BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF032B13

Length=825
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABH08753.1|  ubiquitin                                               382   5e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567286.1|  ubiquitin 11                                          383   6e-131   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08755.1|  ubiquitin                                               382   1e-130   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78180.1|  putative polyubiquitin                                  381   1e-130   Gossypium herbaceum [Arabian cotton]
gb|ACJ85618.1|  unknown                                                 382   2e-130   Medicago truncatula
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    382   2e-130   
gb|ACJ85643.1|  unknown                                                 381   3e-130   Medicago truncatula
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             381   3e-130   Brachypodium distachyon [annual false brome]
dbj|BAC57955.1|  polyubiquitin                                          381   3e-130   Tripolium pannonicum [sea starwort]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             380   4e-130   Elaeis guineensis
gb|AAB36546.1|  polyubiquitin                                           380   4e-130   Phaseolus vulgaris [French bean]
gb|AIZ74335.1|  polyubiquitin 3                                         381   4e-130   Pinus massoniana [Chinese red pine]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   380   4e-130   Camelina sativa [gold-of-pleasure]
gb|AAM64530.1|  ubiquitin homolog                                       380   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626479.1|  Ubiquitin-like protein                             382   5e-130   
gb|AET06143.1|  ubiquitin                                               380   5e-130   Papaver somniferum
gb|EEC81189.1|  hypothetical protein OsI_24195                          380   5e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_002317213.1|  polyubiquitin family protein                       380   5e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             381   6e-130   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      380   6e-130   Setaria italica
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                380   6e-130   Erythranthe guttata [common monkey flower]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      383   6e-130   Brassica rapa
gb|ABH08754.1|  ubiquitin                                               380   6e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48140.1|  ubiquitin                                              383   6e-130   Antirrhinum majus [garden snapdragon]
gb|AAP31578.1|  ubiquitin                                               380   6e-130   Hevea brasiliensis [jebe]
gb|AFK43392.1|  unknown                                                 380   6e-130   Medicago truncatula
ref|NP_849292.1|  polyubiquitin 14                                      383   7e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    380   7e-130   Gossypium raimondii
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             380   7e-130   
gb|AAF31707.1|AF221858_1  polyubiquitin                                 379   7e-130   Euphorbia esula [wolf's milk]
emb|CAH59739.1|  polyubiquitin                                          380   7e-130   Plantago major [cart-track plant]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   380   7e-130   Citrus sinensis [apfelsine]
gb|ABD96088.1|  polyubiquitin                                           381   7e-130   Malus domestica [apple tree]
gb|ABK94002.1|  unknown                                                 383   7e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      383   7e-130   Camelina sativa [gold-of-pleasure]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             380   9e-130   Citrus clementina [clementine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    382   9e-130   Gossypium raimondii
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   380   1e-129   Citrus sinensis [apfelsine]
gb|AEZ49160.1|  polyubiquitin                                           382   1e-129   Wolffia australiana
gb|AFK41706.1|  unknown                                                 380   1e-129   Medicago truncatula
gb|AAO43307.1|  putative polyubiquitin                                  380   1e-129   Arabidopsis thaliana [mouse-ear cress]
gb|EPS72031.1|  polyubiquitin                                           381   1e-129   Genlisea aurea
gb|AFY06654.1|  polyubiquitin                                           380   1e-129   Carica papaya [mamon]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    379   1e-129   Gossypium raimondii
gb|AGV54749.1|  ubiquitin 11                                            381   1e-129   Phaseolus vulgaris [French bean]
emb|CBY46745.1|  polyubiquitin 10 protein                               382   2e-129   Lepidium appelianum [hairy whitetop]
ref|XP_003627152.1|  Ubiquitin                                          380   2e-129   
gb|AAC35858.1|  polyubiquitin                                           380   2e-129   Capsicum chinense [bonnet pepper]
gb|AES89866.2|  polyubiquitin 3                                         382   2e-129   Medicago truncatula
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             379   2e-129   
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      382   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             382   2e-129   
emb|CBI22349.3|  unnamed protein product                                381   2e-129   Vitis vinifera
gb|ABY60454.1|  putative polyubiquitin                                  380   2e-129   Adonis aestivalis var. palaestina
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          379   2e-129   Sorghum bicolor [broomcorn]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             380   3e-129   Brachypodium distachyon [annual false brome]
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             381   3e-129   
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            380   4e-129   Phaseolus vulgaris [French bean]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             381   4e-129   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             378   4e-129   Citrus clementina [clementine]
emb|CAA40323.1|  polyubiquitin protein                                  382   4e-129   Helianthus annuus
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      381   5e-129   Camelina sativa [gold-of-pleasure]
ref|XP_007014924.1|  Polyubiquitin 3                                    381   5e-129   Theobroma cacao [chocolate]
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    378   5e-129   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             381   5e-129   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           380   5e-129   Brassica rapa
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    380   5e-129   Linum usitatissimum
gb|AAO42469.1|  putative polyubiquitin                                  380   5e-129   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          380   5e-129   Sorghum bicolor [broomcorn]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           380   5e-129   Nelumbo nucifera [Indian lotus]
emb|CAH59740.1|  polyubiquitin                                          380   5e-129   Plantago major [cart-track plant]
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                380   6e-129   Erythranthe guttata [common monkey flower]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             380   6e-129   
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           380   6e-129   Fragaria vesca subsp. vesca
ref|NP_851029.1|  polyubiquitin 3                                       380   6e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AFW66439.1|  putative ubiquitin family protein                       380   6e-129   
dbj|BAJ85978.1|  predicted protein                                      380   6e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP08569.1|  unnamed protein product                                380   6e-129   Coffea canephora [robusta coffee]
gb|AES89865.2|  polyubiquitin 3                                         379   6e-129   Medicago truncatula
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      380   6e-129   Oryza brachyantha
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         381   7e-129   Jatropha curcas
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    380   7e-129   Phoenix dactylifera
gb|AAL09741.1|  AT4g05320/C17L7_240                                     383   7e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             380   7e-129   Citrus clementina [clementine]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      380   7e-129   Citrus sinensis [apfelsine]
emb|CAC94926.1|  putative ubiquitin                                     378   8e-129   Pleurotus sp. 'Florida' [Florida oyster mushroom]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      383   8e-129   Nelumbo nucifera [Indian lotus]
ref|NP_849300.4|  polyubiquitin 10                                      383   8e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CBY46746.1|  polyubiquitin 10 protein                               383   8e-129   Lepidium campestre [bastard cress]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             380   8e-129   
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      380   8e-129   Glycine max [soybeans]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             380   9e-129   
gb|AAK68824.1|  Unknown protein                                         377   9e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007512209.1|  polyubiquitin                                      382   9e-129   Bathycoccus prasinos
emb|CDP05795.1|  unnamed protein product                                383   9e-129   Coffea canephora [robusta coffee]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             380   9e-129   Citrus clementina [clementine]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    383   9e-129   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      383   9e-129   Nicotiana sylvestris
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      381   1e-128   Brachypodium distachyon [annual false brome]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         380   1e-128   Jatropha curcas
prf||1604470A  poly-ubiquitin                                           379   1e-128
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    382   1e-128   Nicotiana sylvestris
gb|AAB68045.1|  polyubiquitin                                           383   1e-128   Fragaria x ananassa
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             380   1e-128   Citrus clementina [clementine]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           380   1e-128   Nicotiana tomentosiformis
gb|ACD31680.1|  ubiquitin                                               380   1e-128   Gossypium hirsutum [American cotton]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      380   1e-128   
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                383   1e-128   Pyrus x bretschneideri [bai li]
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      382   1e-128   Nicotiana tomentosiformis
gb|KJB13592.1|  hypothetical protein B456_002G083000                    383   1e-128   Gossypium raimondii
emb|CAA54603.1|  pentameric polyubiquitin                               381   1e-128   Nicotiana tabacum [American tobacco]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        382   1e-128   
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  377   1e-128   Piloderma croceum F 1598
gb|AAB95250.1|  ubiquitin                                               380   1e-128   Arabidopsis thaliana [mouse-ear cress]
gb|AAB36545.1|  ubiquitin-like protein                                  383   1e-128   Phaseolus vulgaris [French bean]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           380   1e-128   Elaeis guineensis
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            379   1e-128   Phaseolus vulgaris [French bean]
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  377   1e-128   Hypholoma sublateritium FD-334 SS-4
gb|KJB14874.1|  hypothetical protein B456_002G147600                    381   1e-128   Gossypium raimondii
gb|KIR83632.1|  polyubiquitin                                           376   2e-128   Cryptococcus gattii VGIV IND107
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 377   2e-128   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          377   2e-128   Yamadazyma tenuis ATCC 10573
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         380   2e-128   
gb|AEW46688.1|  polyubiquitin                                           376   2e-128   Ulva linza
gb|AAQ84316.1|  fiber polyubiquitin                                     376   2e-128   Gossypium barbadense [Egyptian cotton]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   376   2e-128   Piloderma croceum F 1598
gb|KJB62487.1|  hypothetical protein B456_009G418900                    379   2e-128   Gossypium raimondii
ref|NP_001148453.1|  LOC100282068                                       382   2e-128   Zea mays [maize]
ref|XP_011110054.1|  hypothetical protein H072_4094                     376   2e-128   
gb|KEH31155.1|  polyubiquitin 3                                         382   3e-128   Medicago truncatula
ref|XP_007339454.1|  ubiquitin                                          379   3e-128   
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  377   3e-128   Pisolithus microcarpus 441
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             379   3e-128   Capsella rubella
gb|AIY27743.1|  polyubiquitin Ubi10                                     379   4e-128   Betula luminifera [liang ye hua]
gb|KDB11907.1|  ubiquitin                                               378   4e-128   Ustilaginoidea virens
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                381   4e-128   
ref|XP_002872109.1|  predicted protein                                  381   4e-128   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   378   5e-128   Amanita muscaria Koide BX008
ref|NP_001105376.1|  polyubiquitin                                      381   5e-128   
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         381   5e-128   Elaeis guineensis
emb|CEF99839.1|  Ubiquitin conserved site                               379   5e-128   Ostreococcus tauri
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             381   5e-128   Eutrema salsugineum [saltwater cress]
gb|ADD52202.1|  ubiquitin                                               381   5e-128   Catharanthus roseus [chatas]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                379   5e-128   
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     375   6e-128   Rhodotorula toruloides
gb|KJB62485.1|  hypothetical protein B456_009G418900                    378   6e-128   Gossypium raimondii
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    381   6e-128   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             381   6e-128   
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   375   6e-128   Brassica rapa
ref|XP_006381473.1|  polyubiquitin family protein                       378   6e-128   
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      381   6e-128   Tarenaya hassleriana [spider flower]
gb|AAX40652.1|  polyubiquitin                                           381   6e-128   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174480.1|  Os05g0504766                                       380   6e-128   
ref|XP_002508175.1|  ubiquitin                                          380   6e-128   Micromonas commoda
ref|XP_719867.1|  hypothetical protein CaO19.6771                       375   6e-128   Candida albicans SC5314
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                378   6e-128   Serpula lacrymans var. lacrymans S7.3
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                380   6e-128   Erythranthe guttata [common monkey flower]
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                381   7e-128   
gb|ACS68205.1|  ubiquitin 10.2                                          380   7e-128   Brassica napus [oilseed rape]
gb|ABU40645.1|  polyubiquitin                                           380   7e-128   Triticum aestivum [Canadian hard winter wheat]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    380   7e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           382   7e-128   Eucalyptus grandis [rose gum]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                380   7e-128   Erythranthe guttata [common monkey flower]
ref|NP_568397.1|  ubiquitin 4                                           380   7e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             375   7e-128   Selaginella moellendorffii
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      380   7e-128   Nicotiana tomentosiformis
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             382   7e-128   Phaseolus vulgaris [French bean]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    380   8e-128   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             380   8e-128   Capsella rubella
gb|AAQ07453.1|  ubiquitin                                               380   8e-128   Musa acuminata AAA Group [Cavendish banana]
ref|XP_001420612.1|  predicted protein                                  380   8e-128   Ostreococcus lucimarinus CCE9901
ref|XP_002953480.1|  polyubiquitin                                      378   8e-128   Volvox carteri f. nagariensis
gb|AAY86773.1|  polyubiquitin                                           380   8e-128   Noccaea caerulescens
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         380   8e-128   Nicotiana tomentosiformis
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      380   9e-128   Nelumbo nucifera [Indian lotus]
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           374   9e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    383   9e-128   Cucumis melo [Oriental melon]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  375   9e-128   Paxillus rubicundulus Ve08.2h10
emb|CDP08567.1|  unnamed protein product                                380   9e-128   Coffea canephora [robusta coffee]
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    380   9e-128   Camelina sativa [gold-of-pleasure]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             380   9e-128   
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    380   1e-127   Setaria italica
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    383   1e-127   Camelina sativa [gold-of-pleasure]
ref|XP_001783045.1|  predicted protein                                  374   1e-127   
ref|NP_849299.4|  polyubiquitin 10                                      383   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   383   1e-127   
ref|XP_001764949.1|  predicted protein                                  378   1e-127   
emb|CCL99875.1|  predicted protein                                      377   1e-127   Fibroporia radiculosa
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         380   1e-127   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54228.1|  polyubiquitin-like protein                              380   1e-127   Phaseolus vulgaris [French bean]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    380   1e-127   Gossypium raimondii
gb|KJB81827.1|  hypothetical protein B456_013G163500                    383   1e-127   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           383   1e-127   Nicotiana sylvestris
gb|KJB13590.1|  hypothetical protein B456_002G083000                    383   1e-127   Gossypium raimondii
ref|XP_001555417.1|  polyubiquitin                                      377   1e-127   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             377   1e-127   Exserohilum turcica Et28A
ref|XP_001830230.1|  ubiquitin                                          377   1e-127   Coprinopsis cinerea okayama7#130
gb|EMS65864.1|  Polyubiquitin                                           381   1e-127   Triticum urartu
gb|KIY53974.1|  polyubiquitin                                           377   1e-127   Fistulina hepatica ATCC 64428
gb|KIY45417.1|  ubiquitin                                               377   1e-127   Fistulina hepatica ATCC 64428
gb|AHC00631.1|  polyubiquitin                                           377   1e-127   Ganoderma lucidum
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   377   1e-127   Sphaerobolus stellatus SS14
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    377   1e-127   Populus euphratica
gb|EWZ40370.1|  ubiquitin C                                             374   1e-127   Fusarium oxysporum Fo47
ref|XP_001828882.1|  ubiquitin C                                        377   2e-127   Coprinopsis cinerea okayama7#130
dbj|BAL61087.1|  polyubiquitin                                          374   2e-127   Dianthus caryophyllus [carnation]
ref|NP_001053957.1|  Os04g0628100                                       380   2e-127   
ref|XP_003030030.1|  polyubiquitin                                      377   2e-127   Schizophyllum commune H4-8
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                383   2e-127   Prunus mume [ume]
ref|XP_001598085.1|  polyubiquitin                                      377   2e-127   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             380   2e-127   
ref|XP_006372519.1|  polyubiquitin family protein                       377   2e-127   Populus trichocarpa [western balsam poplar]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    380   2e-127   Gossypium raimondii
gb|KIR29996.1|  polyubiquitin                                           377   2e-127   Cryptococcus gattii VGII LA55
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 377   2e-127   Scleroderma citrinum Foug A
gb|KIR63773.1|  polyubiquitin                                           377   2e-127   Cryptococcus gattii CA1873
ref|XP_007366816.1|  polyubiquitin                                      377   2e-127   Dichomitus squalens LYAD-421 SS1
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  377   2e-127   Botryobasidium botryosum FD-172 SS1
gb|ACX46987.1|  ubiquitin                                               381   3e-127   Guzmania wittmackii x Guzmania lingulata
ref|XP_007049060.1|  Polyubiquitin 10                                   382   3e-127   
ref|XP_007763327.1|  polyubiquitin                                      376   3e-127   Coniophora puteana RWD-64-598 SS2
gb|EFN76024.1|  Ubiquitin                                               374   3e-127   Harpegnathos saltator
ref|XP_007864655.1|  ubiquitin                                          379   3e-127   Gloeophyllum trabeum ATCC 11539
gb|KFX48439.1|  Polyubiquitin                                           373   3e-127   Talaromyces marneffei PM1
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      381   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_005644220.1|  polyubiquitin                                      376   3e-127   Coccomyxa subellipsoidea C-169
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             373   3e-127   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             378   4e-127   Phaseolus vulgaris [French bean]
gb|KJB62486.1|  hypothetical protein B456_009G418900                    379   4e-127   Gossypium raimondii
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  377   4e-127   Plicaturopsis crispa FD-325 SS-3
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      379   4e-127   Populus euphratica
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  373   4e-127   Naumovozyma dairenensis CBS 421
emb|CCT70325.1|  UBI4-Ubiquitin                                         375   4e-127   Fusarium fujikuroi IMI 58289
emb|CEP60563.1|  LALA0S01e13784g1_1                                     373   4e-127   Lachancea lanzarotensis
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                381   4e-127   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              373   5e-127   Pseudocercospora fijiensis CIRAD86
ref|XP_001931824.1|  ubiquitin                                          373   5e-127   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_002419618.1|  ubiquitin, putative                                375   5e-127   Candida dubliniensis CD36
dbj|BAK61744.1|  ubiquitin                                              372   5e-127   Collozoum amoeboides
emb|CAB81074.1|  polyubiquitin (ubq10)                                  381   6e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    381   6e-127   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      381   6e-127   Setaria italica
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          381   6e-127   Sorghum bicolor [broomcorn]
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    372   6e-127   Candida albicans
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      375   6e-127   Populus euphratica
dbj|GAK65396.1|  ubiquitin                                              376   6e-127   Moesziomyces antarcticus
gb|EPX74297.1|  ubiquitin                                               372   6e-127   Schizosaccharomyces octosporus yFS286
gb|AAO43308.1|  putative polyubiquitin                                  373   7e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001755431.1|  predicted protein                                  372   7e-127   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             381   7e-127   Prunus persica
gb|AAB95251.1|  ubiquitin                                               381   7e-127   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                381   7e-127   Erythranthe guttata [common monkey flower]
ref|NP_001045980.1|  Os02g0161900                                       381   7e-127   
gb|AAC16012.1|  polyubiquitin                                           381   7e-127   Elaeagnus umbellata [aki-gumi]
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           381   7e-127   Camelina sativa [gold-of-pleasure]
dbj|BAK03691.1|  predicted protein                                      380   7e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           381   8e-127   Nelumbo nucifera [Indian lotus]
emb|CAA40324.1|  hexaubiquitin protein                                  380   8e-127   Helianthus annuus
gb|EKV18932.1|  hypothetical protein PDIP_25190                         372   8e-127   Penicillium digitatum Pd1
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             375   8e-127   
ref|XP_002888365.1|  polyubiquitin                                      380   8e-127   Arabidopsis lyrata subsp. lyrata
dbj|BAK02501.1|  predicted protein                                      380   8e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91912.1|  predicted protein                                      380   8e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           380   8e-127   
gb|AAD03343.1|  ubiquitin                                               380   8e-127   Pisum sativum [garden pea]
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      380   8e-127   
emb|CAA52290.1|  polyubiquitin                                          378   9e-127   Volvox carteri f. nagariensis
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         380   9e-127   Jatropha curcas
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          381   9e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AGM32540.1|  polyubiquitin-B-like isoform                            373   9e-127   Coptotermes formosanus
gb|AAB95252.1|  ubiquitin                                               378   9e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      380   9e-127   Sesamum indicum [beniseed]
gb|AGT38457.1|  polyubiquitin                                           381   9e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             380   1e-126   
ref|XP_003627151.1|  Ubiquitin                                          383   1e-126   Medicago truncatula
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          383   1e-126   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           380   1e-126   Sesamum indicum [beniseed]
ref|XP_002891806.1|  predicted protein                                  378   1e-126   
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    372   1e-126   Parastagonospora nodorum SN15
gb|AIS40894.1|  polyubiquitin                                           381   1e-126   
ref|XP_001755307.1|  predicted protein                                  375   1e-126   
gb|AFW70219.1|  polyubiquitin-like protein                              382   1e-126   
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      377   1e-126   
gb|ACN40936.1|  unknown                                                 380   1e-126   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        372   1e-126   
dbj|BAK61751.1|  ubiquitin                                              372   1e-126   
ref|XP_003052575.1|  predicted protein                                  374   1e-126   
gb|ACZ69386.1|  polyubiquitin UBQ14                                     370   1e-126   
gb|AFK47245.1|  unknown                                                 372   1e-126   
gb|AAL91103.1|  ubiquitin                                               373   1e-126   
ref|XP_001777816.1|  predicted protein                                  377   2e-126   
ref|XP_003196661.1|  ATP-dependent protein binding protein              377   2e-126   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           383   2e-126   
dbj|GAA27344.2|  polyubiquitin-A                                        374   2e-126   
gb|EJU00136.1|  ubiquitin                                               377   2e-126   
ref|XP_001880135.1|  ubiquitin                                          377   2e-126   
gb|EGA57707.1|  Ubi4p                                                   372   2e-126   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  377   2e-126   
ref|XP_002888394.1|  hexaubiquitin protein                              380   2e-126   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             377   2e-126   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          371   2e-126   
gb|EUC59758.1|  polyubiquitin                                           377   2e-126   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           379   2e-126   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  377   2e-126   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                377   2e-126   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 377   2e-126   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  374   2e-126   
gb|ETN78467.1|  ubiquitin family protein                                371   2e-126   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    377   2e-126   
gb|AFR98116.1|  polyubiquitin                                           377   2e-126   
gb|KDR10312.1|  Ubiquitin                                               371   2e-126   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    377   2e-126   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     371   2e-126   
emb|CCA70326.1|  related to UBI4-Ubiquitin                              371   2e-126   
dbj|GAA55031.1|  ubiquitin C                                            371   2e-126   
gb|KIY97628.1|  ubiquitin C                                             374   2e-126   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  377   2e-126   
ref|XP_008816966.1|  polyubiquitin                                      374   2e-126   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   371   2e-126   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          371   3e-126   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  371   3e-126   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         374   3e-126   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      379   3e-126   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  377   3e-126   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         371   3e-126   
gb|AAO43309.1|  putative polyubiquitin                                  372   3e-126   
ref|XP_003607670.1|  Ubiquitin                                          382   3e-126   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    379   3e-126   
gb|EEH07231.1|  ubiquitin                                               374   3e-126   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                382   3e-126   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             379   3e-126   
ref|XP_005831810.1|  ubiquitin                                          370   4e-126   
ref|XP_001210780.1|  ubiquitin                                          373   4e-126   
ref|XP_002551324.1|  ubiquitin                                          373   4e-126   
ref|XP_001227036.1|  polyubiquitin                                      373   4e-126   
gb|KIW56414.1|  polyubiquitin                                           373   4e-126   
gb|AAV65292.1|  polyubiquitin                                           373   4e-126   
ref|XP_004341200.1|  polyubiquitin, putative                            370   4e-126   
gb|EWS74283.1|  polyubiquitin                                           370   5e-126   
ref|XP_002494205.1|  Ubiquitin                                          373   5e-126   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   370   5e-126   
ref|XP_002839703.1|  hypothetical protein                               373   5e-126   
gb|EEQ88150.1|  ubiquitin                                               373   5e-126   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    375   5e-126   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     373   5e-126   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           381   5e-126   
dbj|BAP70433.1|  Ubiquitin                                              373   5e-126   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         373   5e-126   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    381   6e-126   
ref|XP_010756991.1|  polyubiquitin                                      373   6e-126   
gb|KEZ40313.1|  Polyubiquitin                                           373   6e-126   
gb|ABF66639.1|  ubiquitin                                               373   6e-126   
gb|AFW66445.1|  ubiquitin2                                              381   6e-126   
gb|AAC67552.1|  polyubiquitin                                           375   6e-126   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    381   7e-126   
gb|AAO43306.1|  putative polyubiquitin                                  374   7e-126   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             375   7e-126   
gb|AAO43310.1|  putative polyubiquitin                                  370   7e-126   
emb|CAA51679.1|  ubiquitin                                              381   7e-126   
gb|AAA82978.1|  polyubiquitin                                           375   7e-126   
ref|XP_003608276.1|  Ubiquitin                                          381   7e-126   
emb|CCG34086.1|  Polyubiquitin                                          373   7e-126   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           381   7e-126   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                381   7e-126   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      381   7e-126   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    370   8e-126   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           380   8e-126   
emb|CCA16073.1|  polyubiquitin putative                                 381   8e-126   
ref|XP_004365491.1|  polyubiquitin 5                                    370   8e-126   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         383   8e-126   
emb|CCO30833.1|  Polyubiquitin                                          377   8e-126   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         370   8e-126   
gb|AAL91109.1|  ubiquitin                                               372   8e-126   
gb|EEH20847.2|  polyubiquitin                                           373   8e-126   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      380   8e-126   
gb|EZF98642.1|  polyubiquitin                                           370   8e-126   
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         370   9e-126   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    370   9e-126   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             375   9e-126   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      383   9e-126   
gb|ADD24466.1|  Ubiquitin                                               369   9e-126   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             375   9e-126   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              380   9e-126   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    380   9e-126   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         374   9e-126   
gb|ABD32351.2|  Ubiquitin                                               380   1e-125   
ref|XP_659604.1|  hypothetical protein AN2000.2                         373   1e-125   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                380   1e-125   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    370   1e-125   
ref|XP_002791169.1|  ubiquitin                                          372   1e-125   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    380   1e-125   
tpd|FAA00317.1|  TPA: polyubiquitin                                     372   1e-125   
gb|EJD76734.1|  polyubiquitin, variant 2                                373   1e-125   
gb|KHN45015.1|  Polyubiquitin-A                                         383   1e-125   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    372   1e-125   
gb|ABV22331.1|  ubiquitin                                               372   1e-125   
emb|CDI53149.1|  probable Polyubiquitin protein                         372   1e-125   
ref|XP_001538486.1|  polyubiquitin                                      372   1e-125   
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               372   1e-125   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  372   1e-125   
ref|XP_007808982.1|  ubiquitin                                          373   1e-125   
gb|AAA31133.1|  poly-ubiquitin precursor                                370   2e-125   
gb|AAO43305.1|  putative polyubiquitin                                  372   2e-125   
dbj|BAL61084.1|  polyubiqutin                                           375   2e-125   
gb|EMS60894.1|  Polyubiquitin                                           377   2e-125   
tpd|FAA00319.1|  TPA: polyubiquitin                                     377   2e-125   
emb|CAI83758.1|  Polyubiqutin 5                                         369   2e-125   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              369   2e-125   
ref|XP_567862.1|  ATP-dependent protein binding protein                 377   2e-125   
ref|XP_011388891.1|  putative ubiquitin                                 377   2e-125   
ref|XP_667472.1|  ubiquitin B                                           369   2e-125   
ref|XP_003290908.1|  ubiquitin                                          369   2e-125   
ref|XP_002171731.1|  ubiquitin                                          374   2e-125   
ref|XP_007861169.1|  polyubiquitin                                      377   2e-125   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              370   2e-125   
ref|XP_008034069.1|  ubiquitin 10.1                                     377   2e-125   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     380   2e-125   
pir||PS0380  ubiquitin precursor - rice (fragment)                      367   2e-125
ref|XP_007307433.1|  polyubiquitin                                      377   2e-125   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              370   2e-125   
emb|CAX72421.1|  ubiquitin C                                            369   2e-125   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      380   2e-125   
dbj|GAA87419.1|  polyubiquitin                                          371   2e-125   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         369   2e-125   
ref|XP_001246797.1|  polyubiquitin                                      371   2e-125   
gb|ACL98140.1|  ubiquitin C variant                                     369   2e-125   
ref|XP_002099886.1|  GE16472                                            369   3e-125   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    374   3e-125   
gb|AAA28997.1|  ubiquitin                                               369   3e-125   
gb|KIZ01427.1|  ubiquitin C                                             374   3e-125   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          368   3e-125   
ref|XP_002842034.1|  hypothetical protein                               371   3e-125   
gb|AAY33920.2|  polyubiquitin                                           374   3e-125   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              369   3e-125   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              368   3e-125   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   377   3e-125   
gb|EMS24129.1|  ubiquitin C                                             369   3e-125   
ref|XP_008924878.1|  PREDICTED: polyubiquitin isoform X5                369   3e-125   
emb|CAA72799.1|  polyubiquitin precursor                                374   3e-125   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              369   3e-125   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         368   3e-125   
ref|NP_001133175.1|  polyubiquitin                                      368   3e-125   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         368   4e-125   
gb|AAC84175.1|  ubiquitin                                               368   4e-125   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 370   4e-125   
ref|XP_011152175.1|  PREDICTED: polyubiquitin                           374   4e-125   
gb|EKC42613.1|  Ubiquitin                                               368   4e-125   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    378   4e-125   
emb|CAJ32646.1|  ubiquitin                                              368   4e-125   
ref|XP_001610925.1|  polyubiquitin                                      368   4e-125   
gb|ELR08709.1|  polyubiquitin                                           374   4e-125   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       368   4e-125   
ref|XP_001018501.1|  Ubiquitin family protein                           368   4e-125   
ref|XP_010876509.1|  PREDICTED: polyubiquitin-B                         368   5e-125   
tpd|FAA00316.1|  TPA: polyubiquitin                                     374   5e-125   
gb|AAX43350.1|  ubiquitin B                                             368   5e-125   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              368   5e-125   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  374   5e-125   
ref|NP_013061.1|  ubiquitin                                             373   5e-125   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              367   5e-125   
ref|XP_453980.1|  hypothetical protein                                  373   5e-125   
ref|NP_983342.1|  ACL062Cp                                              373   5e-125   
ref|XP_002771956.1|  polyubiquitin, putative                            367   6e-125   
ref|NP_595409.1|  ubiquitin                                             373   6e-125   
ref|NP_061828.1|  polyubiquitin-B precursor                             367   6e-125   
gb|KFP25549.1|  Polyubiquitin-B                                         367   6e-125   
dbj|BAO38900.1|  ubiquitin                                              373   6e-125   
ref|XP_010298601.1|  PREDICTED: polyubiquitin-B isoform X3              367   6e-125   
ref|XP_008477814.1|  PREDICTED: polyubiquitin-B isoform X1              370   6e-125   
ref|XP_005439794.1|  PREDICTED: polyubiquitin-B isoform X3              367   6e-125   
ref|XP_011275993.1|  ubiquitin C                                        373   6e-125   
gb|AEH41483.1|  ubiquitin                                               370   6e-125   
dbj|BAE40351.1|  unnamed protein product                                369   6e-125   
ref|XP_002627625.1|  ubiquitin                                          373   6e-125   
ref|XP_005620147.1|  PREDICTED: polyubiquitin-B isoform X2              367   6e-125   
ref|XP_005056763.1|  PREDICTED: polyubiquitin-C-like isoform X1         370   7e-125   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       373   7e-125   
ref|XP_003590494.1|  Ubiquitin                                          370   7e-125   
emb|CAA11269.1|  polyubiquitin                                          373   7e-125   
gb|ABD78847.1|  ubiquitin C II                                          369   7e-125   
emb|CAJ41447.1|  polyubiquitin                                          370   7e-125   
ref|XP_008047384.1|  PREDICTED: polyubiquitin-B                         367   7e-125   
ref|XP_958803.1|  ubiquitin                                             370   7e-125   
dbj|BAH71115.1|  ACYPI006410                                            367   7e-125   
ref|XP_003331105.1|  polyubiquitin-A                                    380   8e-125   
gb|KFY77115.1|  hypothetical protein V499_03430                         373   8e-125   
emb|CAX72419.1|  polyubiquitin                                          368   8e-125   
gb|EJD76736.1|  polyubiquitin, variant 1                                373   9e-125   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             369   9e-125   
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    383   9e-125   
gb|AEG78435.1|  ubiquitin C variant 3                                   369   9e-125   
ref|XP_001616591.1|  polyubiquitin 5                                    373   9e-125   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             375   9e-125   
gb|EIE87024.1|  polyubiquitin                                           367   9e-125   
emb|CAB55973.1|  hypothetical protein                                   367   9e-125   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           378   1e-124   
emb|CAX79692.1|  ubiquitin C                                            367   1e-124   
ref|XP_005498325.1|  PREDICTED: polyubiquitin-C isoform X2              369   1e-124   
gb|AFC36452.1|  ubiquitin                                               366   1e-124   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        382   1e-124   



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   382 bits (982),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  17   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  75

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  76   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  135

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  136  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  195

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  RTLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  501  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  322
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  321  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  142
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  141  TLADYNIQKESTLHLVLRLRGGF  73
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  66   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  114


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  142  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  190



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   382 bits (980),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  19   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  77

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  78   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  137

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  138  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  197

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  198  RTLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  507  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  328
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  327  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  148
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  147  GRTLADYNIQKESTLHLVLRLRGGF  73
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  68   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  116


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  144  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  192



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   381 bits (978),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  2    KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGF  204


 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = -1

Query  456  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  277
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  276  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  97
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  96   VLRLRGGF  73
            VLRLRGG 
Sbjct  121  VLRLRGGM  128


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  51   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  99


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  127  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  175



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   382 bits (980),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG+
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGY  229


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  217
            VLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  222  VLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   381 bits (978),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQ+KEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQNKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQNKEGIPPDQQRLIFAGK  48



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   381 bits (979),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 198/211 (94%), Gaps = 1/211 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF*IP*CPN  52
            RTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   381 bits (978),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   380 bits (976),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  13   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  71

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  72   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  131

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  132  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  191

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  192  RTLADYNIQKESTLHLVLRLRGGL  215


 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -1

Query  489  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  310
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  309  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  130
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  129  YNIQKESTLHLVLRLRGGF*I  67
            YNIQKESTLHLVLRLRGG  I
Sbjct  121  YNIQKESTLHLVLRLRGGMQI  141


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  62   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  110


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  138  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  186



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   381 bits (979),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  16   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  74

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  75   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  134

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  135  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  194

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  RTLADYNIQKESTLHLVLRLRGGM  218


 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  498  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  319
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  318  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  139
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  138  LADYNIQKESTLHLVLRLRGGF  73
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142


 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  92   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  150

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  151  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  210

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223
            VLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  211  VLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  65   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  113


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  141  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  189



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   304 bits (778),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   380 bits (977),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLXLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (770),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   382 bits (982),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  75   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  133

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  134  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  193

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  194  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  253

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  254  RTLADYNIQKESTLHLVLRLRGGF  277


 Score =   303 bits (776),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  203


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  124  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  172


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  200  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  248


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  49   MQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  96



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   380 bits (976),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   304 bits (778),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   380 bits (976),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  21   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  79

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  80   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  139

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  140  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  199

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  200  RTLADYNIQKESTLHLVLRLRGG  222


 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -1

Query  492  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  313
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  312  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  132  DYNIQKESTLHLVLRLRGGF  73
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  70   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  118


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  146  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  194



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   380 bits (976),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGI  229


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   381 bits (979),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 144/152 (95%), Gaps = 1/152 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  229
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGM  301
            VLRLRGG+
Sbjct  222  VLRLRGGV  229


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   383 bits (984),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P+  +   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEG-IPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   380 bits (975),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  17   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  75

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  76   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  135

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  136  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  195

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  196  RTLADYNIQKESTLHLVLRLRGG  218


 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  501  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  322
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  321  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  142
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  141  TLADYNIQKESTLHLVLRLRGGF  73
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  66   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  114


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  142  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  190



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   383 bits (983),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  94   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  152

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  153  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  212

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  213  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  272

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  273  RTLADYNIQKESTLHLVLRLRGGF  296


 Score =   380 bits (976),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  18   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  76

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  77   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  136

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  137  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  196

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  RTLADYNIQKESTLHLVLRLRGGM  220


 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -1

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  67   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  115


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  143  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  191


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  219  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  267



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  687  SRAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  508
            ++AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  26   AKAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  84

Query  507  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  328
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  85   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  144

Query  327  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  148
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  145  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  204

Query  147  GRTLADYNIQKESTLHLVLRLRGG  76
            GRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  GRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   383 bits (983),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   380 bits (977),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  13   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  71

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  72   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  131

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  132  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  191

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  192  RTLADYNIQKESTLHLVLRLRGG  214


 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -1

Query  489  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  310
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  309  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  130
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  129  YNIQKESTLHLVLRLRGGF*I  67
            YNIQKESTLHLVLRLRGG  I
Sbjct  121  YNIQKESTLHLVLRLRGGMQI  141


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  62   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  110


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  138  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  186



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIF  292
            VLRLRGG+  F
Sbjct  222  VLRLRGGLTGF  232


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   381 bits (979),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  68   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  126

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  127  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  186

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  187  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  246

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  247  RTLADYNIQKESTLHLVLRLRGGF  270


 Score =   367 bits (942),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/186 (99%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = -1

Query  630  FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  451
             FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  9    IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  68

Query  450  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  271
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  69   AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  128

Query  270  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  129  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  188

Query  90   RLRGGF  73
            RLRGG 
Sbjct  189  RLRGGM  194


 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -1

Query  426  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  246  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  41   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  89


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  117  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  165


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  193  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  241



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   383 bits (983),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADNNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   383 bits (983),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVES+DTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESTDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   380 bits (975),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   382 bits (982),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   378 bits (971),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   382 bits (980),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  47   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  105

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  106  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  165

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  166  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  225

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  226  RTLADYNIQKESTLHLVLRLRGGM  249


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = -1

Query  546  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  367
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  366  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  187
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  186  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   290 bits (743),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  123  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  181

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  182  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  241

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  205
            VLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  242  VLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  96   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  144


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  172  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  220



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   380 bits (976),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  47   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  105

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  106  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  165

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  166  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  225

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  226  RTLADYNIQKESTLHLVLRLRGG  248


 Score =   344 bits (883),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  591  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  412
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  411  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  232
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  231  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  20   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  68


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  96   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  144


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  172  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  220



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   381 bits (978),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  72   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  130

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  131  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  190

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  191  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  250

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  251  RTLADYNIQKESTLHLVLRLRGGF  274


 Score =   371 bits (952),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 191/201 (95%), Gaps = 1/201 (0%)
 Frame = -1

Query  669  DKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  490
            DKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  1    DKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  59

Query  489  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  310
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  60   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  119

Query  309  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  130
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  120  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  179

Query  129  YNIQKESTLHLVLRLRGGF*I  67
            YNIQKESTLHLVLRLRGG  I
Sbjct  180  YNIQKESTLHLVLRLRGGMQI  200


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  45   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  93


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  121  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  169


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  197  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  245



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   380 bits (977),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  62   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  120

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  121  GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  180

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  181  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  240

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  241  RTLADYNIQKESTLHLVLRLRGGF  264


 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -1

Query  603  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  424
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  423  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  244
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  243  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  187  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  235


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  111  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  159


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  36   MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  83



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   379 bits (974),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  48



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   381 bits (978),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  67   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  125

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  126  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  185

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  186  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  245

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  246  RTLADYNIQKESTLHLVLRLRGGF  269


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  195


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  116  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  164


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  192  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  240


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  41   MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  88



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   382 bits (981),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  106  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  164

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  165  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  224

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  225  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  284

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  285  RTLADYNIQKESTLHLVLRLRGGF  308


 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  30   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  88

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  89   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  148

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  149  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  208

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  209  RTLADYNIQKESTLHLVLRLRGGM  232


 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  540  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  361
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  360  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  181
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  180  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  3    GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  51


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  79   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  127


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  155  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  203


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  231  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  279



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   380 bits (977),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 161/204 (79%), Gaps = 36/204 (18%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTIT                                   LEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTIT-----------------------------------LEDG  246

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  247  RTLADYNIQKESTLHLVLRLRGGF  270


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   380 bits (976),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  63   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  121

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  122  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  181

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  182  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  241

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  242  RTLADYNIQKESTLHLVLRLRGGF  265


 Score =   367 bits (943),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  630  FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  451
             FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  4    IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  63

Query  450  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  271
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  64   AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  123

Query  270  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  124  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  183

Query  90   RLRGGF*I  67
            RLRGG  I
Sbjct  184  RLRGGMQI  191


 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = -1

Query  411  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  232
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  231  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  115


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  36   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  84


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  112  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  160


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  188  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  236



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG+
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGY  305


 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQD+EG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDQEGIPPDQQRF-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   377 bits (969),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q    PPDQQR IF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDQ-EGIPPDQQRFIFAGK  124



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 153/161 (95%), Gaps = 1/161 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  202
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   381 bits (979),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  54   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  112

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  113  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  172

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  173  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  232

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  233  RTLADYNIQKESTLHLVLRLRGGM  256


 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 155/163 (95%), Gaps = 1/163 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  130  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  188

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  189  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  248

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  196
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  249  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  103  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  151


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  179  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  227



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   380 bits (977),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  38   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  96

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  156

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  157  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  216

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  217  RTLADYNIQKESTLHLVLRLRGGM  240


 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -1

Query  564  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  385
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  384  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  205
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  204  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164


 Score =   312 bits (800),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 161/169 (95%), Gaps = 1/169 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  114  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  172

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  173  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  232

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  178
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  233  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  11   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  59


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  87   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  135


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  163  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  211



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   379 bits (972),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQK+STLHLVLRLRGG
Sbjct  206  RTLADYNIQKDSTLHLVLRLRGG  228


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   380 bits (975),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 198/211 (94%), Gaps = 1/211 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  51   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  109

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  110  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  169

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  170  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  229

Query  144  RTLADYNIQKESTLHLVLRLRGGF*IP*CPN  52
            RTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  230  RTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  549  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  370
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  369  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  189  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  100  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  156

Query  595  P-RRLQHPEGVHPPSR  551
                +Q    +H   R
Sbjct  157  ADYNIQKESTLHLVLR  172


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  176  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  232

Query  595  P-RRLQHPEGVHPPSR  551
                +Q    +H   R
Sbjct  233  ADYNIQKESTLHLVLR  248


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPYP  593
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR   
Sbjct  25   MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTLA  81

Query  592  -RRLQHPEGVHPPSR  551
               +Q    +H   R
Sbjct  82   DYNIQKESTLHLVLR  96



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   381 bits (978),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 184/192 (96%), Gaps = 1/192 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKES  109
            RTLADYNIQKE+
Sbjct  282  RTLADYNIQKEN  293


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   380 bits (975),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/168 (94%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  181
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVE+SDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVENSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   381 bits (978),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGL  305


 Score =   381 bits (978),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   378 bits (971),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            R LADYNIQKESTLHLVLRLRGG
Sbjct  206  RNLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/157 (94%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  214
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   381 bits (978),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   378 bits (971),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIF  626
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIF  121



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   381 bits (978),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVXRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPYP  593
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR   
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTLA  57

Query  592  -RRLQHPEGVHPPSR  551
               +Q    +H   R
Sbjct  58   DYNIQKESTLHLVXR  72



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   381 bits (978),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (971),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 194/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRG  79
            RTLADYNIQKESTLHLVLRLRG
Sbjct  282  RTLADYNIQKESTLHLVLRLRG  303


 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  68   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  126

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  127  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  186

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  187  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  246

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  RTLADYNIQKESTLHLVLRLRGGM  270


 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/186 (98%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = -1

Query  630  FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  451
             FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVK
Sbjct  9    IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVESSDTIDNVK  68

Query  450  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  271
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  69   AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  128

Query  270  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  129  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  188

Query  90   RLRGGF  73
            RLRGG 
Sbjct  189  RLRGGM  194


 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 155/163 (95%), Gaps = 1/163 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  144  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  202

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  203  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  262

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  196
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  263  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305


 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -1

Query  426  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  246  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  117  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  165


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  193  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  241


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI +K L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  41   GMQIFLKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  89



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   380 bits (976),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  18   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  76

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  77   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  136

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  137  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  196

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  197  RTLADYNIQKESTLHLVLRLRGGMQI  222


 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 187/203 (92%), Gaps = 9/203 (4%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  94   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  152

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  153  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  212

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  213  VLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLIFAGKQLEDG  264

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  265  RTLADYNIQKESTLHLVLRLRGG  287


 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -1

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQI  146


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  67   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  115


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  143  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  191



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGM  301
            VLRLRGG+
Sbjct  298  VLRLRGGV  305


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   380 bits (976),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 188/204 (92%), Gaps = 9/204 (4%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLIFAGKQLEDG  273

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG+
Sbjct  274  RTLADYNIQKESTLHLVLRLRGGY  297


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   379 bits (974),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGI  305


 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   379 bits (974),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLE  256
            VLRLRGGMQIFVKTLTGKTITLE
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLE  244


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  132

Query  595  P-RRLQHPEGVHPPSR  551
                +Q    +H   R
Sbjct  133  ADYNIQKESTLHLVLR  148


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  208

Query  595  P-RRLQHPEGVHPPSR  551
                +Q    +H   R
Sbjct  209  ADYNIQKESTLHLVLR  224



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   380 bits (977),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   381 bits (978),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIF  292
            VLRLRGGMQI 
Sbjct  298  VLRLRGGMQIL  308


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   380 bits (977),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   379 bits (973),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVES DTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESXDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   383 bits (984),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   378 bits (971),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (971),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   380 bits (976),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   380 bits (976),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   378 bits (970),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  8    KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  66

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  67   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  126

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  127  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  186

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTL+DYNIQKESTLHLVLRLRGG  I
Sbjct  187  RTLSDYNIQKESTLHLVLRLRGGMQI  212


 Score =   281 bits (720),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 148/156 (95%), Gaps = 1/156 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  84   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  142

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  143  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  202

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  217
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  203  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238


 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -1

Query  474  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  295
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  294  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  115
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  114  ESTLHLVLRLRGGF*I  67
            ESTLHLVLRLRGG  I
Sbjct  121  ESTLHLVLRLRGGMQI  136


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  57   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  105


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  133  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  181



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   383 bits (983),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (975),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYN+QKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNVQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   383 bits (983),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   383 bits (983),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   380 bits (976),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   379 bits (972),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLTDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   377 bits (968),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   382 bits (981),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  154  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  212

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  213  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  272

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  273  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  332

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  333  RTLADYNIQKESTLHLVLRLRGG  355


 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  630  FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  451
             FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  95   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  154

Query  450  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  271
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  155  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  214

Query  270  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  215  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  274

Query  90   RLRGGF*I  67
            RLRGG  I
Sbjct  275  RLRGGMQI  282


 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 153/206 (74%), Gaps = 51/206 (25%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  427
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  426  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQI  206


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIF  626
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF
Sbjct  127  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIF  172


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIF  626
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF
Sbjct  203  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIF  248


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIF  626
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF
Sbjct  279  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIF  324



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   383 bits (983),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQ+KEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQEKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +  ++    PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK-IQEKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   380 bits (976),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   377 bits (969),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQ KEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQHKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   383 bits (983),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   383 bits (983),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   378 bits (970),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVES+DTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESTDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  63   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  121

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  122  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  181

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  182  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  241

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  242  RTLADYNIQKESTLHLVLRLRGGMQI  267


 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  139  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  197

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  198  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  257

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  258  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  317

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  318  RTLADYNIQKESTLHLVLRLRGG  340


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  191


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  112  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  160


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  188  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  236


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  264  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  312



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>prf||1604470A poly-ubiquitin
Length=272

 Score =   379 bits (972),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  70   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  128

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  129  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  188

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  189  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  248

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  249  RTLADYNIQKESTLHLVLRLRGG  271


 Score =   367 bits (942),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  630  FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  451
             FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  11   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  70

Query  450  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  271
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  71   AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  130

Query  270  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  91
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  131  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  190

Query  90   RLRGGF*I  67
            RLRGG  I
Sbjct  191  RLRGGMQI  198


 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -1

Query  429  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  250
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  249  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*  70
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  69   I  67
            I
Sbjct  122  I  122


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  43   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  91


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  119  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  167


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  195  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  243



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  175  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  233

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  234  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  293

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  294  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  353

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  354  RTLADYNIQKESTLHLVLRLRGGF  377


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  23   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  81

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  82   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  141

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  142  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  201

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  202  RTLADYNIQKESTLHLVLRLRGGM  225


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  99   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  157

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  158  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  217

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  218  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  277

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  278  RTLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -1

Query  519  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  340
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  339  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  160
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  159  QLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  72   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  120


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  148  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  196


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  224  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  272


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  300  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  348



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   378 bits (970),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (970),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKI DKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIXDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIXDKEG--IPPDQQRLIFAGK  124



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGF  305


 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL DYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   378 bits (970),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  284

Query  595  P-RRLQHPEGVHPPSR  551
            P   +Q    +H   R
Sbjct  285  PDYNIQKESTLHLVLR  300


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  109  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  167

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  168  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  227

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  228  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  287

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  288  RTLADYNIQKESTLHLVLRLRGG  310


 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 179/214 (84%), Gaps = 11/214 (5%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLR--------LRGGM  529
            +AKIQDKEG  P   R   FAGKQLEDGR L      + +  H             R  M
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRNLIFSPFARNA--HTARSPISDPRSPRRSKM  83

Query  528  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  349
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  84   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  143

Query  348  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  169
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  144  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  203

Query  168  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  204  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  237


 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 136/161 (84%), Gaps = 6/161 (4%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA---  361
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  360  ---DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  190
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  189  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  161


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  158  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  206


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  234  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  282



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  199  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  257

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  258  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  317

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  318  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  377

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  378  RTLADYNIQKESTLHLVLRLRGGF  401


 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  47   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  105

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  106  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  165

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  166  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  225

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  226  RTLADYNIQKESTLHLVLRLRGGM  249


 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  123  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  181

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  182  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  241

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  242  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  301

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  302  RTLADYNIQKESTLHLVLRLRGGM  325


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  96   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  144


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  172  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  220


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  248  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  296


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  324  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  372



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   376 bits (966),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKESTLHL
Sbjct  86   GKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDN+K +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNIKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVE+SDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVENSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQI  295
            VLRLRGG ++
Sbjct  374  VLRLRGGFRM  383


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 156/164 (95%), Gaps = 1/164 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  193
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTVT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   377 bits (967),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ+ESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  205  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  263

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  264  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  323

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  383

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  384  RTLADYNIQKESTLHLVLRLRGGF  407


 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  129  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  187

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  188  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  247

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  248  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  307

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  308  RTLADYNIQKESTLHLVLRLRGGMQI  333


 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/185 (98%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -1

Query  621  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  442
             KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  73   AKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  132

Query  441  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  262
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  133  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  192

Query  261  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  82
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  193  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  252

Query  81   GGF*I  67
            GG  I
Sbjct  253  GGMQI  257


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  102  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  150


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  178  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  226


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  254  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  302


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  330  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  378



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFIKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (970),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI +K L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFIKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   379 bits (974),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGL  305


 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVE+SDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVENSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   377 bits (967),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  68   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  126

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  127  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  186

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  187  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  246

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  RTLADYNIQKESTLHLVLRLRGGM  270


 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 194/202 (96%), Gaps = 1/202 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  144  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  202

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  203  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  262

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  263  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  322

Query  144  RTLADYNIQKESTLHLVLRLRG  79
            RTLADYNIQKESTLHLVLRLRG
Sbjct  323  RTLADYNIQKESTLHLVLRLRG  344


 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  612  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  433
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  15   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  74

Query  432  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  253
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  75   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  134

Query  252  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  41   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  89


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  117  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  165


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  193  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  241


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  269  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  317



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  16   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  74

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  75   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  134

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  135  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  194

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  RTLSDYNIQKESTLHLVLRLRGG  217


 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  498  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  319
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  318  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  139
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  138  LADYNIQKESTLHLVLRLRGGF  73
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  65   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  113


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  141  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  189



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   380 bits (977),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  55   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  113

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  114  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  173

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  174  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  233

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  234  RTLADYNIQKESTLHLVLRLRGGMQI  259


 Score =   380 bits (976),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  131  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  189

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  190  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  249

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  250  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  309

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  310  RTLADYNIQKESTLHLVLRLRGG  332


 Score =   333 bits (853),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -1

Query  576  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  397
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  396  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  217
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  216  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  183


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  28   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  76


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  104  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  152


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  180  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  228


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  256  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  304



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 193/201 (96%), Gaps = 1/201 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLR  82
            RTLADYNIQKESTLHLVLRLR
Sbjct  206  RTLADYNIQKESTLHLVLRLR  226


 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTL LVLRLRGGF
Sbjct  206  RTLADYNIQKESTLPLVLRLRGGF  229


 Score =   301 bits (771),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGM  301
            VLRLRGG+
Sbjct  222  VLRLRGGV  229


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   378 bits (971),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG+
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGY  381


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   379 bits (973),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   376 bits (966),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   377 bits (967),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  45   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  103

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  104  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  163

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  164  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  223

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  224  RTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   337 bits (865),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -1

Query  585  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  406
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  405  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  225  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  18   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  66


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  94   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  142


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  170  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  218



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   379 bits (972),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +  ++    PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK-IQEKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   379 bits (974),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLT
Sbjct  101  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLT  159

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  160  GKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  219

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  220  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  279

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  280  RTLADYNIQKESTLHLVLRLRGGM  303


 Score =   378 bits (971),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLV RLRGGMQIFVKTLT
Sbjct  25   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVFRLRGGMQIFVKTLT  83

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  84   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  143

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  144  VLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  203

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  204  RTLADYNIQKESTLHLVLRLRGGM  227


 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  750  RPLTGKXHXPSRWRAXTPLITSRAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQK  571
            R LTGK        + T +   +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQK
Sbjct  156  RTLTGKTITLEVESSDT-VDNVKAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQK  213

Query  570  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  391
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  214  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  273

Query  390  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  220
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  274  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330


 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  151


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  74   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  122


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  226  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  274


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI V+ L  K  + LEVESSDT+DNVK +   Q +E  PPDQQRLIF  K
Sbjct  150  GMQIFVRTLTGKTIT-LEVESSDTVDNVKAK--IQDKEGIPPDQQRLIFAGK  198



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   378 bits (971),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (971),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   381 bits (979),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   +   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEG-IPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   381 bits (979),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  104  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  162

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  163  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  222

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  223  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  282

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  283  RTLADYNIQKESTLHLVLRLRGGM  306


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  180  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  238

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  239  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  298

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLIFAGKQLEDG
Sbjct  299  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIFAGKQLEDG  358

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  359  RTLADYNIQKESTLHLVLRLRGG  381


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   +   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  28   KAKIQDKEG-IPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  86

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  87   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  146

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  147  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  206

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  207  RTLADYNIQKESTLHLVLRLRGGM  230


 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  77   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  125


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  153  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  201


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  229  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  277


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  305  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGVPPDQQRLIFAGK  353



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   378 bits (971),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   378 bits (971),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLV+RLRGG 
Sbjct  282  RTLADYNIQKESTLHLVVRLRGGM  305


 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            V+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   379 bits (974),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  61   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  119

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  120  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  179

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  180  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  239

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  240  RTLADYNIQKESTLHLVLRLRGGMQI  265


 Score =   379 bits (973),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  137  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  195

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  196  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  255

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  256  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  315

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  316  RTLADYNIQKESTLHLVLRLRGG  338


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  189


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  110  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  158


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  186  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  234


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  262  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  310



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGL  381


 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI AGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGF  381


 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/206 (94%), Positives = 195/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGMQI  307


 Score =   373 bits (957),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 193/206 (94%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AK QDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKTQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHL
Sbjct  86   GKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGMQI  231


 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG  I
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQI  155


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--TQDKEGIPPDQQRLIFAGK  48


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDT DNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTTDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   379 bits (974),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  61   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  119

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  120  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  179

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  180  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  239

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  240  RTLADYNIQKESTLHLVLRLRGGM  263


 Score =   379 bits (973),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  137  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  195

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  196  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  255

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  256  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  315

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  316  RTLADYNIQKESTLHLVLRLRGG  338


 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  540  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  361
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  360  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  181
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  180  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  34   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  82


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  110  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  158


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  186  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  234


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQ-DPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   ++G   PPDQQRLIF  K
Sbjct  262  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGK  310



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   375 bits (963),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN+QKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLQDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG  I
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQI  155


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   378 bits (971),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDT+DNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTVDNVKAK--IQDKEGIPPDQQRLIFAGK  124



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   375 bits (963),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKE+ LHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKETNLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGREFPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +  +   + PPDQQRLIF  K
Sbjct  152  GMQIFVKNLTGKTIT-LEVESSDTIDNVKAK-IQDKEDIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPYP  593
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR   
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTLA  57

Query  592  -RRLQHPEGVHPPSR  551
               +Q    +H   R
Sbjct  58   DYNIQKETNLHLVLR  72



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   378 bits (970),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            G TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KVKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L     + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGNTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGL  381


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRL+F  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLVFAGK  276



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   375 bits (963),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGGF
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  48



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   378 bits (971),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   366 bits (939),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVL  91
            RTL+DYNIQKESTLHLV 
Sbjct  282  RTLSDYNIQKESTLHLVF  299


 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 46/86 (53%), Gaps = 6/86 (7%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  284

Query  595  P-RRLQHPEGVHPPSRAPFERRHANL  521
                +Q    +H         + +N+
Sbjct  285  SDYNIQKESTLHLVFVCVVVTKSSNV  310


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGM  301
            VLRLRGG+
Sbjct  374  VLRLRGGV  381


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   381 bits (978),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  29   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  87

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  88   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  147

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  148  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  207

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  208  RTLADYNIQKESTLHLVLRLRGGM  231


 Score =   381 bits (978),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  105  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  163

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  164  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  223

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  224  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  283

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  284  RTLADYNIQKESTLHLVLRLRGGM  307


 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  181  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  239

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  240  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  299

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  300  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  359

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  360  RTLADYNIQKESTLHLVLRLRGG  382


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  78   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  126


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  154  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  202


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  230  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  278


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  306  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  354



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGL  381


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   382 bits (981),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  223  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  281

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  282  GKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  341

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  342  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  401

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  402  RTLADYNIQKESTLHLVLRLRGGF  425


 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  71   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  129

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  130  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  189

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  190  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  249

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  250  RTLADYNIQKESTLHLVLRLRGGMQI  275


 Score =   380 bits (975),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 194/206 (94%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  147  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  205

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  206  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  265

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  266  VLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  325

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  326  RTLADYNIQKESTLHLVLRLRGGMQI  351


 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  543  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  364
            LR  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  41   LRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  100

Query  363  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  184
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  101  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  160

Query  183  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  161  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  199


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  120  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  168


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  196  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  244


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  348  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  396


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDT+DNVK +   Q +E  PPDQQRLIF  K
Sbjct  272  GMQIFVKTLTGKTIT-LEVESSDTVDNVKAK--IQDKEGIPPDQQRLIFAGK  320



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   375 bits (962),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  200



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   382 bits (981),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  227  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  285

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  286  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  345

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  346  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  405

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  406  RTLADYNIQKESTLHLVLRLRGGF  429


 Score =   380 bits (975),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  75   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  133

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  134  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  193

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  194  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  253

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  254  RTLADYNIQKESTLHLVLRLRGGM  277


 Score =   380 bits (975),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  151  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  209

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  210  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  269

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  270  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  329

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  330  RTLADYNIQKESTLHLVLRLRGGM  353


 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  124  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  172


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  200  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  248


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  276  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  324


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  352  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  400



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   378 bits (971),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + L+VESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LKVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   378 bits (970),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGL  305


 Score =   377 bits (969),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTI+NVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIENVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTI+NVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIENVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTI+NVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIENVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (975),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTVT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   374 bits (959),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 192/201 (96%), Positives = 192/201 (96%), Gaps = 1/201 (0%)
 Frame = -1

Query  678  KIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  499
            KIQDKEG  P   R   FAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  1    KIQDKEGIPPDQQRL-IFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  59

Query  498  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  319
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  60   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  119

Query  318  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  139
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  120  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  179

Query  138  LADYNIQKESTLHLVLRLRGG  76
            LADYNIQKESTLHLVLRLRGG
Sbjct  180  LADYNIQKESTLHLVLRLRGG  200


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  48   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  96


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  124  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  172



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (977),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (973),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   379 bits (973),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF KTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFCKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   375 bits (962),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  48



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   380 bits (975),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  80   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  138

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  139  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  198

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  199  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  258

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  259  RTLADYNIQKESTLHLVLRLRGGMQI  284


 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 185/204 (91%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  156  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  214

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  215  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  274

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  275  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  334

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNI   +   L  + R  F
Sbjct  335  RTLADYNITPLTMSRLRSKTRRAF  358


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  208


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  129  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  177


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  205  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  253


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  281  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  329



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKE+TLHLVLRLRGG 
Sbjct  282  RTLADYNIQKETTLHLVLRLRGGM  305


 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTID+VK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDHVKAK--IQDKEGIPPDQQRLIFAGK  200



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV TLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 192/203 (95%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  206  RTLADYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  200



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>ref|XP_003542730.1| PREDICTED: polyubiquitin 10-like [Glycine max]
 gb|KHN09976.1| Polyubiquitin 10 [Glycine soja]
Length=457

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   378 bits (970),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   376 bits (965),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTIT  262
            VLRLRGGM+I   TL  K IT
Sbjct  298  VLRLRGGMEIIEDTLASKIIT  318


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  200


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  276



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  110  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  168

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  169  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  228

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  229  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  288

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  289  RTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  34   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  92

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  93   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  152

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  153  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  212

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  213  RTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  83   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  131


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  159  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  207


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  235  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  283


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  784  SVXGXGMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            ++    MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  2    TISSSNMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  55



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   378 bits (970),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 194/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  352



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   380 bits (976),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGL  381


 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            V  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRKTAR-GRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K    GR  
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEDGRTL  132

Query  595  P-RRLQHPEGVHPPS  554
                +Q    +H  S
Sbjct  133  ADYNIQKESTLHLVS  147


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGMQI  307


 Score =   379 bits (972),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/206 (94%), Positives = 195/206 (95%), Gaps = 1/206 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF*I  67
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGMQI  231


 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 1/194 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTL  103
            RTLADYNIQKE+ L
Sbjct  358  RTLADYNIQKENPL  371


 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  67
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  155


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|KJB81827.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=457

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>ref|XP_009784905.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784906.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
Length=457

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  200



>gb|KJB13590.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
 gb|KJB13591.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=461

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 196/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  255  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  313

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  314  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  373

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  374  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  433

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  434  RTLADYNIQKESTLHLVLRLRGGF  457


 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  RTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  331  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  389

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  390  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  449

Query  324  VLRLRGGMQI  295
            VLRLRGG ++
Sbjct  450  VLRLRGGFRM  459


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  380  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  428



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            + KIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KTKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGGF
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   375 bits (962),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKTK--IQDKEGIPPDQQRLIFAGK  124



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLADYNIQKESTLHLVLRLRGGM  305


 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  179  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  237

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  238  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  297

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  298  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  357

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  358  RTLADYNIQKESTLHLVLRLRGG  380


 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  304  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  352



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   375 bits (963),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DY+IQKESTLHLVLRLRGG 
Sbjct  282  RTLSDYSIQKESTLHLVLRLRGGL  305


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  117  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  175

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  176  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  235

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  236  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  295

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  296  RTLSDYNIQKESTLHLVLRLRGGL  319


 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  41   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  99

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  100  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  159

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  160  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  219

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  220  RTLSDYNIQKESTLHLVLRLRGGM  243


 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  543  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  364
            L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  11   LAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  70

Query  363  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  184
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  71   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  130

Query  183  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  131  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  167


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  90   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  138


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  166  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  214


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  242  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  290


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  784  SVXGXGMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            S+    MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  9    SLLAYSMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  62



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  200


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+G
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLADYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTLADYNIQKESTLHLVLRLRGG
Sbjct  282  RTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFR-RKTARGRPY  596
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  ++   GR  
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGKQLEEGRTL  208

Query  595  P-RRLQHPEGVHPPSR  551
                +Q    +H   R
Sbjct  209  ADYNIQKESTLHLVLR  224


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  124


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  228  GMQIFVKTLTGKTIT-LEVESSDTIDNVKAK--IQDKEGIPPDQQRLIFAGK  276



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   374 bits (960),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            ++KIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KSKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  171  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  73
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  76   GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  124


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = -3

Query  769  GMQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            GMQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  152  GMQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  200


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -3

Query  766  MQIXVKALNRKXPSPLEVESSDTIDNVKGQDPRQGRE-FPPDQQRLIFRRK  617
            MQI VK L  K  + LEVESSDTIDNVK +   Q +E  PPDQQRLIF  K
Sbjct  1    MQIFVKTLTGKTIT-LEVESSDTIDNVKSK--IQDKEGIPPDQQRLIFAGK  48



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   377 bits (968),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 1/204 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  27   KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  85

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  86   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  145

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  146  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  205

Query  144  RTLADYNIQKESTLHLVLRLRGGF  73
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  206  RTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 195/203 (96%), Gaps = 1/203 (0%)
 Frame = -1

Query  684  RAKIQDKEGNSPRTSRG*FFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  505
            +AKIQDKEG  P   R   FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  103  KAKIQDKEGIPPDQQRL-IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT  161

Query  504  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  325
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  162  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL  221

Query  324  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  145
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  222  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  281

Query  144  RTLADYNIQKESTLHLVLRLRGG  76
            RTL+DYNIQKESTLHLVLRLRGG
Sbjct  282  RTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  531  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  352
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  351  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE