP_009784625.1|  PREDICTED: uncharacterized protein LOC104233...    112   3e-25   Nicotiana sylvestris
gb|KJB18684.1|  hypothetical protein B456_003G065000                    112   3e-25   Gossypium raimondii
gb|KJB18685.1|  hypothetical protein B456_003G065000                    112   3e-25   Gossypium raimondii
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...    112   3e-25   Prunus mume [ume]
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g             112   4e-25   Phaseolus vulgaris [French bean]
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373    112   5e-25   Nicotiana tomentosiformis
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg             112   5e-25   
ref|XP_009777903.1|  PREDICTED: uncharacterized protein LOC104227...    111   6e-25   Nicotiana sylvestris
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...    112   6e-25   Nicotiana sylvestris
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...    112   7e-25   Nicotiana sylvestris
gb|ABK22903.1|  unknown                                                 105   7e-25   Picea sitchensis
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523    111   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg                111   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_007012056.1|  Membrane protein-like, putative                    111   9e-25   
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g             110   1e-24   Phaseolus vulgaris [French bean]
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...    111   1e-24   
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...    111   1e-24   Cicer arietinum [garbanzo]
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g             110   1e-24   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605    110   2e-24   Fragaria vesca subsp. vesca
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...    110   2e-24   Glycine max [soybeans]
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...    109   2e-24   
gb|KHN04837.1|  hypothetical protein glysoja_047520                     109   3e-24   
gb|EMT09652.1|  hypothetical protein F775_10698                         108   3e-24   
ref|XP_011014738.1|  PREDICTED: uncharacterized protein LOC105118467    108   4e-24   
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...    109   5e-24   
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g             109   5e-24   
gb|KJB56746.1|  hypothetical protein B456_009G134400                    108   7e-24   
ref|XP_007216194.1|  hypothetical protein PRUPE_ppa015991mg             107   1e-23   
ref|XP_008228601.1|  PREDICTED: uncharacterized protein LOC103327990    107   1e-23   
ref|XP_006465613.1|  PREDICTED: uncharacterized protein LOC102613991    107   2e-23   
gb|KEH40300.1|  sulfite exporter TauE/SafE family protein               107   2e-23   
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321    107   2e-23   
gb|AFK45505.1|  unknown                                                 105   2e-23   
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316    107   4e-23   
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712    106   5e-23   
ref|XP_009338073.1|  PREDICTED: uncharacterized protein LOC103930451    105   9e-23   
ref|XP_009338074.1|  PREDICTED: uncharacterized protein LOC103930452    105   9e-23   
ref|NP_001061712.1|  Os08g0387200                                       105   1e-22   
gb|EAZ06861.1|  hypothetical protein OsI_29096                          105   1e-22   
ref|XP_009394307.1|  PREDICTED: uncharacterized protein LOC103979817    105   2e-22   
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...    104   2e-22   
gb|EMS67477.1|  hypothetical protein TRIUR3_25438                     99.0    9e-22   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448    102   1e-21   
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300    102   1e-21   
ref|XP_007145273.1|  hypothetical protein PHAVU_007G225100g           98.6    3e-20   
ref|XP_006588810.1|  PREDICTED: uncharacterized protein LOC100788770  98.6    3e-20   
gb|KHN45702.1|  hypothetical protein glysoja_036851                   98.6    3e-20   
gb|KHN48208.1|  hypothetical protein glysoja_007877                   97.1    8e-20   
ref|XP_006594178.1|  PREDICTED: uncharacterized protein LOC100804918  97.4    8e-20   
ref|XP_007027568.1|  Sulfite exporter TauE/SafE family protein is...  96.7    9e-20   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640  97.4    1e-19   
ref|XP_007027567.1|  Sulfite exporter TauE/SafE family protein is...  97.1    1e-19   
ref|XP_010278281.1|  PREDICTED: uncharacterized protein LOC104612536  95.9    3e-19   
gb|KHG12656.1|  putative tripeptidyl-peptidase SED4                   95.5    3e-19   
gb|KJB15102.1|  hypothetical protein B456_002G160300                  94.0    5e-19   
gb|KDP29233.1|  hypothetical protein JCGZ_16622                       95.1    6e-19   
gb|KJB15099.1|  hypothetical protein B456_002G160300                  94.4    7e-19   
ref|XP_006381336.1|  hypothetical protein POPTR_0006s11920g           94.7    7e-19   
ref|XP_006341192.1|  PREDICTED: uncharacterized protein LOC102602443  94.4    9e-19   
gb|KJB15100.1|  hypothetical protein B456_002G160300                  94.4    1e-18   
gb|KJB15098.1|  hypothetical protein B456_002G160300                  94.4    1e-18   
gb|KJB15101.1|  hypothetical protein B456_002G160300                  94.0    1e-18   
ref|XP_008462667.1|  PREDICTED: uncharacterized protein LOC103500970  93.2    2e-18   
ref|XP_004143372.1|  PREDICTED: uncharacterized protein LOC101206149  93.6    2e-18   
ref|XP_007159527.1|  hypothetical protein PHAVU_002G2450001g          87.4    2e-18   
ref|XP_006481932.1|  PREDICTED: uncharacterized protein LOC102623178  92.8    3e-18   
gb|KDO57298.1|  hypothetical protein CISIN_1g048232mg                 92.8    3e-18   
ref|XP_009803774.1|  PREDICTED: uncharacterized protein LOC104249090  92.8    4e-18   
ref|XP_009143571.1|  PREDICTED: uncharacterized protein LOC103867...  91.7    4e-18   
gb|KEH24087.1|  sulfite exporter TauE/SafE family protein             91.7    4e-18   
ref|XP_004246584.1|  PREDICTED: uncharacterized protein LOC101249675  92.4    4e-18   
ref|XP_006430350.1|  hypothetical protein CICLE_v10011694mg           92.4    4e-18   
ref|XP_010558974.1|  PREDICTED: uncharacterized protein LOC104827497  92.4    5e-18   
ref|XP_011018859.1|  PREDICTED: uncharacterized protein LOC105121770  92.4    5e-18   
ref|XP_009340971.1|  PREDICTED: uncharacterized protein LOC103933044  92.4    5e-18   
gb|KEH24086.1|  sulfite exporter TauE/SafE family protein             91.7    6e-18   
ref|XP_009143570.1|  PREDICTED: uncharacterized protein LOC103867...  91.7    9e-18   
emb|CDX75027.1|  BnaA05g07730D                                        91.7    9e-18   
gb|KEH24085.1|  sulfite exporter TauE/SafE family protein             91.7    1e-17   
ref|XP_008387475.1|  PREDICTED: uncharacterized protein LOC103449926  91.7    1e-17   
ref|XP_004494124.1|  PREDICTED: uncharacterized protein LOC101492516  91.7    1e-17   
gb|KJB62289.1|  hypothetical protein B456_009G410000                  89.7    1e-17   
emb|CDY33170.1|  BnaC04g08690D                                        91.3    1e-17   
emb|CDP15335.1|  unnamed protein product                              90.9    2e-17   
ref|XP_011094444.1|  PREDICTED: uncharacterized protein LOC105174142  90.9    2e-17   
ref|XP_004498087.1|  PREDICTED: uncharacterized protein LOC101512728  90.9    2e-17   
ref|XP_011101500.1|  PREDICTED: uncharacterized protein LOC105179547  90.9    2e-17   
ref|XP_006651766.1|  PREDICTED: uncharacterized protein LOC102721538  90.5    2e-17   
ref|XP_002283988.1|  PREDICTED: uncharacterized protein LOC100240792  90.9    2e-17   
ref|XP_010683928.1|  PREDICTED: uncharacterized protein LOC104898535  90.9    2e-17   
emb|CDO98032.1|  unnamed protein product                              90.5    2e-17   
ref|XP_010527869.1|  PREDICTED: uncharacterized protein LOC104805133  90.5    2e-17   
ref|XP_006410834.1|  hypothetical protein EUTSA_v10016620mg           89.4    2e-17   
gb|KHG01219.1|  hypothetical protein F383_22307                       90.1    3e-17   
ref|XP_002881456.1|  hypothetical protein ARALYDRAFT_902780           90.5    3e-17   
ref|XP_010243123.1|  PREDICTED: uncharacterized protein LOC104587275  90.1    3e-17   
gb|KJB62286.1|  hypothetical protein B456_009G410000                  90.1    3e-17   
ref|XP_003553577.1|  PREDICTED: uncharacterized protein LOC100807336  90.1    3e-17   
ref|XP_010505210.1|  PREDICTED: uncharacterized protein LOC104782082  90.1    3e-17   
gb|ACY95275.1|  unknown                                               84.3    3e-17   
ref|XP_010516887.1|  PREDICTED: uncharacterized protein LOC104792440  90.1    3e-17   
gb|KHN06457.1|  hypothetical protein glysoja_010801                   89.4    4e-17   
ref|XP_010509452.1|  PREDICTED: uncharacterized protein LOC104785865  89.7    4e-17   
ref|XP_006294156.1|  hypothetical protein CARUB_v10023149mg           89.7    4e-17   
ref|XP_007202039.1|  hypothetical protein PRUPE_ppa005330mg           89.7    4e-17   
ref|NP_850267.1|  Sulfite exporter TauE/SafE family protein           89.7    4e-17   
ref|XP_008241333.1|  PREDICTED: uncharacterized protein LOC103339...  89.7    4e-17   
gb|EYU41559.1|  hypothetical protein MIMGU_mgv1a005977mg              89.7    4e-17   
ref|XP_008241334.1|  PREDICTED: uncharacterized protein LOC103339...  89.7    4e-17   
ref|XP_006410835.1|  hypothetical protein EUTSA_v10016620mg           89.4    6e-17   
gb|AES60654.2|  sulfite exporter TauE/SafE family protein             89.7    6e-17   
gb|KDO56904.1|  hypothetical protein CISIN_1g0454881mg                83.2    7e-17   
ref|XP_010936218.1|  PREDICTED: uncharacterized protein LOC105055...  89.4    7e-17   
ref|XP_010050180.1|  PREDICTED: uncharacterized protein LOC104438693  89.0    7e-17   
gb|EYU38596.1|  hypothetical protein MIMGU_mgv1a005752mg              89.0    9e-17   
ref|XP_006838739.1|  hypothetical protein AMTR_s00002p00254220        88.6    1e-16   
ref|XP_009603782.1|  PREDICTED: uncharacterized protein LOC104098687  88.6    1e-16   
ref|XP_002528632.1|  conserved hypothetical protein                   88.2    1e-16   
ref|NP_001051136.1|  Os03g0726500                                     88.6    1e-16   
gb|EAY91726.1|  hypothetical protein OsI_13369                        88.6    1e-16   
gb|KJB54850.1|  hypothetical protein B456_009G051700                  87.8    2e-16   
ref|XP_009388390.1|  PREDICTED: uncharacterized protein LOC103975...  87.8    2e-16   
ref|XP_009388389.1|  PREDICTED: uncharacterized protein LOC103975...  87.8    2e-16   
ref|XP_009760234.1|  PREDICTED: uncharacterized protein LOC104212618  87.4    2e-16   
ref|NP_001168709.1|  uncharacterized protein LOC100382501             87.4    3e-16   
ref|XP_004981916.1|  PREDICTED: uncharacterized protein LOC101758770  87.4    3e-16   
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein             87.0    3e-16   
ref|XP_009615566.1|  PREDICTED: uncharacterized protein LOC104108278  87.0    3e-16   
ref|XP_003560372.1|  PREDICTED: uncharacterized protein LOC100844938  87.0    4e-16   
gb|EEE59848.1|  hypothetical protein OsJ_12424                        86.7    5e-16   
gb|EPS64071.1|  hypothetical protein M569_10711                       81.3    6e-16   
ref|XP_004303051.1|  PREDICTED: uncharacterized protein LOC101313325  84.7    2e-15   
dbj|BAK00649.1|  predicted protein                                    84.0    4e-15   
gb|EMT16950.1|  hypothetical protein F775_12779                       84.0    4e-15   
ref|XP_003629896.1|  hypothetical protein MTR_8g088070                83.2    8e-15   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...  82.8    9e-15   
ref|XP_002463955.1|  hypothetical protein SORBIDRAFT_01g009520        82.8    1e-14   
ref|XP_008790425.1|  PREDICTED: uncharacterized protein LOC103707634  82.0    2e-14   
gb|KHN48052.1|  hypothetical protein glysoja_015522                   80.9    3e-14   
gb|KHN06459.1|  hypothetical protein glysoja_010803                   81.3    3e-14   
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950        79.3    1e-13   
gb|KHN02273.1|  60S ribosomal protein L24                             79.3    2e-13   
ref|XP_003590403.1|  hypothetical protein MTR_1g061710                76.3    2e-12   
gb|EMS49201.1|  hypothetical protein TRIUR3_18274                     71.2    9e-12   
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...  72.8    2e-11   
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...  72.0    4e-11   
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...  71.2    8e-11   
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...  69.7    2e-10   
gb|KEH40299.1|  sulfite exporter TauE/SafE family protein             69.3    3e-10   
gb|KEH24089.1|  sulfite exporter TauE/SafE family protein             66.2    3e-09   
ref|XP_007217409.1|  hypothetical protein PRUPE_ppa025656mg           65.1    4e-09   
ref|XP_002990023.1|  hypothetical protein SELMODRAFT_184956           65.1    7e-09   
ref|XP_002968975.1|  hypothetical protein SELMODRAFT_170159           64.7    7e-09   
ref|NP_001175555.1|  Os08g0389733                                     60.1    1e-08   
gb|EMS50771.1|  hypothetical protein TRIUR3_13143                     63.9    1e-08   
gb|EMT22888.1|  hypothetical protein F775_28607                       63.9    2e-08   
gb|EMT30170.1|  hypothetical protein F775_26300                       60.1    3e-07   
gb|EMS56955.1|  hypothetical protein TRIUR3_23950                     59.7    5e-07   
ref|XP_002980486.1|  hypothetical protein SELMODRAFT_55219            56.2    6e-06   
ref|XP_002962601.1|  hypothetical protein SELMODRAFT_65204            56.2    7e-06   
ref|XP_010104542.1|  hypothetical protein L484_025516                 53.9    9e-06   
ref|XP_002460081.1|  hypothetical protein SORBIDRAFT_02g022480        47.4    1e-05   
ref|XP_001774657.1|  predicted protein                                55.1    2e-05   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg           53.5    6e-05   



>gb|KHG13748.1| Flavonol synthase/flavanone 3-hydroxylase [Gossypium arboreum]
Length=303

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ TAVAT AAF+GQHVVRRLI V 
Sbjct  195  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAVATFAAFVGQHVVRRLIIVF  254

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSA+SLGGVGISNMI+KIH++EYMGFENLCKY
Sbjct  255  GRASLIIFILAFTIFVSAVSLGGVGISNMIDKIHHNEYMGFENLCKY  301



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA +  AV TVAAFIGQHVVR+LI +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYFVAVVTVAAFIGQHVVRKLINIL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI+KI  HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMIQKIQRHEYMGFENLCKY  475



>gb|KJB07537.1| hypothetical protein B456_001G028700 [Gossypium raimondii]
Length=475

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ TAVAT AAF+GQHVVRRLI V 
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAVATFAAFVGQHVVRRLIIVF  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSA+SLGGVGISNMI+KIH++EYMGFENLCKY
Sbjct  427  GRASLIIFILAFTIFVSAVSLGGVGISNMIDKIHHNEYMGFENLCKY  473



>ref|XP_008357417.1| PREDICTED: uncharacterized protein LOC103421160 [Malus domestica]
Length=265

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+VRRLI + 
Sbjct  157  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILF  216

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EYMGFENLCKY V
Sbjct  217  GRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEYMGFENLCKYDV  265



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVATVAA +GQHVVRR+I +L
Sbjct  375  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAALVGQHVVRRMIVIL  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMIEKI +HEYMGFENLCKY
Sbjct  435  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIQHHEYMGFENLCKY  481



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+  AV+T+AAF+GQHVVRRLI++L
Sbjct  375  PPQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYFVAVSTIAAFVGQHVVRRLISIL  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSAISLGGVGI+NMIEKI NHEYMGF+N+C Y
Sbjct  435  GRASLIIFILSFTIFVSAISLGGVGIANMIEKIENHEYMGFDNICSY  481



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++L  VAT+AAFIGQHVVRRLI++L
Sbjct  370  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLVLVATIAAFIGQHVVRRLISIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIF+SAISLGGVG+SNMI KI  HEYMGFENLC+Y V
Sbjct  430  GRASLIIFILAFTIFISAISLGGVGLSNMIGKIERHEYMGFENLCRYEV  478



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAFIGQHVVRRLI VL
Sbjct  373  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFIGQHVVRRLIIVL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  433  GRASLIIFILSFTIFVSAISLGGVGISNMIYKIEKHEYMGFENLCKY  479



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAFIGQHVVR+LI VL
Sbjct  372  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFIGQHVVRKLIIVL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL+FTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY V
Sbjct  432  GRASIIIFILSFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYAV  480



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVRRLI VL
Sbjct  370  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIVVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY V
Sbjct  430  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYEV  478



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVRRLI VL
Sbjct  370  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIVVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY V
Sbjct  430  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKYEV  478



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+VRRLI + 
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILF  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSA+SLGGVGISNMI KI+ HEYMGFENLCKY V
Sbjct  427  GRASLIIFILAFTIFVSAVSLGGVGISNMIGKINQHEYMGFENLCKYDV  475



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PP+VSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+   VAT AA +GQH+VRRLI VL
Sbjct  372  PPEVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVMVATFAALVGQHIVRRLIIVL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  432  GRASLIIFILAFTIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  478



>ref|XP_008347634.1| PREDICTED: uncharacterized protein LOC103410743 isoform X2 [Malus 
domestica]
Length=360

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+VRRLI + 
Sbjct  252  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILF  311

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EYMGFENLCKY V
Sbjct  312  GRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEYMGFENLCKYDV  360



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+VRRLI + 
Sbjct  381  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILF  440

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNM+ KI+ HEYMGFENLCKY V
Sbjct  441  GRASLIIFILAFTIFVSAISLGGVGISNMVGKINRHEYMGFENLCKYDV  489



>gb|KDO79725.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=365

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQHVVR+LI +L
Sbjct  257  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILL  316

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  317  GRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  363



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            P QVSSATATFAM FS+SMSV+EYYLLKRFPVPYAL+  +V+TVAAF+GQHVVRRLI++L
Sbjct  374  PAQVSSATATFAMTFSASMSVIEYYLLKRFPVPYALYFVSVSTVAAFVGQHVVRRLISIL  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI+NM+EKI NH+YMGFENLC Y
Sbjct  434  GRASIIIFILAFTIFVSAISLGGVGIANMVEKIENHQYMGFENLCTY  480



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQHVVRRLI VL
Sbjct  369  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHVVRRLIFVL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI   EYMGFENLCKY
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEYMGFENLCKY  475



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAA IGQHVVRR+I +L
Sbjct  368  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAALIGQHVVRRMIMIL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  428  GRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  474



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VA VAAF+GQHVVRRLI ++
Sbjct  370  PPQVSSATATFAMTFSSSMSVVEYYLLDRFPVPYALYFITVAAVAAFVGQHVVRRLIILM  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEYMGFENLC+Y
Sbjct  430  GRASLIIFILAFTIFVSAISLGGVGISNMIRKIKDHEYMGFENLCRY  476



>ref|XP_007161545.1| hypothetical protein PHAVU_001G078400g, partial [Phaseolus vulgaris]
 gb|ESW33539.1| hypothetical protein PHAVU_001G078400g, partial [Phaseolus vulgaris]
Length=107

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VVEYYLLKRFPVPYAL+    A ++A +GQH+VR+LI +LGRASLIIF+LAFTIFVSA+S
Sbjct  19   VVEYYLLKRFPVPYALYFIVAAAISAIVGQHIVRKLIQLLGRASLIIFVLAFTIFVSAVS  78

Query  491  LGGVGISNMIEKIHNHEYMGFENLCKY  411
            LGGVGI+ M++KI NHEYMGF++LCKY
Sbjct  79   LGGVGIAAMVKKIENHEYMGFDDLCKY  105



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQH+VRRLI + 
Sbjct  368  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHIVRRLIILF  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EYMGFENLCKY
Sbjct  428  GRASLIIFILAFTIFVSAISLGGVGISNMIVKIHQNEYMGFENLCKY  474



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVATVAA +GQHVVRR+I +L
Sbjct  375  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAALVGQHVVRRMIVIL  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  435  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIERHEYMGFENLCKY  481



>gb|KDO79723.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=425

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQHVVR+LI +L
Sbjct  317  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILL  376

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  377  GRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  423



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAFIGQHVVR+LI +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFIGQHVVRKLIILL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  475



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++LTAVATVAA +GQH+VRRLI + 
Sbjct  368  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYLTAVATVAALVGQHIVRRLIILF  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI+ +EYMGFENLCKY V
Sbjct  428  GRASLIIFILAFTIFVSAISLGGVGISNMIGKINRNEYMGFENLCKYDV  476



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA +  AVATVAAF+GQH VR+LI +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAAYFVAVATVAAFVGQHAVRKLINIL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMIHKIQRHEYMGFENLCKY  475



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+  AVATVAAFIGQH VRR+I +L
Sbjct  374  PPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYFIAVATVAAFIGQHFVRRIIILL  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI +HEYMGFENLCKY
Sbjct  434  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIEHHEYMGFENLCKY  480



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+SMSVVEYYLL RFPVPYA +  AVA VAA IGQHVVRRLI+ L
Sbjct  363  PPQVSSATATFAMMFSASMSVVEYYLLNRFPVPYAAYFVAVAFVAAIIGQHVVRRLISWL  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  423  GRASLIIFILAFMIFVSAISLGGVGISNMIHKIEQHEYMGFENLCKY  469



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L+ VAT+AA +GQH+VRRLI + 
Sbjct  362  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLSLVATIAALVGQHIVRRLIILF  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIF+SAISLGGVGISNM+ KI NHEYMGFEN+CKYG
Sbjct  422  GRASLIIFILAGTIFISAISLGGVGISNMVHKIANHEYMGFENICKYG  469



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF+GQHVVR+LI +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFVGQHVVRKLIILL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI K H HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFMIFVSAISLGGVGISNMIGKFHRHEYMGFENLCKY  475



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRRLI+ L
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAALVGQHVVRRLISAL  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  427  GRASLIIFILASTIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  474



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  AVA VAA +GQH+V+RLI +L
Sbjct  366  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEIL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNM++KI +HEYMGF+NLCKY
Sbjct  426  GRASLIIFILAFTIFVSAISLGGVGISNMVQKIQHHEYMGFDNLCKY  472



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  AVA VAA +GQH+V+RLI +L
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVAVALVAALVGQHIVKRLIEIL  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNM++KI +HEYMGF+NLCKY
Sbjct  427  GRASLIIFILAFTIFVSAISLGGVGISNMVQKIQHHEYMGFDNLCKY  473



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVATVAAFIGQHVVR+LI +L
Sbjct  373  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFIGQHVVRKLIIIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSA+SLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  433  GRASLIIFILSLTIFVSAVSLGGVGISNMIGKIQRHEYMGFENLCKY  479



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRRLIA L
Sbjct  364  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAALVGQHVVRRLIAAL  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF SAISLGGVGI+NMI KI  HEYMGFENLCKYG
Sbjct  424  GRASLIIFILASMIFTSAISLGGVGIANMIGKIQRHEYMGFENLCKYG  471



>gb|AAY63998.1| unknown [Brassica napus]
Length=348

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVRRLIAVL
Sbjct  240  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVL  299

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  300  GRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  346



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQH+V+RLI +L
Sbjct  366  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEIL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGISNM++KI +HEYMGFENLCKY
Sbjct  426  GRASLIIFILASTIFISAISLGGVGISNMVQKIQHHEYMGFENLCKY  472



>ref|XP_006660551.1| PREDICTED: uncharacterized protein LOC102715329 [Oryza brachyantha]
Length=470

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+  AVA +AA IGQHVVRRLI  L
Sbjct  362  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVAVAFIAAIIGQHVVRRLINWL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  422  GRASLIIFILAFMIFVSAISLGGVGISNMIHKIQQHEYMGFENLCKY  468



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++  AVAT AAFIGQH+VRRLI + 
Sbjct  371  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFVAVATFAAFIGQHIVRRLIIMF  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEYMGFENLCKY
Sbjct  431  GRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEYMGFENLCKY  477



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAA +GQH+VRRLI + 
Sbjct  368  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAALVGQHIVRRLIILF  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KIH +EYMGFENLCKY
Sbjct  428  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIHQNEYMGFENLCKY  474



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   VA +AA IGQHVVRRLI  L
Sbjct  357  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWL  416

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI KI+ HEYMGFENLCKY
Sbjct  417  GRASLIIFILAFMIFVSAISLGGVGISNMIHKINQHEYMGFENLCKY  463



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ TAVAT+AA IGQH+VR+LI V 
Sbjct  375  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTAVATIAALIGQHIVRKLIIVF  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSA+SLGGVGISNMI KI  HEYMGFENLC Y
Sbjct  435  GRASLIIFILAFTIFVSAVSLGGVGISNMIGKIERHEYMGFENLCMY  481



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQH+V+RLI +L
Sbjct  391  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEIL  450

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGISNM++KI +HEYMGFENLCKY
Sbjct  451  GRASLIIFILASTIFISAISLGGVGISNMVQKIQHHEYMGFENLCKY  497



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PP+V+SATAT  M FSSSMSVVEYYLL RFPVPYA++  AVATVAA +GQH++ +LIA+ 
Sbjct  369  PPEVTSATATLGMTFSSSMSVVEYYLLNRFPVPYAVYFIAVATVAALVGQHIMSKLIAIF  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KIH HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIHRHEYMGFENLCKY  475



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AAF+GQHVVRRLIA L
Sbjct  371  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAFVGQHVVRRLIAAL  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  431  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  478



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYA++ T VA +AAF+GQH+VR+LI VL
Sbjct  360  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYAVYFTLVAVIAAFVGQHIVRKLIIVL  419

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIF SA+SLGGVGI NM+ KI NHEYMGF+NLCKYG
Sbjct  420  GRASLIIFILASTIFASAVSLGGVGIVNMVHKIQNHEYMGFDNLCKYG  467



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQ+VV+RLI +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFISVALVAAFVGQYVVKRLIDIL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSA+SLGGVGISNM++KI +H YMGFENLCKY V
Sbjct  429  GRASLIIFILAFTIFVSAVSLGGVGISNMVQKIQHHGYMGFENLCKYEV  477



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  +VAT+AA IGQH+VRR+I + 
Sbjct  368  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVSVATIAALIGQHIVRRMIIMF  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI ++EYMGFENLCKY
Sbjct  428  GRASLIIFILAFTIFVSAISLGGVGISNMIWKIQHNEYMGFENLCKY  474



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVRR+I +L
Sbjct  366  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRMIMIL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  426  GRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  472



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVRR+I +L
Sbjct  368  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRMIMIL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  428  GRASLIIFILASTIFVSAISLGGVGISNMIGKIQRHEYMGFENLCKY  474



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   VA+ AA +GQHVVR++I +L
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFALVASGAALVGQHVVRKIIILL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAI+LGGVGISNMI KI N EYMGFENLC Y
Sbjct  429  GRASLIIFILAFTIFVSAITLGGVGISNMIHKIQNREYMGFENLCSY  475



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+  AVATVAAF+GQHVVRRLIAVL
Sbjct  370  PPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYFVAVATVAAFVGQHVVRRLIAVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEYMGFENLC Y +
Sbjct  430  GRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEYMGFENLCMYDI  478



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYY+LKRFPVPYAL+  AVATVAAF+GQHVVRRLIAVL
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYILKRFPVPYALYFVAVATVAAFVGQHVVRRLIAVL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAF IF+SAISLGGVGISNM+ KI  HEYMGFENLC Y +
Sbjct  429  GRASLIIFILAFMIFISAISLGGVGISNMVGKIQRHEYMGFENLCMYDI  477



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   VA +AA IGQHVVRRLI  L
Sbjct  373  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEYMGFENLCKY
Sbjct  433  GRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEYMGFENLCKY  479



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYAL+   VA +AA IGQHVVRRLI  L
Sbjct  373  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALYFVIVAFIAAIIGQHVVRRLINWL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVGISNMI +I+ HEYMGFENLCKY
Sbjct  433  GRASLIIFILAFMIFVSAISLGGVGISNMIHRINQHEYMGFENLCKY  479



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA++GQHVVRRLIA +
Sbjct  368  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAWVGQHVVRRLIAAI  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  428  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  475



>gb|KJB54849.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=474

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ T VATVAAFIGQHVVR+LI + 
Sbjct  366  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTGVATVAAFIGQHVVRKLIILF  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  426  GRASLIIFILASTIFVSAISLGGVGISNMIGKIERHEYMGFENLCKY  472



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRRLI+ L
Sbjct  364  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAIVGQHVVRRLISAL  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  424  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  471



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+SMSVVEYYLL RFPVPYA++  AVA +AA IGQH VR+LI+ L
Sbjct  361  PPQVSSATATFAMMFSASMSVVEYYLLNRFPVPYAVYFVAVAFIAAIIGQHAVRKLISWL  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVG+SNMI+KI  HEYMGFENLCKY
Sbjct  421  GRASLIIFILAFMIFVSAISLGGVGVSNMIQKIQRHEYMGFENLCKY  467



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRRLI+ L
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAIVGQHVVRRLISAL  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  427  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  474



>gb|KJB54846.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=475

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ T VATVAAFIGQHVVR+LI + 
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTGVATVAAFIGQHVVRKLIILF  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  427  GRASLIIFILASTIFVSAISLGGVGISNMIGKIERHEYMGFENLCKY  473



>gb|KHG04871.1| hypothetical protein F383_28778 [Gossypium arboreum]
Length=413

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+ T VATVAAFIGQHVVR+LI + 
Sbjct  305  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFTGVATVAAFIGQHVVRKLIILF  364

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNMI KI  HEYMGFENLCKY
Sbjct  365  GRASLIIFILASTIFVSAISLGGVGISNMIGKIERHEYMGFENLCKY  411



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVRRLIAVL
Sbjct  362  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  422  GRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA +GQHVVRRLI+ L
Sbjct  373  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAALVGQHVVRRLISAL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKYG
Sbjct  433  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKYG  480



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVAT+AAF GQHVVRR+IA+L
Sbjct  372  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVAVATIAAFTGQHVVRRIIAIL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILAFTIFVSAISLGGVGI NMIE I N EYMGFE+LC 
Sbjct  432  GRASLIIFILAFTIFVSAISLGGVGIVNMIEDIENKEYMGFEDLCS  477



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVRRLIAVL
Sbjct  362  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  422  GRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQHVVRRLIAVL
Sbjct  362  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVGVATIAALVGQHVVRRLIAVL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVGI NM+ K+  HEYMGFENLCKY
Sbjct  422  GRASLIIFILASTIFISAISLGGVGIVNMMGKLQRHEYMGFENLCKY  468



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVRRLI VL
Sbjct  369  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQHVVRRLIIVL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNMI KI   EYMGFENLC Y
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMIGKIQRDEYMGFENLCNY  475



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA +   VATVAA +GQHVVRR+IA+L
Sbjct  372  PPQVASATSTFAMTFSSSMSVVQYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAIL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA TIFVSAISLGGVGI++MIEK+ NHEYMGF+NLC+
Sbjct  432  GRASLIIFILALTIFVSAISLGGVGIASMIEKLQNHEYMGFDNLCR  477



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VATVAA  GQH+VR+LI V 
Sbjct  369  PPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYFVIVATVAALFGQHIVRKLIIVF  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGISNM+ KI  HEYMGFENLCKY
Sbjct  429  GRASLIIFILAFTIFVSAISLGGVGISNMVGKIERHEYMGFENLCKY  475



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPV YA++  AVAT AAFIGQH+VRRLI V 
Sbjct  371  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVSYAVYFVAVATFAAFIGQHIVRRLIIVF  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIF+SAISLGGVG++NMI KIH HEYMGFENLCKY
Sbjct  431  GRASLIIFILASTIFISAISLGGVGVANMIGKIHRHEYMGFENLCKY  477



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA + TAVAT+AA  GQHVVRRLI + 
Sbjct  365  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYYTAVATIAAITGQHVVRRLITIF  424

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IF+SAISLGGVG+SNMI KI+++EYMGFENLCKY
Sbjct  425  GRASLIIFILAFMIFISAISLGGVGVSNMIWKINHNEYMGFENLCKY  471



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L AVA VAA +GQHVV+RLI +L
Sbjct  367  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLVAVALVAAIVGQHVVKRLIEIL  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA TIFVSAISLGGVGISNM++KI +HEYMGFENLCKY
Sbjct  427  GRASLIIFILASTIFVSAISLGGVGISNMVQKIQHHEYMGFENLCKY  473



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+   VAT+AAF+GQH+VR+LI + 
Sbjct  331  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILF  390

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEYMGFE+LCKYG
Sbjct  391  GRASLIIFILASTIFVSAVSLGGVGIVNMVHKIQNHEYMGFEDLCKYG  438



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+   VAT+AAF+GQH+VR+LI + 
Sbjct  364  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYFILVATIAAFVGQHIVRKLIILF  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEYMGFE+LCKYG
Sbjct  424  GRASLIIFILASTIFVSAVSLGGVGIVNMVHKIQNHEYMGFEDLCKYG  471



>gb|AAC42255.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15102.1| hypothetical protein [Arabidopsis thaliana]
Length=902

 Score =   137 bits (345),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+L  VAT+AA++GQHVVRRLIA +
Sbjct  223  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYLVGVATIAAWVGQHVVRRLIAAI  282

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI KI  HEYMGFENLCKY
Sbjct  283  GRASLIIFILASMIFISAISLGGVGIVNMIGKIQRHEYMGFENLCKY  329



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA +  AVAT AA +GQ +VRRLIA++
Sbjct  355  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAAYFVAVATFAALVGQILVRRLIAII  414

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILAFTIFVSAISLGGVGISNM+ KI  HEYMGF++LC Y 
Sbjct  415  GRASLIIFILAFTIFVSAISLGGVGISNMVYKIQQHEYMGFDSLCAYA  462



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+L  VAT+AA +GQH+VR+LI + 
Sbjct  376  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYLGLVATIAAVVGQHIVRKLIILF  435

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIF+SAISLGGVGISNM+ KI +HEYMGFEN+CKYG
Sbjct  436  GRASLIIFILAGTIFISAISLGGVGISNMVHKIASHEYMGFENICKYG  483



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA +   VATVAA +GQHVVRR+IA+L
Sbjct  358  PPQVASATSTFAMTFSSSMSVVQYYLLNRFPVPYATYFVLVATVAALVGQHVVRRIIAIL  417

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRASLIIFILA TIFVSAISLGGVGI++MIEK+ NHEYMGF+NLC
Sbjct  418  GRASLIIFILALTIFVSAISLGGVGIASMIEKLQNHEYMGFDNLC  462



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFP+PYAL+   VAT+AAF+GQH+VR+LI + 
Sbjct  369  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPIPYALYFVLVATIAAFVGQHIVRKLIILF  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILA TIFVSA+SLGGVGI NM+ KI NHEYMGFE+LCKYG
Sbjct  429  GRASLIIFILASTIFVSAVSLGGVGIVNMVHKIDNHEYMGFEDLCKYG  476



>tpg|DAA61110.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=404

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++   VA VAA IGQHVVR+LI  L
Sbjct  296  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYFIVVAFVAAIIGQHVVRKLINWL  355

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVG+SNM+ KI  HEYMGFE+LCKY
Sbjct  356  GRASLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEYMGFEDLCKY  402



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYA++L  VAT+AA +GQH+VRRLI + 
Sbjct  370  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAVYLVLVATLAAVVGQHIVRRLIILF  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFILAFTIFVSAISLGGVGIS+MI  I  H YMGFENLCKY V
Sbjct  430  GRASLIIFILAFTIFVSAISLGGVGISDMIGMIERHAYMGFENLCKYKV  478



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   VA+++A +GQHVVR++I+VL
Sbjct  366  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFALVASLSALVGQHVVRKVISVL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EYMGFEN+C Y
Sbjct  426  GRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEYMGFENICTY  472



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQHVVR+LI +L
Sbjct  373  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAFLGQHVVRKLINIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSAISLGGVGI +MIEKI   +YMGFENLC Y
Sbjct  433  GRASLIIFILSFTIFVSAISLGGVGIKDMIEKIEQKDYMGFENLCTY  479



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   VA+++A +GQHVVR++I+VL
Sbjct  366  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFALVASLSALVGQHVVRKVISVL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+I+FILA TIFVSAISLGGVGI++M+EKI N EYMGFEN+C Y
Sbjct  426  GRASIIVFILASTIFVSAISLGGVGIASMVEKIENKEYMGFENICTY  472



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT++AF+GQHVVR++IA L
Sbjct  370  PPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFALVATISAFVGQHVVRKIIAFL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA TIFVSA+SLGGVGI+NM+EK+ N EYMGFENLC+
Sbjct  430  GRASLIIFILALTIFVSAVSLGGVGIANMVEKLENEEYMGFENLCQ  475



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   VA  AA IGQH+VRRLI V 
Sbjct  371  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFVVVAAFAALIGQHIVRRLIIVF  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAI LGG GISN+I KIH+ EYMGFENLCK+
Sbjct  431  GRASLIIFILAFTIFVSAILLGGFGISNIIGKIHHQEYMGFENLCKH  477



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++   VA VAA IGQHVVR+LI  L
Sbjct  362  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYFIVVAFVAAIIGQHVVRKLINWL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSAISLGGVG+SNM+ KI  HEYMGFE+LCKY
Sbjct  422  GRASLIIFILAFMIFVSAISLGGVGVSNMVHKIERHEYMGFEDLCKY  468



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VVEYYLLKRFPVPYAL+L+ VAT+AA +GQH+VRRLI + GRASLIIFILA TIF+SAIS
Sbjct  392  VVEYYLLKRFPVPYALYLSLVATIAALVGQHIVRRLIILFGRASLIIFILAGTIFISAIS  451

Query  491  LGGVGISNMIEKIHNHEYMGFENLCKYG  408
            LGGVGISNM+ KI NHEYMGFEN+CKYG
Sbjct  452  LGGVGISNMVHKIANHEYMGFENICKYG  479



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA++ T VA  AA IGQH VR+LI  L
Sbjct  362  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVYFTIVAFAAALIGQHAVRKLINWL  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSA+SLGGVGISNM+ KI  HEYMGFENLCKY
Sbjct  422  GRASLIIFILAFMIFVSALSLGGVGISNMVHKIARHEYMGFENLCKY  468



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT+AAF GQHV+RR+IA+L
Sbjct  370  PPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  430  GRASIIIFILALTIFVSAISLGGVGIANMVEKLENDEYMGFENLC  474



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAFIGQH VR+LI +L
Sbjct  369  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFIGQHFVRKLIIIL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EYMGFENLCKY V
Sbjct  429  GRASIIIFILASTIFISAISLGGVGISNMIGKIERNEYMGFENLCKYQV  477



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYAL+  AVATVAAFIGQH VR+LI +L
Sbjct  373  PPQVSSATATFAMMFSSSMSVVEYYLLKRFPVPYALYFVAVATVAAFIGQHFVRKLIIIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFILA TIF+SAISLGGVGISNMI KI  +EYMGFENLCKY V
Sbjct  433  GRASIIIFILASTIFISAISLGGVGISNMIGKIERNEYMGFENLCKYQV  481



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT++A +GQHVVR++IA L
Sbjct  370  PPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFALVATISALVGQHVVRKIIAFL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRASLIIFILA TIFVSA+SLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  430  GRASLIIFILALTIFVSAVSLGGVGIANMVEKLENEEYMGFENLC  474



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYA+F   VA  AA IGQH+VR+L+  L
Sbjct  360  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYAVFFVVVAFFAAIIGQHIVRKLVNWL  419

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF IFVSA+SLGGVGISNM+ KI +HEYMGFENLCKY
Sbjct  420  GRASLIIFILAFMIFVSALSLGGVGISNMVNKIAHHEYMGFENLCKY  466



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +GQHVVRRLIAV+
Sbjct  354  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALVGQHVVRRLIAVI  413

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  414  GRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  460



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +GQHVVRRLIAV+
Sbjct  355  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALVGQHVVRRLIAVI  414

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  415  GRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  461



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVVEYYLL RFPVPYA +   VAT+AAF GQHV+RR+IA+L
Sbjct  370  PPQVASATSTFAMAFSSSMSVVEYYLLNRFPVPYAAYFVLVATIAAFAGQHVIRRIIAIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFENLC
Sbjct  430  GRASIIIFILALTIFVSAISLGGVGIANMVEKLENDEYMGFENLC  474



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQ VVR+LI +L
Sbjct  381  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLL  440

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSAISLGGVGI NMIEKI +HEYMGFEN+C Y
Sbjct  441  GRASLIIFILSFTIFVSAISLGGVGIENMIEKIEHHEYMGFENICSY  487



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATVAAF+GQ VVR+LI +L
Sbjct  377  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVAAFVGQFVVRKLINLL  436

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSAISLGGVGI NMIEKI +HEYMGFEN+C Y
Sbjct  437  GRASLIIFILSFTIFVSAISLGGVGIENMIEKIEHHEYMGFENICSY  483



>ref|XP_010667910.1| PREDICTED: uncharacterized protein LOC104884897 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=347

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+  AVA VAAF+GQH+VR+LI +L
Sbjct  239  PPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYFMAVAIVAAFVGQHLVRKLIILL  298

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H YMGFENLCKY
Sbjct  299  GRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHYMGFENLCKY  345



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+   VAT+AA +GQHV+RRLI VL
Sbjct  370  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFVGVATIAALVGQHVIRRLITVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFENLCKY
Sbjct  430  GRASLIIFILASMIFISAISLGGVGIVNMIGKYQRHEYMGFENLCKY  476



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYAL+  AVA ++A +GQH+VR+LI VL
Sbjct  361  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYALYFIAVAAISAIVGQHIVRKLIDVL  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIF+LAFTI VSA+SLGGVGI  M++KI NHEYMGF++LC Y
Sbjct  421  GRASLIIFVLAFTILVSAVSLGGVGIVAMVKKIENHEYMGFDDLCTY  467



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+L
Sbjct  372  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAIL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLGGVGISNMI+KI N EYMGFENLC Y
Sbjct  432  GRASLIIFILSGTIFVSAISLGGVGISNMIQKIANKEYMGFENLCTY  478



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  336  PPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  395

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EYMGFENLCK
Sbjct  396  GRASIIIFILALTIFISAISLGGVGIADMVEKLENEEYMGFENLCK  441



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL+RFPVPY ++L  VAT+AAF+GQHVV RLI V+
Sbjct  373  PPQVSSATATFAMMFSSSMSVVEYYLLRRFPVPYGVYLAVVATMAAFVGQHVVGRLIVVM  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFIL+FTIFVSAISLGGVGISNM+ KI  HEYMGF+NLC Y
Sbjct  433  GRASIIIFILSFTIFVSAISLGGVGISNMVGKIAGHEYMGFDNLCSY  479



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSV+EYYLL+RFPVPYAL+L AVAT++A +GQHVVR+++ +L
Sbjct  381  PPQVSSATATFAMTFSASMSVIEYYLLRRFPVPYALYLAAVATLSAIVGQHVVRKVVMIL  440

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++M+EKI + EYMGFEN+C Y
Sbjct  441  GRASIIIFILAFTIFVSAISLGGVGIADMVEKIEHKEYMGFENICTY  487



>gb|KHN41986.1| hypothetical protein glysoja_003726 [Glycine soja]
Length=198

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VL
Sbjct  91   PPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVL  150

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI N+IEKI +HEYMGFE+LC
Sbjct  151  GRASIIIFILALTIFISAISLGGVGIENIIEKIESHEYMGFEDLC  195



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+ YAL+  AVA VAAF+GQH+VR+LI +L
Sbjct  370  PPQVSSATATFAMAFSASMSVVEYYLLKRFPITYALYFMAVAIVAAFVGQHLVRKLIILL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAF+IFVSA+SLGGVGISNMI+  H H YMGFENLCKY
Sbjct  430  GRASLIIFILAFSIFVSAVSLGGVGISNMIKMFHRHHYMGFENLCKY  476



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  369  PPQVASATSTFAMVFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M+EK+ N EYMGFENLCK
Sbjct  429  GRASIIIFILALTIFISAISLGGVGIADMVEKLENEEYMGFENLCK  474



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+L
Sbjct  379  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAIL  438

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLGGVGISNMI+KI N EYMGFENLC Y
Sbjct  439  GRASLIIFILSGTIFVSAISLGGVGISNMIQKIANKEYMGFENLCTY  485



>ref|XP_003537580.2| PREDICTED: uncharacterized protein LOC100817312 [Glycine max]
Length=204

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VL
Sbjct  97   PPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVL  156

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI N+IEKI +HEYMGFE+LC
Sbjct  157  GRASIIIFILALTIFISAISLGGVGIENIIEKIESHEYMGFEDLC  201



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
             PQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AVATV+AF+GQ VVR+LI +L
Sbjct  377  SPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFVAVATVSAFVGQFVVRKLINLL  436

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIFVSAISLGGVGI NMIEKI +H+YMGFEN+C Y
Sbjct  437  GRASLIIFILAFTIFVSAISLGGVGIVNMIEKIEHHDYMGFENICSY  483



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSV+EYYLLKRFPVPYAL+L  VATVAA +GQHVVR+LIAV+
Sbjct  354  PPQVSSATATFAMTFSSSMSVIEYYLLKRFPVPYALYLVGVATVAALVGQHVVRKLIAVI  413

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI K   HEYMGFEN+CKY
Sbjct  414  GRASLIIFILASMIFISAISLGGVGIVNMIGKFQRHEYMGFENICKY  460



>dbj|BAG89362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA  AA IGQH+VR+LI  L
Sbjct  241  PPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWL  300

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N+C Y V
Sbjct  301  GRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDNICNYDV  349



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+L
Sbjct  368  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAIL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLGGVGISNMI++I N EYMGFENLC Y
Sbjct  428  GRASLIIFILSSTIFVSAISLGGVGISNMIQRIANKEYMGFENLCTY  474



>gb|KDP37236.1| hypothetical protein JCGZ_06292 [Jatropha curcas]
Length=411

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSAT TF M FS+SMSV+EYYLLKRFPVPYAL+    A  AAF+GQHVVR+LI++L
Sbjct  303  PPQVSSATTTFVMTFSASMSVIEYYLLKRFPVPYALYFFGAAIFAAFVGQHVVRKLISIL  362

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILAFTIFVSAI LGGVGI++MI++I   EYMGFEN+C YG
Sbjct  363  GRASLIIFILAFTIFVSAILLGGVGIAHMIKRIERSEYMGFENICSYG  410



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQHV+RRLI ++
Sbjct  363  PPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQHVIRRLINLI  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  423  GRASLIIFILSFTIFVSALSLGGVGISKMIRQIQRHEYMGFENLCKY  469



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLLKRFPVPYA F   VATVAA +GQHVVR++IA+L
Sbjct  373  PPQVASATSTFAMVFSSSMSVVQYYLLKRFPVPYATFFVLVATVAALVGQHVVRKIIAIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI +M+EK+ N EYMGFENLC
Sbjct  433  GRASIIIFILALTIFVSAISLGGVGIVDMVEKLTNEEYMGFENLC  477



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLL RFPVPYAL+   VA VAA++GQ+VVRRLI ++
Sbjct  370  PPQVSSATATFAMTFSSSMSVVEYYLLNRFPVPYALYFVTVAAVAAYVGQNVVRRLIILM  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIF+SAISLGGVGISN+I KI +HEYMGFENLC+Y
Sbjct  430  GRASLIIFILAFTIFISAISLGGVGISNIIRKIKHHEYMGFENLCRY  476



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ TAVAT +A +GQ+VVR+++++ 
Sbjct  320  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYFTAVATFSALVGQYVVRKVVSIF  379

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EYMGFEN+C Y
Sbjct  380  GRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEYMGFENICTY  426



>ref|XP_006660104.1| PREDICTED: uncharacterized protein LOC102707608 [Oryza brachyantha]
Length=446

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T  A  AA +GQHVVR+LI  L
Sbjct  338  PPQVSSATATFAMMFSSSMSVVEYYLLNRFPVPYALFFTVTAFFAAIVGQHVVRKLINWL  397

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFIL+F IFVSAISLGGVGISNM+ KI  HEYMGF+N+C Y V
Sbjct  398  GRASLIIFILSFMIFVSAISLGGVGISNMVGKISRHEYMGFDNICNYDV  446



>gb|EAZ42610.1| hypothetical protein OsJ_27176 [Oryza sativa Japonica Group]
Length=442

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA  AA IGQH+VR+LI  L
Sbjct  334  PPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWL  393

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N+C Y V
Sbjct  394  GRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDNICNYDV  442



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  +VAT+AA +GQHVVRR+IA+L
Sbjct  372  PPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYFVSVATIAALVGQHVVRRVIALL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NMIEK+ N +YMGF+NLC
Sbjct  432  GRASIIIFILAMTIFVSAISLGGVGIANMIEKLENKDYMGFDNLC  476



>ref|XP_010113488.1| hypothetical protein L484_026823 [Morus notabilis]
 gb|EXC35515.1| hypothetical protein L484_026823 [Morus notabilis]
Length=460

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLLKRFPVPYA +   VAT+AAF GQHVVR++IAV+
Sbjct  353  PPQVASATSTFAMVFSSSMSVVQYYLLKRFPVPYASYFVLVATIAAFTGQHVVRKIIAVV  412

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  413  GRASIIIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  457



>gb|EEC83519.1| hypothetical protein OsI_29108 [Oryza sativa Indica Group]
Length=466

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA  AA IGQH+VR+LI  L
Sbjct  358  PPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTTVAFFAAIIGQHIVRKLINWL  417

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N+C Y V
Sbjct  418  GRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDNICNYDV  466



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  368  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  428  GRASIIIFILALTIFVSAISLGGVGIANMVEKMENREYMGFENFC  472



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  +VAT+AA +GQHVVRR+IA+L
Sbjct  373  PPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYAAYFVSVATIAALVGQHVVRRVIALL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NMIEK+ N +YMGF+NLC
Sbjct  433  GRASIIIFILAMTIFVSAISLGGVGIANMIEKLENKDYMGFDNLC  477



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  370  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVVVATIAAFTGQHVVRKIIAVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  430  GRASIIIFILALTIFVSAISLGGVGIANMVEKMENREYMGFENFC  474



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEYYLL RFPVPYALF T VA  AA IGQH+VR+LI  L
Sbjct  357  PPQVSSATATFAMMFSSSMSVVEYYLLDRFPVPYALFFTVVAFFAAIIGQHIVRKLINWL  416

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRASLIIFIL+F IF+SAISLGGVGISNMI KI  HEYMGF+N+C Y V
Sbjct  417  GRASLIIFILSFMIFISAISLGGVGISNMIGKIARHEYMGFDNICNYDV  465



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  370  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  430  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  474



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VL
Sbjct  334  PPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVL  393

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI N+IEKI NHEYMGFE+LC
Sbjct  394  GRASIIIFILALTIFISAISLGGVGIENIIEKIENHEYMGFEDLC  438



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  368  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  428  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  472



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YY+LKRFPVP+A +   VATVAA +GQHVVR++IA+L
Sbjct  374  PPQVASATSTFAMTFSSSMSVVQYYILKRFPVPFASYFVLVATVAAIVGQHVVRKIIAIL  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GR S+IIFILA TIFVSAISLGGVGISNM+EK+ N EYMGFE+LC
Sbjct  434  GRTSIIIFILALTIFVSAISLGGVGISNMVEKLENQEYMGFESLC  478



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  379  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  438

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  439  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  483



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VL
Sbjct  363  PPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALVATIAAFTGQHVVRKVIVVL  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI N+IEKI NHEYMGFE+LC
Sbjct  423  GRASIIIFILALTIFISAISLGGVGIENIIEKIENHEYMGFEDLC  467



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  377  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  436

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  437  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  481



>ref|XP_008353719.1| PREDICTED: uncharacterized protein LOC103417306 [Malus domestica]
Length=1022

 Score =   132 bits (331),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  731   PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
             PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PYAL+ TAVAT +A +GQ+VVR+++++ 
Sbjct  914   PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYALYFTAVATFSALVGQYVVRKVVSIF  973

Query  551   GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
             GRAS+IIFILAFTIFVSAISLGGVGI++MIEKI + EYMGFEN+C Y
Sbjct  974   GRASIIIFILAFTIFVSAISLGGVGIADMIEKIKHKEYMGFENICTY  1020



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  379  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  438

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  439  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  483



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF M+FSSSMSVV+YYLL RFPVPYA +L  VAT+AA  GQHVVR+++A+ 
Sbjct  365  PPQVASATSTFVMVFSSSMSVVQYYLLDRFPVPYASYLVLVATIAALTGQHVVRKMVAIF  424

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILAFTIFVSAISLGGVGI NM+EK+ N +YMGF+NLC
Sbjct  425  GRASIIIFILAFTIFVSAISLGGVGIENMVEKMENEDYMGFDNLC  469



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  375  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  435  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  479



>gb|KDO79523.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
 gb|KDO79524.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=347

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVL
Sbjct  240  PPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVL  299

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+I+FILA TIFVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  300  GRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  345



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAVL
Sbjct  377  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVL  436

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  437  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  481



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+S+SVVEYYLLKRFP+PYAL+ TAVAT +A +GQ+VVR++++ L
Sbjct  381  PPQVSSATATFAMTFSASLSVVEYYLLKRFPIPYALYFTAVATFSALVGQYVVRKVVSFL  440

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI +MIEKI + EYMGFEN+C Y
Sbjct  441  GRASIIIFILAFTIFVSAISLGGVGIVDMIEKIKHKEYMGFENICTY  487



>ref|XP_010235081.1| PREDICTED: uncharacterized protein LOC100846525 isoform X2 [Brachypodium 
distachyon]
Length=373

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSAT+TFAMMFS+SMSVVEYYLLKRFPVPYA F T VA +AA +GQ VVR++I+ L
Sbjct  265  PPQVSSATSTFAMMFSASMSVVEYYLLKRFPVPYAAFFTIVAFLAAIVGQGVVRKMISWL  324

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIF+L+F IF+SA+SLGGVG SNMI KI  HEY+GFEN+CKY
Sbjct  325  GRASLIIFVLSFMIFISALSLGGVGTSNMIHKITQHEYLGFENICKY  371



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+   VATVAAF+GQH+VR+LI + 
Sbjct  364  PPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLIIIT  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEYMGF+NLC +G
Sbjct  424  GRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEYMGFDNLCNFG  471



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PP+VSSATATF M +SSSMSVVEYYLLKRFPVPYAL+   VATVAAF+GQH+VR+LI + 
Sbjct  366  PPEVSSATATFGMTYSSSMSVVEYYLLKRFPVPYALYFILVATVAAFVGQHIVRKLIIIT  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRAS+IIFIL+FTIFVSAI LGGVG+SNMI KI  HEYMGF+NLC +G
Sbjct  426  GRASIIIFILSFTIFVSAILLGGVGLSNMIGKIERHEYMGFDNLCNFG  473



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQHV+R+LI ++
Sbjct  363  PPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQHVIRKLILLI  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  423  GRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGFENLCKY  469



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSA+ATF M FSSSMSV++YYLL RFPVPYAL+ T VA VAAF+GQHV+R+LI ++
Sbjct  363  PPQVSSASATFGMTFSSSMSVIQYYLLNRFPVPYALYFTIVAAVAAFVGQHVIRKLILLI  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+FTIFVSA+SLGGVGIS MI +I  HEYMGFENLCKY
Sbjct  423  GRASLIIFILSFTIFVSALSLGGVGISKMIGQIQRHEYMGFENLCKY  469



>ref|XP_003574413.1| PREDICTED: uncharacterized protein LOC100846525 isoform X1 [Brachypodium 
distachyon]
Length=461

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSAT+TFAMMFS+SMSVVEYYLLKRFPVPYA F T VA +AA +GQ VVR++I+ L
Sbjct  353  PPQVSSATSTFAMMFSASMSVVEYYLLKRFPVPYAAFFTIVAFLAAIVGQGVVRKMISWL  412

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIF+L+F IF+SA+SLGGVG SNMI KI  HEY+GFEN+CKY
Sbjct  413  GRASLIIFVLSFMIFISALSLGGVGTSNMIHKITQHEYLGFENICKY  459



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA+ 
Sbjct  361  PPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIF  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC----KYGV  405
            GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC    KYGV
Sbjct  421  GRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEYMGFDNLCHHGKKYGV  473



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++AT+AA +GQHV+RR+IA+L
Sbjct  369  PPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSIATIAAVVGQHVIRRVIALL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N +YMGF+NLC
Sbjct  429  GRASIIIFILAMTIFTSAISLGGVGIANMIEKLENQDYMGFDNLC  473



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+YYLLKRFPVPYA +  ++AT+AA +GQHV+RR+IA+L
Sbjct  379  PPQVASATSTFSMTFSSSMSVVQYYLLKRFPVPYATYFVSIATIAAVVGQHVIRRVIALL  438

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF SAISLGGVGI+NMIEK+ N++YMGF+NLC
Sbjct  439  GRASIIIFILAMTIFTSAISLGGVGIANMIEKLKNNDYMGFDNLC  483



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSV+EYYLL RFPVPYAL+L AVAT++A +GQHVVR+++ +L
Sbjct  381  PPQVSSATATFAMTFSASMSVIEYYLLHRFPVPYALYLAAVATLSAVVGQHVVRKVVMIL  440

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++ +EKI + EYMGFEN+C Y
Sbjct  441  GRASIIIFILAFTIFVSAISLGGVGIADTVEKIEHKEYMGFENICTY  487



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA+ 
Sbjct  368  PPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIF  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC----KYGV  405
            GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC    KYGV
Sbjct  428  GRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENEEYMGFDNLCHHGKKYGV  480



>ref|XP_009410875.1| PREDICTED: uncharacterized protein LOC103992760 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSS+SVVEYYLL RFPVPYA++   VATVAAF+GQHVVRRL+ ++
Sbjct  265  PPQVSSATATFAMTFSSSLSVVEYYLLNRFPVPYAVYFIFVATVAAFVGQHVVRRLVILI  324

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILA  IF+SAISLGGVGI NMI+KI +++YMGFENLC+Y
Sbjct  325  GRASLIIFILASMIFISAISLGGVGIVNMIKKIEDNDYMGFENLCRY  371



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SATATFAMMFS+SMSVVEYYLL RFPVPYAL+LT +A +AA IGQ VVR+LI +L
Sbjct  366  PPQVASATATFAMMFSASMSVVEYYLLNRFPVPYALYLTILAFLAAIIGQRVVRKLIDLL  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL+F IF+SA+SLGGVGISN I KI   EYMGFEN+CKYGV
Sbjct  426  GRASIIIFILSFMIFISALSLGGVGISNTIHKIARREYMGFENICKYGV  474



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA+ 
Sbjct  361  PPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIF  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC----KYGV  405
            GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+NLC    KYGV
Sbjct  421  GRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENAEYMGFDNLCHHGKKYGV  473



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YY L RFPVPYA +   VAT AA  GQHVVRR+IAVL
Sbjct  364  PPQVASATSTFAMVFSSSMSVVQYYFLNRFPVPYATYFVIVATFAALAGQHVVRRIIAVL  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GR S+IIFILA TIFVSAISLGGVGI++M+EK+ N EYMGFENLC
Sbjct  424  GRTSIIIFILALTIFVSAISLGGVGIADMVEKLENEEYMGFENLC  468



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVL
Sbjct  370  PPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+I+FILA TIFVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  430  GRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  475



>ref|XP_007156036.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
 gb|ESW28030.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
Length=471

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   +AT+AA  GQHVVR++IA+ 
Sbjct  364  PPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILIATIAALTGQHVVRKIIAIF  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF+LAFTIF+SAISLGGVGI NM+EKI N+EYMGF N+C
Sbjct  424  GRASIIIFVLAFTIFLSAISLGGVGIENMVEKIENNEYMGFANIC  468



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVL
Sbjct  370  PPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+I+FILA TIFVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  430  GRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  475



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAV+
Sbjct  375  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKIIAVV  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TIFVSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  435  GRASIVIFILALTIFVSAISLGGVGIANMVEKMENQEYMGFENFC  479



>gb|KDO79522.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=474

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSVV+YYLL RFPVPYA F T VAT AAF GQHVVR++IAVL
Sbjct  367  PPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKIIAVL  426

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+I+FILA TIFVSAISLGG GI NM++K+ N EYMGFENLC+
Sbjct  427  GRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ  472



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFPVPYA++   +++++A +GQHVVR++I+VL
Sbjct  334  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPVPYAVYFAVMSSLSALVGQHVVRKVISVL  393

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIFVSAISLGGVGI++MI KI + EYMGFEN+C 
Sbjct  394  GRASIIIFILASTIFVSAISLGGVGIADMIGKIEHKEYMGFENICN  439



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF M FS+SMSV+EYYLLKRFPVPYAL+L AVA +AAF+GQHVVR+LI++L
Sbjct  373  PPQVSSATATFIMAFSASMSVIEYYLLKRFPVPYALYLFAVAIIAAFVGQHVVRKLISLL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFTIF SAISLGGVGI+  I+KI   EYMGFE++C Y
Sbjct  433  GRASLIIFILAFTIFASAISLGGVGIARAIKKIERKEYMGFEDICSY  479



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ TAVA+ AA +GQHVVR++I +L
Sbjct  374  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFTAVASFAALVGQHVVRKVINIL  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIFVSAISLGGVGI++ I+KI N+EYMGFEN+C 
Sbjct  434  GRASIIIFILAATIFVSAISLGGVGIADTIQKIENNEYMGFENICT  479



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ 
Sbjct  370  PPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIF  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY---GV*NLYRTTF  381
            GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C     GV   YR+  
Sbjct  430  GRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANICHVNLGGVFPTYRSGS  489

Query  380  YL  375
            +L
Sbjct  490  FL  491



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYA++   +++++A +GQHVVRR+I+VL
Sbjct  374  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYAVYFAVMSSLSALVGQHVVRRVISVL  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIFVSAISLGGVGI+ MI KI   EYMGFEN+C
Sbjct  434  GRASIIIFILASTIFVSAISLGGVGIAAMIGKIERKEYMGFENIC  478



>ref|XP_011466694.1| PREDICTED: uncharacterized protein LOC101294092 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=510

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+ TAVA+ AA +GQHVVR++I +L
Sbjct  405  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFTAVASFAALVGQHVVRKVINIL  464

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIFVSAISLGGVGI++ I+KI N+EYMGFEN+C 
Sbjct  465  GRASIIIFILAATIFVSAISLGGVGIADTIQKIENNEYMGFENICT  510



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ 
Sbjct  369  PPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIF  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C
Sbjct  429  GRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANIC  473



>gb|KJB40204.1| hypothetical protein B456_007G050900 [Gossypium raimondii]
Length=475

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+YYLL RFP+PYA +   VAT+AAF GQHVVR++I VL
Sbjct  368  PPQVASATSTFSMAFSSSMSVVQYYLLNRFPIPYAAYFVLVATIAAFTGQHVVRKIITVL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M+EK+ + EYMGFENLCK
Sbjct  428  GRASIIIFILALTIFISAISLGGVGIADMVEKLEDEEYMGFENLCK  473



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PP+VSSATATFAMMFSSSMSVVEYYLLKRFP+PYAL+ TAVATVAAF+GQ VVRRLI +L
Sbjct  372  PPEVSSATATFAMMFSSSMSVVEYYLLKRFPIPYALYFTAVATVAAFVGQRVVRRLIILL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLGG+GIS MI KI  HEYMG ENLC Y
Sbjct  432  GRASLIIFILSLTIFVSAISLGGIGISRMIHKIERHEYMGLENLCNY  478



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++I VL
Sbjct  363  PPQVASATSTFAMVFSSSMSVVQYYLLDRFPVPYASYFALVATLAAFTGQHVVRKIIVVL  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SA+SLGGVGI N+IEKI  HEYMGFE+LC
Sbjct  423  GRASIIIFILALTIFISALSLGGVGIENIIEKIEKHEYMGFEDLC  467



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL+RFPVPYA +   VAT+AA  GQHVVR++IA+ 
Sbjct  364  PPQVASATSTFAMVFSSSMSVVQYYLLERFPVPYASYFILVATIAALTGQHVVRKIIAIF  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF+LAFTIF+SAISLGGVGI NM+EK+ N+EYMGF N+C
Sbjct  424  GRASIIIFVLAFTIFLSAISLGGVGIENMVEKMENNEYMGFANIC  468



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA +   VAT+AA +GQHVVRRLI +L
Sbjct  368  PPQVASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TI VSAI+LGGVGI NMI+K+ NHEYMGFEN C
Sbjct  428  GRASIIIFILASTILVSAITLGGVGIVNMIQKLENHEYMGFENFC  472



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+L
Sbjct  380  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAIL  439

Query  551  GRASLIIFILAFTIFVSAISLG--GVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLG  GVGISNMI+KI N EYMGFENLC Y
Sbjct  440  GRASLIIFILSGTIFVSAISLGKCGVGISNMIQKIANKEYMGFENLCTY  488



>ref|XP_004504238.1| PREDICTED: uncharacterized protein LOC101507523 [Cicer arietinum]
Length=468

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+ YAL+  AVATVAA IGQH+VR+LIA+L
Sbjct  358  PPQVSSATSTFAMTFSASMSVVEYYLLKRFPISYALYFVAVATVAALIGQHLVRKLIAIL  417

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC+Y V N
Sbjct  418  GRASIIIFILALTVFVSGISLGGTGIANLIKRVENKEYMGFGNLCEYRVRN  468



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YY+LKRFPVPYA +   VAT+AA +GQHVVRRLI +L
Sbjct  369  PPQVASATSTFSMIFSSSMSVVQYYILKRFPVPYAAYFVLVATLAAIVGQHVVRRLITLL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TI VSAI+LGGVGI NMI+K+ NHEYMGFEN C
Sbjct  429  GRASIIIFILASTILVSAITLGGVGIVNMIQKLENHEYMGFENFC  473



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YY L RFPVPYA +   VAT+AAF GQHVVRR+IA+L
Sbjct  364  PPQVASATSTFSMLFSSSMSVVQYYYLDRFPVPYASYFVLVATIAAFAGQHVVRRIIAIL  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI NMI K+ NHEYMGFENLC
Sbjct  424  GRASIIIFILASTIFISAISLGGVGIQNMIVKLENHEYMGFENLC  468



>gb|ACJ86264.1| unknown [Medicago truncatula]
Length=481

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+LIA+L
Sbjct  371  PPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRKLIALL  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC Y V N
Sbjct  431  GRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEYMGFGNLCSYAVRN  481



>ref|XP_003629897.1| hypothetical protein MTR_8g088080 [Medicago truncatula]
 gb|AET04373.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=479

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+LIA+L
Sbjct  369  PPQVASATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRKLIALL  428

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFILA T+FVS ISLGG GI+N+I+++ N EYMGF NLC Y V N
Sbjct  429  GRASIIIFILALTVFVSGISLGGTGIANLIKRLENKEYMGFGNLCSYAVRN  479



>gb|EMT12794.1| hypothetical protein F775_19997 [Aegilops tauschii]
Length=468

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SATATFAMMFSSSMSVVEYYLL RFPVPYA++LT +A  AA +GQ VVR+LI +L
Sbjct  360  PPQVASATATFAMMFSSSMSVVEYYLLNRFPVPYAVYLTILAFFAAIVGQRVVRKLIDLL  419

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+I+FIL+F IF+SA+SLGGVGISN I KI  HEYMGFEN+CKY
Sbjct  420  GRASIIVFILSFMIFISALSLGGVGISNTIHKIERHEYMGFENICKY  466



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFP+PY L+  AV+T AAF+GQ +VR+L+A+L
Sbjct  369  PPQVSSATATFAMTFSASMSVVEYYLLKRFPIPYTLYFVAVSTFAAFVGQVLVRKLVAIL  428

Query  551  GRASLIIFILAFTIFVSAISLG--GVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFIL+ TIFVSAISLG  GVGISNMI++I N EYMGFENLC Y
Sbjct  429  GRASLIIFILSSTIFVSAISLGKCGVGISNMIQRIANKEYMGFENLCTY  477



>gb|ACJ85296.1| unknown [Medicago truncatula]
Length=474

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 4/113 (4%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YY L RFP+PYA +L  VAT+AA  GQHVVR++IA+ 
Sbjct  362  PPQVASATSTFAMVFSSSMSVVQYYHLDRFPIPYASYLVLVATIAALTGQHVVRKIIAIF  421

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC----KYGV  405
            GRAS+I+FILAFTIFVSAISLGGVGI NM+EK+ N EYMGF+N C    KYGV
Sbjct  422  GRASIIVFILAFTIFVSAISLGGVGIGNMVEKMENAEYMGFDNFCHHGKKYGV  474



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF MMFS+SMSVVEY+LL RFPVPYAL+L  VAT+AA++GQHVVRR+IAV+
Sbjct  338  PPQVSSATATFIMMFSASMSVVEYHLLNRFPVPYALYLFVVATIAAYVGQHVVRRIIAVM  397

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIF+L+FTIFVSA+SLGG GIS ++ KI  HEYMGF NLCKY
Sbjct  398  GRASIIIFVLSFTIFVSAVSLGGFGISKIVAKIRWHEYMGFGNLCKY  444



>ref|XP_010235080.1| PREDICTED: uncharacterized protein LOC100846223 isoform X2 [Brachypodium 
distachyon]
Length=451

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEY+LL RFPVPYALF T +A  AA +GQ VVR+LI +L
Sbjct  343  PPQVSSATATFAMMFSSSMSVVEYFLLNRFPVPYALFFTVLAFFAAIVGQRVVRKLIGLL  402

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLI+FIL+  IFVSA SLGGVGISNMI KI  HEYMGFEN+CKY
Sbjct  403  GRASLIVFILSMMIFVSAFSLGGVGISNMIHKITRHEYMGFENICKY  449



>ref|XP_003636267.1| Membrane protein-like protein [Medicago truncatula]
Length=110

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VV+YY L RFPVPYA +   VAT+AAF GQHVVR++IA+LGRAS+IIFILA TIF+SAIS
Sbjct  23   VVQYYYLDRFPVPYASYFVLVATIAAFAGQHVVRKIIAILGRASIIIFILASTIFISAIS  82

Query  491  LGGVGISNMIEKIHNHEYMGFENLCK  414
            LGGVGI  MI K+ NHEYMGFENLC 
Sbjct  83   LGGVGIEKMIVKMENHEYMGFENLCT  108



>ref|XP_003574412.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235079.1| PREDICTED: uncharacterized protein LOC100846223 isoform X1 [Brachypodium 
distachyon]
Length=468

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFSSSMSVVEY+LL RFPVPYALF T +A  AA +GQ VVR+LI +L
Sbjct  360  PPQVSSATATFAMMFSSSMSVVEYFLLNRFPVPYALFFTVLAFFAAIVGQRVVRKLIGLL  419

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLI+FIL+  IFVSA SLGGVGISNMI KI  HEYMGFEN+CKY
Sbjct  420  GRASLIVFILSMMIFVSAFSLGGVGISNMIHKITRHEYMGFENICKY  466



>ref|XP_003611978.1| Membrane protein-like protein [Medicago truncatula]
Length=109

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VV+YY L RFPVPYA +   VAT+AAF GQHVVR++IA+LGRAS+IIFILA TIF+SAIS
Sbjct  22   VVQYYYLDRFPVPYASYFVLVATIAAFAGQHVVRKIIAILGRASIIIFILASTIFISAIS  81

Query  491  LGGVGISNMIEKIHNHEYMGFENLC  417
            LGGVGI  MI K+ NHEYMGFENLC
Sbjct  82   LGGVGIEKMIVKMENHEYMGFENLC  106



>gb|AES94936.2| membrane-like protein, putative [Medicago truncatula]
Length=111

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VV+YY L RFPVPYA +   VAT+AAF GQHVVR++IA+LGRAS+IIFILA TIF+SAIS
Sbjct  24   VVQYYYLDRFPVPYASYFVLVATIAAFAGQHVVRKIIAILGRASIIIFILASTIFISAIS  83

Query  491  LGGVGISNMIEKIHNHEYMGFENLCK  414
            LGGVGI  MI K+ NHEYMGFENLC 
Sbjct  84   LGGVGIEKMIVKMENHEYMGFENLCT  109



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+SMSVVEYYLLKRFPVPYAL+  AVATVAA +GQHV+R+LI++L
Sbjct  370  PPQVSSATATFAMMFSASMSVVEYYLLKRFPVPYALYFFAVATVAALVGQHVIRKLISIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIF LAFTIFVSAI LGGVGI+ M+++I   EYMGFEN+C 
Sbjct  430  GRASLIIFTLAFTIFVSAILLGGVGIARMVKRIERKEYMGFENICS  475



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM+FSSSMSVV+YYLL RFPVPYA +   VAT+AAF GQHVVR++IAV+
Sbjct  371  PPQVASATSTFAMLFSSSMSVVQYYLLNRFPVPYAAYFVLVATIAAFTGQHVVRKVIAVV  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS++IFILA TI VSAISLGGVGI+NM+EK+ N EYMGFEN C
Sbjct  431  GRASIVIFILALTILVSAISLGGVGIANMVEKMENQEYMGFENFC  475



>gb|KJB43508.1| hypothetical protein B456_007G203800 [Gossypium raimondii]
Length=417

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA +   VAT+AA  GQHVVRR+IAV+
Sbjct  311  PPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYFVLVATIAAIAGQHVVRRIIAVI  370

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EYMGFENLCK
Sbjct  371  GRASIIIFILALTIFISAISLGGVGIADMVKKLANKEYMGFENLCK  416



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA +   VAT+AA  GQHVVRR+IAV+
Sbjct  363  PPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYFVLVATMAAIAGQHVVRRIIAVI  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EYMGFENLCK
Sbjct  423  GRASIIIFILALTIFISAISLGGVGIADMVKKLANKEYMGFENLCK  468



>ref|XP_011011436.1| PREDICTED: uncharacterized protein LOC105116005 isoform X3 [Populus 
euphratica]
Length=422

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT+AA +GQHV+R+LI++L
Sbjct  317  PPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVATLAALVGQHVIRKLISIL  376

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN+C 
Sbjct  377  GRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFENICS  422



>gb|KJB43509.1| hypothetical protein B456_007G203800 [Gossypium raimondii]
Length=469

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA +   VAT+AA  GQHVVRR+IAV+
Sbjct  363  PPQVASATSTFSMVFSSSMSVVQYYLLDRFPVPYAAYFVLVATIAAIAGQHVVRRIIAVI  422

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIF+SAISLGGVGI++M++K+ N EYMGFENLCK
Sbjct  423  GRASIIIFILALTIFISAISLGGVGIADMVKKLANKEYMGFENLCK  468



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT+AA +GQHV+R+LI++L
Sbjct  370  PPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVATLAALVGQHVIRKLISIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN+C 
Sbjct  430  GRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFENICS  475



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF+MMFS+SMSVVEYYLLKRFPVPYAL+  AVAT+AA +GQHV+R+LI++L
Sbjct  392  PPQVSSATATFSMMFSASMSVVEYYLLKRFPVPYALYFFAVATLAALVGQHVIRKLISIL  451

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIF LAFTIFVSAI LGGVGI+ M+ +I   EYMGFEN+C 
Sbjct  452  GRASLIIFTLAFTIFVSAILLGGVGIARMVRRIERKEYMGFENICS  497



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+L
Sbjct  415  PPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAIL  474

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EYMGFEN C
Sbjct  475  GRASIIIFILASTIFISAISLGGVGIENMIVKMENQEYMGFENFC  519



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+L
Sbjct  416  PPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAIL  475

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EYMGFEN C
Sbjct  476  GRASIIIFILASTIFISAISLGGVGIENMIVKMENQEYMGFENFC  520



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+L
Sbjct  416  PPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAIL  475

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EYMGFEN C
Sbjct  476  GRASIIIFILASTIFISAISLGGVGIENMIVKMENQEYMGFENFC  520



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M+FSSSMSVV+YYLL RFPVPYA F   VAT+AAF+GQHVVR++IA+L
Sbjct  417  PPQVASATSTFSMLFSSSMSVVQYYLLDRFPVPYASFFVLVATIAAFVGQHVVRKIIAIL  476

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI NMI K+ N EYMGFEN C
Sbjct  477  GRASIIIFILASTIFISAISLGGVGIENMIVKMENQEYMGFENFC  521



>ref|XP_010254877.1| PREDICTED: uncharacterized protein LOC104595716 isoform X2 [Nelumbo 
nucifera]
Length=345

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+S+T+TF M+FSSSMSV++YYLLKRFPVPYA +   +ATVAAF GQHVVR+LI + 
Sbjct  240  PPQVASSTSTFVMVFSSSMSVIQYYLLKRFPVPYAAYFVLIATVAAFTGQHVVRKLIRLF  299

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA TIFVSAI LGGVGI++M+EK+ ++EYMGFE+LC+
Sbjct  300  GRASLIIFILALTIFVSAIGLGGVGIADMVEKLEHNEYMGFESLCQ  345



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF M+FSSSMSVV+YYLLKRFPVPYA +   VAT+AAF GQHVVR+LI +L
Sbjct  368  PPQVASATSTFVMVFSSSMSVVQYYLLKRFPVPYASYFVLVATIAAFTGQHVVRKLITLL  427

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRAS+IIFILA TIFVSA+SLGGVGI+NM+E + ++EYMGFE+LC+
Sbjct  428  GRASIIIFILAMTIFVSALSLGGVGIANMLEMLEHNEYMGFESLCQ  473



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF M FSSSMSVVEYY LKRFPVPYA +L  V  +AAF+GQHV+RRL+ +L
Sbjct  397  PPQVSSATATFVMTFSSSMSVVEYYFLKRFPVPYAAYLFGVCVIAAFMGQHVIRRLVILL  456

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFILAF IF+SAI+LGGVGI  MI K  N +YMGFENLC Y 
Sbjct  457  GRASLIIFILAFVIFLSAITLGGVGIVKMIHKFENGDYMGFENLCSYS  504



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSV++YYLL RFPVPYA +   +ATVAAF GQH+VRRLI +L
Sbjct  380  PPQVASATSTFAMTFSSSMSVIQYYLLDRFPVPYAAYFVFLATVAAFTGQHIVRRLIVLL  439

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRASLIIFILA TIFVSAISLGGVGI++M+EK+   E+MGFENLC
Sbjct  440  GRASLIIFILALTIFVSAISLGGVGIAHMVEKLERKEHMGFENLC  484



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+S+T+TF M+FSSSMSV++YYLLKRFPVPYA +   +ATVAAF GQHVVR+LI + 
Sbjct  366  PPQVASSTSTFVMVFSSSMSVIQYYLLKRFPVPYAAYFVLIATVAAFTGQHVVRKLIRLF  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA TIFVSAI LGGVGI++M+EK+ ++EYMGFE+LC+
Sbjct  426  GRASLIIFILALTIFVSAIGLGGVGIADMVEKLEHNEYMGFESLCQ  471



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA++AA +GQHVVRR+I+++
Sbjct  366  PPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVASIAALVGQHVVRRIISIV  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  426  GRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  472



>ref|XP_009592782.1| PREDICTED: uncharacterized protein LOC104089559 isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA++AA +GQHVVRR+I+++
Sbjct  349  PPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVASIAALVGQHVVRRIISIV  408

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  409  GRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  455



>ref|XP_009800426.1| PREDICTED: uncharacterized protein LOC104246320 isoform X2 [Nicotiana 
sylvestris]
Length=456

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA +AA +GQHVVRR+I+++
Sbjct  349  PPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVAGIAALVGQHVVRRIISIV  408

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  409  GRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  455



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA F M+FSSSMSV++YYLL+RFPVPYAL+  AVA +AA +GQHVVRR+I+++
Sbjct  366  PPQVSSATAAFVMIFSSSMSVIQYYLLRRFPVPYALYFIAVAGIAALVGQHVVRRIISIV  425

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  426  GRASVIIFILAFTIFVSAISLGGVGIADTIKKIEEGQHMGFDNICAY  472



>ref|XP_002516036.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46456.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+L AV T+A F+GQ+VV+++I +L
Sbjct  359  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYLFAVTTLAGFVGQYVVKKVIDML  418

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRAS+IIFIL+FTI VSAISLGGVG+++MI+KI   EYMGFE++C Y 
Sbjct  419  GRASIIIFILSFTILVSAISLGGVGLADMIKKIERKEYMGFEDICLYS  466



>ref|XP_010098073.1| hypothetical protein L484_026205 [Morus notabilis]
 gb|EXB74510.1| hypothetical protein L484_026205 [Morus notabilis]
Length=470

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            VVEYYLLKRFPVPYA++   VA  +A +GQ VV ++I+++GRASLIIFIL+  IFVSAI+
Sbjct  384  VVEYYLLKRFPVPYAVYFAGVAAFSAIVGQRVVGKVISLIGRASLIIFILSSMIFVSAIT  443

Query  491  LGGVGISNMIEKIHNHEYMGFENLCK  414
            LGGVGI+N +EKIHNHEYMGFEN+CK
Sbjct  444  LGGVGIANAVEKIHNHEYMGFENICK  469



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AV+T+AAF+GQHVVR+LI +L
Sbjct  370  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFAVSTIAAFVGQHVVRKLINIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EYMGF+++C Y
Sbjct  430  GRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEYMGFDSICSY  476



>ref|XP_008783526.1| PREDICTED: uncharacterized protein LOC103702749 [Phoenix dactylifera]
Length=506

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TFAM FSSSMSV++YYLL RFPVPYA +   +ATVAAF  QH+VRRLI +L
Sbjct  391  PPQVASATSTFAMTFSSSMSVIQYYLLDRFPVPYAAYFVFLATVAAFTSQHIVRRLIVLL  450

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRASLIIFILA TIFVSAISLGGVGI++M+EK+   E+MGFENLC
Sbjct  451  GRASLIIFILALTIFVSAISLGGVGIAHMVEKLERKEHMGFENLC  495



>gb|KHN06458.1| hypothetical protein glysoja_010802 [Glycine soja]
Length=469

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH+VR+ IA+L
Sbjct  361  PPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQHLVRKAIAIL  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFIL+ T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  421  GRASVIIFILSLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>ref|XP_008670142.1| PREDICTED: uncharacterized protein LOC103647377 [Zea mays]
Length=383

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + T VA VAA  GQH VR+LIA L
Sbjct  277  PPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHCVRKLIAWL  336

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA  IFVSA++LGGVGISN++ ++  H+YMGFE+LCK
Sbjct  337  GRASLIIFILASMIFVSALTLGGVGISNIVHRVERHQYMGFESLCK  382



>ref|XP_002460083.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
 gb|EER96604.1| hypothetical protein SORBIDRAFT_02g022500 [Sorghum bicolor]
Length=455

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + T VA VAA  GQH VR+LIA L
Sbjct  349  PPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHFVRKLIAWL  408

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA  IFVSA++LGGVGISN++ ++  HEYMGFE+LCK
Sbjct  409  GRASLIIFILASMIFVSALTLGGVGISNIVHRMERHEYMGFESLCK  454



>ref|XP_006580197.1| PREDICTED: uncharacterized protein LOC100818778 [Glycine max]
Length=469

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH+VR+ IA+L
Sbjct  361  PPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQHLVRKAIAIL  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  421  GRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>ref|XP_003532779.1| PREDICTED: uncharacterized protein LOC100801788 [Glycine max]
 gb|KHN48051.1| hypothetical protein glysoja_015521 [Glycine soja]
Length=469

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYAL+  A+AT AA +GQH+VR+ IA+L
Sbjct  361  PPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYALYFVAIATAAALVGQHLVRKAIAIL  420

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFIL  T+ VSA+ LGGVGI++MI+KI N EYMGF +LC Y
Sbjct  421  GRASVIIFILTLTLSVSAVLLGGVGIAHMIQKIENKEYMGFGDLCTY  467



>ref|XP_002298219.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
 gb|EEE83024.2| hypothetical protein POPTR_0001s18390g [Populus trichocarpa]
Length=438

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+SMSVVE+YLLKRFPVPYAL+   VAT+AA +GQHVVR+LI++L
Sbjct  333  PPQVSSATATFAMMFSASMSVVEFYLLKRFPVPYALYFFTVATIAAVVGQHVVRKLISIL  392

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA TIFVSAI +GG G+++MIEK    EYMGFE++C 
Sbjct  393  GRASLIIFILASTIFVSAILVGGAGMASMIEKFERKEYMGFESMCS  438



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+   V+TVAAF+GQHVVR+LI +L
Sbjct  370  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFGVSTVAAFVGQHVVRKLINIL  429

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIF L+ TIFVSA+SLGG+G++ M+++I   EYMGF+++C Y
Sbjct  430  GRASIIIFTLSLTIFVSALSLGGIGLAKMVQRIDRKEYMGFDSICSY  476



>ref|XP_004959391.1| PREDICTED: uncharacterized protein LOC101762929 [Setaria italica]
Length=459

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + TAVA VAA +GQH VR+LIA L
Sbjct  353  PPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTAVAFVAAIVGQHCVRKLIAWL  412

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA  IFVSA++LGGVGISN++ ++  H+YMGFE+LC+
Sbjct  413  GRASLIIFILASMIFVSALTLGGVGISNIVHRMERHQYMGFESLCR  458



>tpg|DAA39926.1| TPA: hypothetical protein ZEAMMB73_327447 [Zea mays]
Length=497

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATF MMFSSSMSVVEYYLL RFPVPYA + T VA VAA  GQH VR+LIA L
Sbjct  391  PPQVSSATATFTMMFSSSMSVVEYYLLHRFPVPYAAYFTGVAFVAAITGQHCVRKLIAWL  450

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCK  414
            GRASLIIFILA  IFVSA++LGGVGISN++ ++  H+YMGFE+LCK
Sbjct  451  GRASLIIFILASMIFVSALTLGGVGISNIVHRVERHQYMGFESLCK  496



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSS TATF M+FSSSMSVVEYYLL RFPVPYAL+  AVA +AAFIGQ+++ +LI + 
Sbjct  365  PPQVSSGTATFGMLFSSSMSVVEYYLLDRFPVPYALYFIAVAVIAAFIGQNIITKLITIS  424

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIF+LAFTIF+SAI+LGGVGI+  I  +  HEYMGFENLCKY
Sbjct  425  GRASLIIFVLAFTIFISAIALGGVGITRTIGMVERHEYMGFENLCKY  471



>ref|XP_007159526.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
 gb|ESW31520.1| hypothetical protein PHAVU_002G244900g [Phaseolus vulgaris]
Length=464

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+T  M FS+SM+VVEYYLLKRFPVPYA++  ++AT AA +GQH+VR+ IA+L
Sbjct  354  PPQVASATSTLVMAFSASMAVVEYYLLKRFPVPYAIYFVSIATAAALVGQHLVRKAIAIL  413

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL FT+ VSA+ LGGVG+ +MI+KI + EYMGF +LC Y V
Sbjct  414  GRASVIIFILTFTLSVSAVLLGGVGVVHMIQKIEHQEYMGFGDLCTYKV  462



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHVV++LI +L
Sbjct  373  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVVKKLIKIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  433  GRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEYMGFDNIC  477



>gb|KDO56902.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=348

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV+++LI +L
Sbjct  242  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKIL  301

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  302  GRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEYMGFDNIC  346



>gb|KDO56900.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=355

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV+++LI +L
Sbjct  249  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKIL  308

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  309  GRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEYMGFDNIC  353



>gb|KDO56901.1| hypothetical protein CISIN_1g0116821mg, partial [Citrus sinensis]
Length=353

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV+++LI +L
Sbjct  247  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKIL  306

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  307  GRASIIIFTLSFIIFVSALSLGGVGLAKMIKRIEHKEYMGFDNIC  351



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLL RFP+PY L+  AV+T AAF+GQ +V++L+A+L
Sbjct  372  PPQVSSATATFAMTFSASMSVVEYYLLNRFPIPYTLYFVAVSTFAAFVGQVLVKKLVALL  431

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYG  408
            GRASLIIFIL+ TIFVSA+SLG VGI++M++K+ + EYMGFENLC Y 
Sbjct  432  GRASLIIFILSGTIFVSALSLGSVGIASMVQKLAHKEYMGFENLCTYA  479



>ref|XP_007159525.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31519.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=347

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+  AM FS+SM+ VEYYLLKRFPV YAL+L AVAT A+ +GQH+VR+++AVL
Sbjct  237  PPQVASATSILAMAFSASMAAVEYYLLKRFPVRYALYLVAVATAASLVGQHLVRKMVAVL  296

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFIL FT+ VSA+ LGGVG+S+MI+KI + EYMGF NLC Y V N
Sbjct  297  GRASVIIFILTFTLSVSAVLLGGVGVSHMIQKIEHKEYMGFGNLCMYKVKN  347



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+TF+M FSSSMSVV+Y+LL+RFPVPYA +   VAT+AA +GQHVVR++I ++
Sbjct  374  PPQVASATSTFSMAFSSSMSVVQYHLLRRFPVPYASYFVLVATIAALVGQHVVRKVIKLV  433

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIFILA TIF+SAISLGGVGI  M+EK+ N+EYMGF++LC
Sbjct  434  GRASIIIFILALTIFISAISLGGVGIMTMVEKLANNEYMGFDDLC  478



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV+++LI +L
Sbjct  373  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  433  GRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEYMGFDNIC  477



>gb|AET04372.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=474

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSAT+TFAM FS+SMSVVEYYLLKRFP+PYAL+   VATVAA +GQH+VR+LI +L
Sbjct  364  PPQVSSATSTFAMTFSASMSVVEYYLLKRFPIPYALYFVVVATVAALVGQHLVRKLIVLL  423

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFILA T+FVS ISLGG GI+++I++  N EYMGF +LC Y V N
Sbjct  424  GRASIIIFILALTVFVSGISLGGTGIASLIKRTENKEYMGFGSLCAYRVRN  474



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA FA+ FSSSMSVVEYYLLKRFPVPYAL+  A++ +AAF+GQHV+++LI +L
Sbjct  371  PPQVSSATALFAITFSSSMSVVEYYLLKRFPVPYALYFFALSIIAAFVGQHVLKKLIKIL  430

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRAS+IIF L+F IFVSA+SLGGVG++ MI++I + EYMGF+N+C
Sbjct  431  GRASIIIFTLSFIIFVSAVSLGGVGLAKMIKRIEHKEYMGFDNIC  475



>gb|AAL27555.1|AF420410_1 hypothetical protein [Musa acuminata AAA Group]
Length=238

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  +VA VAAF+GQH+V+RLI +L
Sbjct  98   PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFVSVALVAAFVGQHLVKRLIEIL  157

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFE  426
            GRASLIIFILA TIF+SAISLGGVGISNM++KI +HE  G  
Sbjct  158  GRASLIIFILASTIFISAISLGGVGISNMVQKIQHHESWGLR  199



>gb|AEI72271.1| hypothetical protein [Citrus trifoliata]
Length=353

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FS+SMSVVEYYLLKRFPVPYAL+  AV+T+AAF+GQHVVR+LI +L
Sbjct  246  PPQVSSATATFAMTFSASMSVVEYYLLKRFPVPYALYFFAVSTIAAFVGQHVVRKLINIL  305

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIF L+ TIFVSA+SL G+G++ M+ +I   EYMGF+++C Y
Sbjct  306  GRASIIIFTLSLTIFVSALSLSGIGLAKMVPRIDRKEYMGFDSICSY  352



>ref|XP_006343068.1| PREDICTED: uncharacterized protein LOC102587876 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343069.1| PREDICTED: uncharacterized protein LOC102587876 isoform X2 [Solanum 
tuberosum]
 ref|XP_006343070.1| PREDICTED: uncharacterized protein LOC102587876 isoform X3 [Solanum 
tuberosum]
Length=483

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATA F M+FSSSMSV++YYLL RFPVPYAL+  AVA++AA +GQHVVR++I+++
Sbjct  375  PPQVSSATAAFVMIFSSSMSVIQYYLLGRFPVPYALYFIAVASIAALVGQHVVRKIISIV  434

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRAS+IIFILAFTIFVSAISLGG GI++ I+KI+  ++MGF+N+C Y
Sbjct  435  GRASVIIFILAFTIFVSAISLGGFGIADTIKKINEGQHMGFDNICAY  481



>ref|XP_007159524.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
 gb|ESW31518.1| hypothetical protein PHAVU_002G244800g [Phaseolus vulgaris]
Length=462

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+  AM FS+SM+ VEYYLLKRFPV YAL+L AVAT A+ +GQH+VR+++AVL
Sbjct  352  PPQVASATSILAMAFSASMAAVEYYLLKRFPVRYALYLVAVATAASLVGQHLVRKMVAVL  411

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV*N  399
            GRAS+IIFIL FT+ VSA+ LGGVG+S+MI+KI + EYMGF NLC Y V N
Sbjct  412  GRASVIIFILTFTLSVSAVLLGGVGVSHMIQKIEHKEYMGFGNLCMYKVKN  462



>ref|XP_009592783.1| PREDICTED: uncharacterized protein LOC104089559 isoform X3 [Nicotiana 
tomentosiformis]
Length=399

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  671  VVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLGRASLIIFILAFTIFVSAIS  492
            V++YYLL+RFPVPYAL+  AVA++AA +GQHVVRR+I+++GRAS+IIFILAFTIFVSAIS
Sbjct  312  VIQYYLLRRFPVPYALYFIAVASIAALVGQHVVRRIISIVGRASVIIFILAFTIFVSAIS  371

Query  491  LGGVGISNMIEKIHNHEYMGFENLCKY  411
            LGGVGI++ I+KI   ++MGF+N+C Y
Sbjct  372  LGGVGIADTIKKIEEGQHMGFDNICAY  398



>ref|XP_004305285.1| PREDICTED: uncharacterized protein LOC101291554 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  AV +V+AF GQHV  +++  L
Sbjct  354  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFAAVTSVSAFAGQHVAGKMVKKL  413

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFT+FVS+++LGG+GI NMI KI + E +GF+N+C Y
Sbjct  414  GRASLIIFILAFTVFVSSLTLGGIGIENMIRKIQHKESLGFQNICTY  460



>ref|XP_011466685.1| PREDICTED: uncharacterized protein LOC101291554 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAM FSSSMSVVEYYLLKRFP+PYAL+  AV +V+AF GQHV  +++  L
Sbjct  323  PPQVSSATATFAMTFSSSMSVVEYYLLKRFPIPYALYFAAVTSVSAFAGQHVAGKMVKKL  382

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            GRASLIIFILAFT+FVS+++LGG+GI NMI KI + E +GF+N+C Y
Sbjct  383  GRASLIIFILAFTVFVSSLTLGGIGIENMIRKIQHKESLGFQNICTY  429



>ref|XP_006585192.1| PREDICTED: uncharacterized protein LOC100801244 [Glycine max]
Length=406

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+  AVAT AA +GQH+VR++IA+L
Sbjct  296  PPQVASATSILAMAFSASMAVVEYYLLKRFPISYALYFVAVATAAALVGQHLVRKVIAIL  355

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  356  GRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  404



>gb|KHN48050.1| hypothetical protein glysoja_015520 [Glycine soja]
Length=465

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+  AM FS+SM+VVEYYLLKRFP+ YAL+  AVAT AA +GQH+VR++IA+L
Sbjct  355  PPQVASATSILAMAFSASMAVVEYYLLKRFPISYALYFVAVATAAALVGQHLVRKVIAIL  414

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  415  GRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  463



>ref|XP_011009831.1| PREDICTED: uncharacterized protein LOC105114838 [Populus euphratica]
Length=478

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQVSSATATFAMMFS+S+SVVEYYL+KRFPVPYAL+   VAT+AA +GQHVVR+LI++L
Sbjct  373  PPQVSSATATFAMMFSASLSVVEYYLIKRFPVPYALYFFTVATIAAVVGQHVVRKLISIL  432

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLC  417
            GRASLIIFILA TIFVSAI +GG G+++MI+K    EYMGFE++C
Sbjct  433  GRASLIIFILASTIFVSAILVGGSGMASMIKKFERKEYMGFESIC  477



>ref|XP_006580862.1| PREDICTED: uncharacterized protein LOC100818240 [Glycine max]
Length=422

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -2

Query  731  PPQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVL  552
            PPQV+SAT+  AM FS+S++VVEYYLLKRFP+ YAL+  AVAT AA +GQH+VR++IA+L
Sbjct  312  PPQVASATSILAMAFSASIAVVEYYLLKRFPISYALYFVAVATAAALVGQHLVRKVIAML  371

Query  551  GRASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKYGV  405
            GRAS+IIFIL  T+ VSA+ LGGVG++NMI++I N EYMGF NLC Y V
Sbjct  372  GRASVIIFILTLTLCVSAVLLGGVGVANMIKRIENKEYMGFGNLCTYKV  420



>gb|EMS53169.1| hypothetical protein TRIUR3_09961 [Triticum urartu]
Length=709

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  728  PQVssatatfammfsssmSVVEYYLLKRFPVPYalfltavatvaaFIGQHVVRRLIAVLG  549
            PQV+SATATFAMMFSSSMSV+EYYLL RFPVPYA++LT +A  +A +GQ VVR+LI +LG
Sbjct  602  PQVASATATFAMMFSSSMSVMEYYLLNRFPVPYAVYLTILAFFSAIVGQRVVRKLIDLLG  661

Query  548  RASLIIFILAFTIFVSAISLGGVGISNMIEKIHNHEYMGFENLCKY  411
            RAS+I+FIL+F IF+SA+SLGGVGISN I KI  HEYMGFEN+CKY
Sbjct  662  RASIIVFILSFMIFISALSLGGVGISNTIHKIARHEYMGFENICKY  707



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485