BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031P11

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 233   3e-76   Triticum urartu
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...    233   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 233   9e-76   
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    233   9e-76   Sesamum indicum [beniseed]
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    231   2e-75   Cucumis melo [Oriental melon]
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    230   2e-75   Cucumis sativus [cucumbers]
dbj|BAJ97692.1|  predicted protein                                      232   2e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    228   3e-75   Gossypium arboreum [tree cotton]
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    231   4e-75   Brachypodium distachyon [annual false brome]
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    230   4e-75   Gossypium arboreum [tree cotton]
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    232   5e-75   Nicotiana tomentosiformis
gb|ADB24772.1|  rhamnose synthase                                       230   5e-75   Gossypium hirsutum [American cotton]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                   231   6e-75   Citrus sinensis [apfelsine]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             231   6e-75   Capsella rubella
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg             230   6e-75   Citrus clementina [clementine]
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...    229   1e-74   Citrus sinensis [apfelsine]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    228   1e-74   Sesamum indicum [beniseed]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    229   1e-74   
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    229   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    228   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    226   2e-74   Eucalyptus grandis [rose gum]
gb|ADB24773.1|  rhamnose synthase                                       228   2e-74   Gossypium hirsutum [American cotton]
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    233   3e-74   Nicotiana tomentosiformis
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...    228   3e-74   Camelina sativa [gold-of-pleasure]
gb|KJB61502.1|  hypothetical protein B456_009G362500                    228   3e-74   Gossypium raimondii
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg             230   3e-74   Prunus persica
emb|CDY20084.1|  BnaA01g29180D                                          226   3e-74   Brassica napus [oilseed rape]
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    229   3e-74   
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...    231   4e-74   Malus domestica [apple tree]
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    234   4e-74   Solanum lycopersicum
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    225   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...    230   4e-74   Prunus mume [ume]
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    229   4e-74   Fragaria vesca subsp. vesca
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    229   4e-74   Nicotiana sylvestris
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...    227   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...    226   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002887744.1|  RHM1/ROL1                                          227   6e-74   
gb|KDP30504.1|  hypothetical protein JCGZ_17141                         227   6e-74   Jatropha curcas
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    229   6e-74   Oryza brachyantha
emb|CDY71423.1|  BnaCnng72830D                                          226   7e-74   Brassica napus [oilseed rape]
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    231   8e-74   Nicotiana sylvestris
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             225   8e-74   
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             228   8e-74   Eutrema salsugineum [saltwater cress]
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...    230   9e-74   Pyrus x bretschneideri [bai li]
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    226   1e-73   Solanum lycopersicum
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 230   1e-73   Glycine soja [wild soybean]
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    228   1e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    230   1e-73   Glycine max [soybeans]
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    228   1e-73   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX88455.1|  BnaC06g38990D                                          227   1e-73   
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    228   2e-73   Elaeis guineensis
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220          228   2e-73   Sorghum bicolor [broomcorn]
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    225   2e-73   Phoenix dactylifera
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-73   Solanum tuberosum [potatoes]
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    230   2e-73   Glycine max [soybeans]
gb|KJB45831.1|  hypothetical protein B456_007G332000                    229   2e-73   Gossypium raimondii
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    227   2e-73   Vitis vinifera
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...    229   2e-73   Malus domestica [apple tree]
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...    229   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             226   2e-73   Capsella rubella
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    228   2e-73   Phoenix dactylifera
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    228   2e-73   Setaria italica
emb|CDP06058.1|  unnamed protein product                                229   2e-73   Coffea canephora [robusta coffee]
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-73   Brassica rapa
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            222   2e-73   Theobroma cacao [chocolate]
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    228   2e-73   Glycine max [soybeans]
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    228   2e-73   
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    229   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    228   3e-73   Glycine max [soybeans]
emb|CDY40003.1|  BnaC05g13120D                                          225   3e-73   Brassica napus [oilseed rape]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    224   3e-73   Tarenaya hassleriana [spider flower]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    223   4e-73   Gossypium raimondii
gb|ACJ11756.1|  rhamnose synthase                                       223   4e-73   Gossypium hirsutum [American cotton]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                      225   4e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32340.1|  BnaC01g36590D                                          222   4e-73   Brassica napus [oilseed rape]
ref|NP_177978.1|  UDP-L-rhamnose synthase                               224   4e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98494.1|  BnaC05g38810D                                          223   4e-73   
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      224   4e-73   
ref|NP_001049724.1|  Os03g0278200                                       229   5e-73   
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    229   5e-73   Pyrus x bretschneideri [bai li]
emb|CBI20105.3|  unnamed protein product                                226   5e-73   Vitis vinifera
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             223   5e-73   Capsella rubella
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    227   5e-73   Tarenaya hassleriana [spider flower]
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    229   5e-73   Fragaria vesca subsp. vesca
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340          226   6e-73   Sorghum bicolor [broomcorn]
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       228   6e-73   Medicago truncatula
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    230   6e-73   Solanum tuberosum [potatoes]
ref|XP_002894444.1|  mucilage-modified 4                                223   6e-73   
emb|CDY35137.1|  BnaA06g11470D                                          224   6e-73   Brassica napus [oilseed rape]
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    223   6e-73   Elaeis guineensis
emb|CDP18722.1|  unnamed protein product                                223   7e-73   Coffea canephora [robusta coffee]
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    223   9e-73   Brassica rapa
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...    222   9e-73   Brassica rapa
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg             223   9e-73   
emb|CDX97601.1|  BnaA05g24780D                                          222   1e-72   
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    225   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN79484.1|  hypothetical protein VITISV_006441                     226   1e-72   Vitis vinifera
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             222   1e-72   
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...    228   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg             222   1e-72   Eutrema salsugineum [saltwater cress]
gb|KHN18614.1|  Putative rhamnose biosynthetic enzyme 1                 228   1e-72   Glycine soja [wild soybean]
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1                 227   1e-72   Glycine soja [wild soybean]
ref|NP_001130297.1|  uncharacterized protein LOC100191391               225   1e-72   Zea mays [maize]
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220          224   1e-72   
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                   222   2e-72   Citrus sinensis [apfelsine]
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    226   2e-72   Eucalyptus grandis [rose gum]
gb|ACG33666.1|  RHM1                                                    224   2e-72   Zea mays [maize]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 226   2e-72   Glycine soja [wild soybean]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    226   2e-72   Glycine max [soybeans]
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...    222   2e-72   
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    224   2e-72   Prunus mume [ume]
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    225   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        221   3e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82539.1|  At1g53500/F22G10_13                                     224   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...    224   3e-72   Citrus sinensis [apfelsine]
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            223   3e-72   Morus notabilis
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    220   3e-72   Gossypium arboreum [tree cotton]
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             225   3e-72   Prunus persica
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg                225   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...    225   3e-72   Setaria italica
emb|CDY45116.1|  BnaC06g06370D                                          220   3e-72   Brassica napus [oilseed rape]
emb|CDY24092.1|  BnaA06g00900D                                          220   3e-72   Brassica napus [oilseed rape]
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...    225   4e-72   Oryza brachyantha
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 224   4e-72   Triticum urartu
dbj|BAJ86835.1|  predicted protein                                      224   4e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                223   6e-72   Erythranthe guttata [common monkey flower]
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             225   7e-72   Phaseolus vulgaris [French bean]
ref|NP_001151455.1|  RHM1                                               224   7e-72   Zea mays [maize]
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    219   8e-72   Brassica rapa
emb|CDY60210.1|  BnaCnng35880D                                          219   8e-72   Brassica napus [oilseed rape]
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    225   8e-72   Vitis vinifera
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...    224   1e-71   
ref|XP_004169238.1|  PREDICTED: probable rhamnose biosynthetic en...    224   1e-71   
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       224   1e-71   Medicago truncatula
emb|CDP22060.1|  unnamed protein product                                221   1e-71   Coffea canephora [robusta coffee]
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...    218   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...    221   2e-71   Setaria italica
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...    221   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1            226   2e-71   Morus notabilis
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             219   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...    218   4e-71   Eucalyptus grandis [rose gum]
ref|XP_010473526.1|  PREDICTED: probable rhamnose biosynthetic en...    221   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...    219   7e-71   Nicotiana tomentosiformis
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    221   9e-71   Cicer arietinum [garbanzo]
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...    216   9e-71   Brassica rapa
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...    218   1e-70   Solanum tuberosum [potatoes]
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          222   1e-70   Amborella trichopoda
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    220   1e-70   Populus euphratica
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg             218   2e-70   Prunus persica
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    218   2e-70   Populus euphratica
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...    220   2e-70   Malus domestica [apple tree]
ref|XP_010430376.1|  PREDICTED: probable rhamnose biosynthetic en...    220   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006477360.1|  PREDICTED: probable rhamnose biosynthetic en...    223   2e-70   Citrus sinensis [apfelsine]
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...    219   2e-70   Nicotiana sylvestris
ref|XP_003588651.1|  Rhamnose synthase                                  219   2e-70   Medicago truncatula
gb|EPS62084.1|  hypothetical protein M569_12709                         215   2e-70   Genlisea aurea
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                  218   2e-70   
ref|XP_010418304.1|  PREDICTED: probable rhamnose biosynthetic en...    219   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002887985.1|  hypothetical protein ARALYDRAFT_893174             219   3e-70   Arabidopsis lyrata subsp. lyrata
gb|AAK62450.1|AF387005_1  Unknown protein                               219   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAC32137.1|  hypothetical protein                                    225   3e-70   Picea mariana [black spruce]
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    218   3e-70   Populus euphratica
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...    218   3e-70   Prunus mume [ume]
ref|NP_564806.1|  UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-re...    219   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22031.1|  unknown                                                 225   4e-70   Picea sitchensis
ref|XP_002454480.1|  hypothetical protein SORBIDRAFT_04g031900          220   4e-70   Sorghum bicolor [broomcorn]
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...    218   5e-70   Pyrus x bretschneideri [bai li]
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...    218   5e-70   
ref|XP_006857961.1|  hypothetical protein AMTR_s00069p00173700          219   5e-70   Amborella trichopoda
ref|XP_006440508.1|  hypothetical protein CICLE_v10021340mg             221   6e-70   Citrus clementina [clementine]
ref|XP_004298763.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    221   7e-70   Fragaria vesca subsp. vesca
emb|CDY45969.1|  BnaA09g12970D                                          218   7e-70   Brassica napus [oilseed rape]
ref|XP_006302532.1|  hypothetical protein CARUB_v10020632mg             219   7e-70   
emb|CDY45471.1|  BnaC09g12890D                                          218   8e-70   Brassica napus [oilseed rape]
gb|KJB20764.1|  hypothetical protein B456_003G163300                    219   8e-70   Gossypium raimondii
gb|ADB24764.1|  UDP-L-rhamnose synthase                                 219   8e-70   Gossypium hirsutum [American cotton]
gb|KFK43526.1|  hypothetical protein AALP_AA1G137100                    219   8e-70   Arabis alpina [alpine rockcress]
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g             216   8e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    218   9e-70   
ref|XP_006647684.1|  PREDICTED: probable rhamnose biosynthetic en...    218   9e-70   Oryza brachyantha
ref|XP_006391796.1|  hypothetical protein EUTSA_v10023613mg             218   9e-70   Eutrema salsugineum [saltwater cress]
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...    219   1e-69   Cicer arietinum [garbanzo]
ref|XP_010533730.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    218   1e-69   Tarenaya hassleriana [spider flower]
gb|KHN09737.1|  Putative rhamnose biosynthetic enzyme 1                 218   1e-69   Glycine soja [wild soybean]
gb|ACG28244.1|  dTDP-4-dehydrorhamnose reductase                        219   1e-69   Zea mays [maize]
ref|NP_001152718.1|  LOC100286359                                       219   1e-69   Zea mays [maize]
gb|AAM65668.1|  unknown                                                 219   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001173114.1|  Os02g0678400                                       219   1e-69   
gb|KFK40550.1|  hypothetical protein AALP_AA2G010500                    217   1e-69   Arabis alpina [alpine rockcress]
ref|XP_009113029.1|  PREDICTED: probable rhamnose biosynthetic en...    217   2e-69   Brassica rapa
gb|EEC73782.1|  hypothetical protein OsI_08465                          218   2e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_011072055.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    219   2e-69   Sesamum indicum [beniseed]
ref|XP_002282339.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    220   2e-69   Vitis vinifera
gb|KHG05296.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    219   2e-69   Gossypium arboreum [tree cotton]
gb|ACJ11713.1|  UDP-L-rhamnose synthase                                 219   2e-69   Gossypium hirsutum [American cotton]
gb|KJB27003.1|  hypothetical protein B456_004G271200                    216   2e-69   Gossypium raimondii
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...    213   3e-69   
ref|XP_001775697.1|  predicted protein                                  218   3e-69   
ref|XP_004953442.1|  PREDICTED: probable rhamnose biosynthetic en...    217   3e-69   Setaria italica
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    216   4e-69   Fragaria vesca subsp. vesca
gb|ADB24774.1|  rhamnose synthase                                       217   4e-69   Gossypium hirsutum [American cotton]
emb|CDY57072.1|  BnaCnng31530D                                          216   4e-69   Brassica napus [oilseed rape]
gb|KJB75445.1|  hypothetical protein B456_012G042300                    217   4e-69   Gossypium raimondii
ref|XP_009148579.1|  PREDICTED: probable rhamnose biosynthetic en...    215   4e-69   Brassica rapa
ref|XP_009766426.1|  PREDICTED: probable rhamnose biosynthetic en...    217   4e-69   Nicotiana sylvestris
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...    218   5e-69   Cucumis melo [Oriental melon]
ref|XP_009620292.1|  PREDICTED: probable rhamnose biosynthetic en...    217   6e-69   Nicotiana tomentosiformis
ref|XP_001766894.1|  predicted protein                                  218   6e-69   
ref|XP_001781616.1|  predicted protein                                  220   6e-69   
ref|XP_007040092.1|  Nucleotide-rhamnose synthase/epimerase-reduc...    216   7e-69   
ref|XP_003549868.1|  PREDICTED: probable rhamnose biosynthetic en...    216   1e-68   Glycine max [soybeans]
ref|XP_007158451.1|  hypothetical protein PHAVU_002G153500g             216   1e-68   Phaseolus vulgaris [French bean]
ref|XP_007011619.1|  Rhamnose biosynthesis 1                            214   2e-68   
ref|XP_010553490.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    213   2e-68   Tarenaya hassleriana [spider flower]
gb|KCW77625.1|  hypothetical protein EUGRSUZ_D01934                     215   2e-68   Eucalyptus grandis [rose gum]
ref|XP_009389578.1|  PREDICTED: probable rhamnose biosynthetic en...    216   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09826.1|  unnamed protein product                                216   3e-68   Coffea canephora [robusta coffee]
ref|XP_010053354.1|  PREDICTED: probable rhamnose biosynthetic en...    214   3e-68   Eucalyptus grandis [rose gum]
ref|XP_010933908.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    213   3e-68   
ref|XP_004143938.1|  PREDICTED: probable rhamnose biosynthetic en...    216   3e-68   Cucumis sativus [cucumbers]
gb|KDP25530.1|  hypothetical protein JCGZ_20686                         214   4e-68   Jatropha curcas
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    214   4e-68   Gossypium arboreum [tree cotton]
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g             216   4e-68   Phaseolus vulgaris [French bean]
ref|XP_010272587.1|  PREDICTED: probable rhamnose biosynthetic en...    216   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010933909.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    212   5e-68   
ref|XP_007155573.1|  hypothetical protein PHAVU_003G213400g             212   5e-68   Phaseolus vulgaris [French bean]
gb|ACU23112.1|  unknown                                                 217   5e-68   Glycine max [soybeans]
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...    213   6e-68   Glycine max [soybeans]
ref|XP_003570100.1|  PREDICTED: probable rhamnose biosynthetic en...    213   6e-68   Brachypodium distachyon [annual false brome]
ref|XP_010255576.1|  PREDICTED: probable rhamnose biosynthetic en...    215   7e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006358852.1|  PREDICTED: probable rhamnose biosynthetic en...    214   7e-68   Solanum tuberosum [potatoes]
ref|XP_002509687.1|  NAD dependent epimerase/dehydratase, putative      214   8e-68   Ricinus communis
emb|CBI24007.3|  unnamed protein product                                212   8e-68   Vitis vinifera
ref|XP_010108054.1|  putative rhamnose biosynthetic enzyme 1            217   8e-68   Morus notabilis
ref|XP_008776517.1|  PREDICTED: probable rhamnose biosynthetic en...    211   8e-68   Phoenix dactylifera
ref|XP_010676576.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    216   9e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400458.1|  PREDICTED: probable rhamnose biosynthetic en...    215   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001775602.1|  predicted protein                                  214   1e-67   
ref|XP_008437195.1|  PREDICTED: probable rhamnose biosynthetic en...    214   1e-67   Cucumis melo [Oriental melon]
ref|XP_001779703.1|  predicted protein                                  214   1e-67   
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...    211   2e-67   
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1                 211   2e-67   Glycine soja [wild soybean]
gb|EYU36941.1|  hypothetical protein MIMGU_mgv1a010842mg                214   2e-67   Erythranthe guttata [common monkey flower]
gb|EMT13548.1|  Putative rhamnose biosynthetic enzyme 1                 211   3e-67   
gb|EPS68271.1|  hypothetical protein M569_06499                         211   3e-67   Genlisea aurea
gb|EMS50143.1|  putative rhamnose biosynthetic enzyme 1                 211   3e-67   Triticum urartu
dbj|BAJ95321.1|  predicted protein                                      211   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004245662.1|  PREDICTED: probable rhamnose biosynthetic en...    211   5e-67   Solanum lycopersicum
ref|XP_009346674.1|  PREDICTED: probable rhamnose biosynthetic en...    215   6e-67   
emb|CDP05404.1|  unnamed protein product                                216   6e-67   Coffea canephora [robusta coffee]
ref|XP_007209407.1|  hypothetical protein PRUPE_ppa009264mg             214   6e-67   Prunus persica
ref|XP_011029152.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    213   6e-67   Populus euphratica
ref|XP_009362849.1|  PREDICTED: probable rhamnose biosynthetic en...    214   6e-67   Pyrus x bretschneideri [bai li]
ref|XP_008238760.1|  PREDICTED: probable rhamnose biosynthetic en...    214   9e-67   
ref|XP_002965630.1|  hypothetical protein SELMODRAFT_439393             210   1e-66   Selaginella moellendorffii
ref|XP_008348787.1|  PREDICTED: probable rhamnose biosynthetic en...    214   1e-66   
ref|XP_008381928.1|  PREDICTED: probable rhamnose biosynthetic en...    214   1e-66   
ref|XP_008776518.1|  PREDICTED: probable rhamnose biosynthetic en...    211   2e-66   
gb|AFK41450.1|  unknown                                                 211   2e-66   Medicago truncatula
ref|XP_002299567.1|  hypothetical protein POPTR_0001s08570g             211   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...    207   3e-66   Phoenix dactylifera
ref|XP_002303557.1|  hypothetical protein POPTR_0003s12000g             212   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008373757.1|  PREDICTED: probable rhamnose biosynthetic en...    214   4e-66   
ref|XP_011033826.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    211   4e-66   Populus euphratica
ref|XP_004515790.1|  PREDICTED: probable rhamnose biosynthetic en...    209   4e-66   Cicer arietinum [garbanzo]
ref|XP_008365831.1|  PREDICTED: probable rhamnose biosynthetic en...    211   6e-66   
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    209   8e-66   Elaeis guineensis
emb|CAN62061.1|  hypothetical protein VITISV_001928                     225   2e-65   Vitis vinifera
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg             207   2e-64   
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...    206   7e-64   
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803             198   1e-63   Selaginella moellendorffii
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972             197   2e-63   
emb|CDX98052.1|  BnaA06g08030D                                          212   4e-63   
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                   207   2e-60   Citrus sinensis [apfelsine]
ref|XP_002955639.1|  hypothetical protein VOLCADRAFT_76853              192   4e-57   Volvox carteri f. nagariensis
ref|XP_001695032.1|  predicted protein                                  191   6e-57   Chlamydomonas reinhardtii
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             182   4e-56   
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 186   4e-56   
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    186   5e-56   
ref|XP_009776239.1|  PREDICTED: probable rhamnose biosynthetic en...    187   1e-55   
gb|KIZ02088.1|  putative rhamnose biosynthetic enzyme 1                 190   2e-55   
ref|XP_010497682.1|  PREDICTED: probable rhamnose biosynthetic en...    185   4e-55   
gb|KDD74838.1|  hypothetical protein H632_c1041p0                       185   7e-55   
ref|XP_005851985.1|  hypothetical protein CHLNCDRAFT_132889             184   2e-54   
ref|XP_008356500.1|  PREDICTED: probable rhamnose biosynthetic en...    178   8e-53   
emb|CDX81794.1|  BnaC08g38070D                                          185   2e-52   
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1                 177   6e-50   
ref|XP_005648979.1|  NAD-dependent epimerase/dehydratase                172   6e-50   
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                    166   6e-49   
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...    165   7e-49   
ref|XP_007514013.1|  predicted protein                                  165   6e-48   
ref|XP_007508076.1|  predicted protein                                  166   7e-48   
ref|XP_003057320.1|  predicted protein                                  166   7e-47   
ref|XP_002500589.1|  predicted protein                                  164   2e-46   
ref|XP_011395817.1|  putative rhamnose biosynthetic enzyme 1            162   3e-44   
gb|KHN44082.1|  Putative rhamnose biosynthetic enzyme 1                 133   1e-43   
emb|CBN77585.1|  conserved unknown protein                              152   4e-43   
ref|WP_038308628.1|  hypothetical protein                               155   5e-43   
gb|EWM28830.1|  epimerase 4-reductase                                   144   6e-43   
ref|XP_005536684.1|  similar to dTDP-4-dehydrorhamnose reductase        154   6e-43   
gb|EMT06313.1|  hypothetical protein F775_00857                         124   6e-43   
emb|CBK21796.2|  unnamed protein product                                154   7e-43   
ref|XP_005535009.1|  similar to dTDP-4-dehydrorhamnose reductase        154   1e-42   
ref|XP_005537979.1|  similar to dTDP-4-dehydrorhamnose reductase        152   5e-42   
ref|XP_002184144.1|  predicted protein                                  150   5e-42   
ref|XP_005537191.1|  similar to dTDP-4-dehydrorhamnose reductase        150   9e-42   
gb|KFK23178.1|  hypothetical protein AALP_AAs48438U000100               140   5e-41   
ref|XP_009039633.1|  hypothetical protein AURANDRAFT_38303              151   3e-40   
ref|XP_004255825.1|  NAD dependent epimerase/dehydratase, putative      143   5e-40   
ref|XP_004337383.1|  NAD dependent epimerase/dehydratase                141   6e-40   
gb|EME44168.1|  hypothetical protein DOTSEDRAFT_80011                   137   9e-40   
gb|EJK71347.1|  hypothetical protein THAOC_07228                        150   1e-39   
ref|XP_009036108.1|  hypothetical protein AURANDRAFT_25417              148   2e-39   
ref|XP_005826217.1|  hypothetical protein GUITHDRAFT_89166              134   6e-39   
ref|XP_007297111.1|  NAD dependent epimerase/dehydratase                135   8e-39   
ref|XP_002290334.1|  hypothetical protein THAPSDRAFT_40788              147   1e-38   
ref|XP_005707655.1|  dTDP-4-dehydrorhamnose reductase                   139   2e-38   
gb|KFK24330.1|  hypothetical protein AALP_AAs39635U000100               132   4e-38   
emb|CCG81053.1|  Putative uncharacterized protein                       138   1e-37   
gb|KIN02359.1|  hypothetical protein OIDMADRAFT_162496                  134   1e-37   
ref|XP_001596309.1|  hypothetical protein SS1G_02529                    135   2e-37   
ref|XP_001738724.1|  NAD dependent epimerase/dehydratase                136   2e-37   
ref|XP_003290007.1|  hypothetical protein DICPUDRAFT_92411              140   2e-37   
ref|XP_655810.1|  hypothetical protein                                  135   3e-37   
gb|KIM94722.1|  hypothetical protein OIDMADRAFT_45649                   134   3e-37   
gb|EPQ67692.1|  hypothetical protein BGT96224_2262                      132   4e-37   
gb|ESZ91842.1|  NAD dependent epimerase/dehydratase                     133   5e-37   
gb|EFX02264.1|  NAD dependent epimerase                                 130   7e-37   
gb|KHJ31736.1|  putative nad dependent epimerase dehydratase            130   8e-37   
ref|XP_001560439.1|  conserved hypothetical protein                     132   1e-36   
ref|XP_003709861.1|  hypothetical protein MGG_09238                     132   1e-36   
emb|CCU81848.1|  oxidoreductase                                         130   1e-36   
emb|CDY72469.1|  BnaCnng77810D                                          137   2e-36   
gb|KEZ41460.1|  hypothetical protein SAPIO_CDS7601                      128   3e-36   
gb|KDN67016.1|  putative NAD dependent epimerase/dehydratase            132   4e-36   
ref|XP_008080873.1|  NAD(P)-binding Rossmann-fold containing protein    131   5e-36   
ref|XP_001740296.1|  NAD dependent epimerase/dehydratase                131   7e-36   
gb|EFQ31859.1|  NAD dependent epimerase/dehydratase                     132   7e-36   
ref|XP_007287733.1|  nrs er                                             130   8e-36   
gb|EQB44511.1|  NAD dependent epimerase/dehydratase                     130   1e-35   
emb|CCF32593.1|  NAD dependent epimerase/dehydratase                    130   1e-35   
ref|XP_644280.1|  hypothetical protein DDB_G0274991                     133   1e-35   
gb|ELR09735.1|  hypothetical protein GMDG_04221                         126   2e-35   
ref|XP_011117055.1|  hypothetical protein AOL_s00004g103                129   2e-35   
gb|EGU73824.1|  hypothetical protein FOXB_15664                         130   2e-35   
emb|CDY25708.1|  BnaC03g69670D                                          135   2e-35   
ref|XP_007600700.1|  NAD dependent epimerase/dehydratase                130   2e-35   
gb|KFY19093.1|  hypothetical protein V493_08151                         125   2e-35   
ref|XP_007833569.1|  hypothetical protein PFICI_06797                   128   2e-35   
gb|KFZ06505.1|  hypothetical protein V501_07336                         126   3e-35   
gb|KFY36191.1|  hypothetical protein V494_05248                         126   3e-35   
gb|KFY09897.1|  hypothetical protein V492_05296                         126   3e-35   
ref|XP_001905352.1|  hypothetical protein                               127   3e-35   
ref|XP_006579608.1|  PREDICTED: probable rhamnose biosynthetic en...    136   4e-35   
gb|KFY97158.1|  hypothetical protein V498_02227                         125   4e-35   
ref|XP_002836423.1|  hypothetical protein                               129   5e-35   
dbj|GAM19914.1|  hypothetical protein SAMD00019534_030890               124   5e-35   
gb|KHN34442.1|  Putative rhamnose biosynthetic enzyme 1                 136   5e-35   
gb|KFZ25372.1|  hypothetical protein V502_00138                         126   8e-35   
gb|KFY72535.1|  hypothetical protein V499_07319                         126   8e-35   
gb|KFZ00250.1|  hypothetical protein V500_01119                         126   8e-35   
ref|XP_007790279.1|  putative nad dependent epimerase dehydratase...    127   8e-35   
gb|KFY47503.1|  hypothetical protein V496_10620                         125   8e-35   
gb|KFX89483.1|  hypothetical protein V490_06984                         125   1e-34   
gb|KFY00697.1|  hypothetical protein O988_03147                         125   1e-34   
ref|XP_011109886.1|  hypothetical protein H072_3926                     127   1e-34   
emb|CEJ87406.1|  Putative NAD(P)-binding Rossmann-fold containing...    125   1e-34   
gb|AAL74389.1|AF359121_1  putative dTDP-glucose 4,6-dehydratase         130   2e-34   
ref|XP_001226132.1|  hypothetical protein CHGG_10865                    124   2e-34   
ref|XP_009853280.1|  hypothetical protein NEUTE1DRAFT_85761             124   3e-34   
ref|XP_009226599.1|  hypothetical protein GGTG_10462                    124   3e-34   
ref|XP_006695147.1|  hypothetical protein CTHT_0047820                  122   4e-34   
ref|XP_004350645.1|  3,5-epimerase/4-reductase                          125   5e-34   
ref|XP_003852439.1|  hypothetical protein MYCGRDRAFT_42346              127   6e-34   
ref|XP_009657319.1|  NRS/ER protein                                     125   6e-34   
gb|KEQ68917.1|  UDP-4-keto-6-deoxy-glucose-3,5-epimerase/ UDP-4-k...    125   7e-34   
gb|EMF10916.1|  NAD(P)-binding protein                                  126   7e-34   
ref|XP_003002732.1|  NRS/ER                                             124   9e-34   
gb|EWG55514.1|  dTDP-glucose 4,6-dehydratase                            125   9e-34   
gb|EPE08529.1|  nad dependent epimerase dehydratase                     124   9e-34   
ref|XP_001728253.1|  NRS/ER                                             122   1e-33   
ref|XP_007677597.1|  hypothetical protein BAUCODRAFT_72815              125   1e-33   
gb|KEQ63324.1|  NAD(P)-binding protein                                  124   1e-33   
gb|KIH91052.1|  NAD dependent epimerase                                 124   1e-33   
gb|ERT00514.1|  hypothetical protein HMPREF1624_03887                   124   1e-33   
ref|XP_007912887.1|  putative nad dependent epimerase dehydratase...    124   2e-33   
ref|XP_008714317.1|  hypothetical protein HMPREF1541_01738              134   2e-33   
ref|XP_003665385.1|  epimerase/hydratase                                120   2e-33   
ref|XP_003044390.1|  hypothetical protein NECHADRAFT_45826              124   2e-33   
gb|ENH87674.1|  NRS/ER protein                                          129   2e-33   
ref|XP_003345125.1|  hypothetical protein SMAC_07414                    120   4e-33   
dbj|GAM86456.1|  hypothetical protein ANO11243_044700                   123   5e-33   
gb|KEQ94116.1|  hypothetical protein AUEXF2481DRAFT_30662               121   1e-32   
gb|EHK39821.1|  hypothetical protein TRIATDRAFT_91570                   124   1e-32   
gb|ENH75980.1|  Putative rhamnose biosynthetic enzyme 1                 120   1e-32   
dbj|GAM88309.1|  hypothetical protein ANO11243_063420                   121   2e-32   
ref|XP_003654153.1|  hypothetical protein THITE_2049831                 117   2e-32   
gb|ESL08135.1|  hypothetical protein TRSC58_04167                       130   3e-32   
ref|XP_006966750.1|  predicted protein                                  123   4e-32   
ref|XP_011320564.1|  hypothetical protein FGSG_13414                    122   4e-32   
gb|EYB25340.1|  hypothetical protein FG05_13414                         122   5e-32   
gb|EGU75305.1|  hypothetical protein FOXB_14184                         119   5e-32   
gb|KEQ81263.1|  NAD(P)-binding protein                                  119   5e-32   
gb|EFA81899.1|  nucleoporin 133                                         119   6e-32   
gb|EWY82942.1|  dTDP-glucose 4,6-dehydratase                            117   9e-32   
gb|EHK25374.1|  hypothetical protein TRIVIDRAFT_31920                   121   1e-31   
gb|EXL51745.1|  dTDP-glucose 4,6-dehydratase                            117   1e-31   
ref|XP_007929610.1|  hypothetical protein MYCFIDRAFT_34055              119   1e-31   
gb|EWZ30417.1|  dTDP-glucose 4,6-dehydratase                            117   1e-31   
gb|EYU36944.1|  hypothetical protein MIMGU_mgv1a018499mg              99.8    2e-31   
ref|XP_007682126.1|  hypothetical protein COCMIDRAFT_31392              117   2e-31   
gb|EMD97212.1|  hypothetical protein COCHEDRAFT_1150873                 117   3e-31   
gb|KDB11056.1|  epimerase hydratase                                     128   3e-31   
gb|EXA35094.1|  dTDP-glucose 4,6-dehydratase                            116   3e-31   
gb|EQL02571.1|  nrs/er                                                  121   4e-31   
ref|XP_009260961.1|  hypothetical protein FPSE_09569                    118   6e-31   
gb|KDO24436.1|  hypothetical protein SPRG_09826                         103   2e-30   
gb|EXK35798.1|  dTDP-glucose 4,6-dehydratase                            111   6e-30   
gb|EKF33998.1|  hypothetical protein MOQ_002402                         124   7e-30   
ref|XP_008610981.1|  hypothetical protein, variant                      102   8e-30   
gb|KDO16909.1|  hypothetical protein SPRG_17627                         102   1e-29   
ref|XP_008610980.1|  hypothetical protein SDRG_06946                    101   2e-29   
gb|EKG05279.1|  hypothetical protein TCSYLVIO_003649                    123   2e-29   
ref|XP_811455.1|  hypothetical protein                                  123   2e-29   
gb|EXK76106.1|  dTDP-glucose 4,6-dehydratase                            122   3e-29   
gb|EXK77723.1|  dTDP-glucose 4,6-dehydratase                            122   4e-29   
ref|XP_009316561.1|  putative NAD dependent epimerase/dehydratase       118   4e-29   
ref|XP_809019.1|  hypothetical protein                                  122   5e-29   
dbj|GAA90292.1|  NRS/ER                                                 110   1e-28   
gb|EQK99925.1|  NRS/ER protein                                          112   1e-28   
gb|ACF82647.1|  unknown                                                 110   3e-27   
ref|YP_003987312.1|  uncharacterized dTDP-4-dehydrorhamnose reduc...    111   2e-25   
dbj|GAD98334.1|  hypothetical protein PVAR5_7026                        111   3e-25   
gb|EKD94030.1|  hypothetical protein ACD_28C00004G0011                98.6    2e-23   
dbj|BAD95054.1|  dTDP-glucose 4,6-dehydratase                           100   3e-23   
gb|KIL84951.1|  hypothetical protein FAVG1_11821                      79.7    1e-20   
ref|XP_003663944.1|  epimerase/hydratase                              87.4    5e-19   
gb|KHJ91488.1|  hypothetical protein OESDEN_08643                     81.3    6e-16   
ref|XP_007806273.1|  hypothetical protein EPUS_08498                  82.8    3e-15   
gb|EYC20279.1|  hypothetical protein Y032_0022g547                    78.6    4e-15   
gb|ETN69594.1|  NAD dependent epimerase/dehydratase family protein    80.5    8e-15   
gb|EYE93584.1|  hypothetical protein EURHEDRAFT_404003                79.7    2e-14   
emb|CDJ86595.1|  NAD dependent epimerase/dehydratase                  77.0    3e-14   
gb|EKD33173.1|  hypothetical protein ACD_76C00078G0010                75.9    1e-13   
gb|KIH64796.1|  hypothetical protein ANCDUO_04892                     76.6    1e-13   
ref|XP_001762762.1|  predicted protein                                71.2    1e-12   
gb|KHN79132.1|  putative rhamnose biosynthetic enzyme 1               68.6    2e-12   
gb|KJB45828.1|  hypothetical protein B456_007G332000                  74.7    6e-12   
gb|EKD49332.1|  hypothetical protein ACD_63C00180G0013                72.8    8e-12   
gb|EKE05351.1|  hypothetical protein ACD_19C00346G0001                70.1    1e-11   
gb|KHO55493.1|  3,5-epimerase/4-reductase                             70.1    7e-11   
gb|EKD23196.1|  hypothetical protein ACD_83C00001G0001                68.9    2e-10   
ref|XP_002324380.1|  hypothetical protein POPTR_0018s03420g           65.9    3e-10   
emb|CEF60842.1|  dTDP-D-glucose 4,6-dehydratase                       69.3    4e-10   
ref|NP_001040728.1|  Protein C01F1.3, isoform b                       64.7    1e-09   
gb|EJD75859.1|  NAD dependent epimerase/dehydratase                   67.4    2e-09   
gb|ERG84349.1|  putative rhamnose biosynthetic enzyme 2               66.2    5e-09   
ref|WP_024808353.1|  dTDP-4-dehydrorhamnose reductase                 55.1    5e-09   
ref|XP_001769231.1|  predicted protein                                61.2    6e-09   
ref|WP_007333931.1|  dTDP-4-dehydrorhamnose reductase                 58.5    7e-09   
ref|XP_003100302.1|  hypothetical protein CRE_22549                   65.5    8e-09   
emb|CAJ43276.1|  hypothetical protein                                 65.5    9e-09   
ref|XP_007795746.1|  putative nrs er protein                          61.6    9e-09   
gb|EJW80188.1|  NAD dependent epimerase/dehydratase                   65.1    1e-08   
gb|EGT38176.1|  hypothetical protein CAEBREN_09988                    65.1    1e-08   
ref|WP_008655232.1|  NAD-dependent epimerase/dehydratase              57.4    1e-08   
gb|EFX06024.1|  hypothetical protein CMQ_4093                         48.1    2e-08   
ref|WP_007324562.1|  dTDP-4-dehydrorhamnose reductase                 57.4    2e-08   
ref|WP_007334357.1|  dTDP-4-dehydrorhamnose reductase                 61.2    2e-08   
ref|XP_002629938.1|  Hypothetical protein CBG03656                    63.9    3e-08   
ref|NP_001040727.1|  Protein C01F1.3, isoform a                       63.9    3e-08   
gb|ERG84376.1|  putative rhamnose biosynthetic enzyme 2               63.5    3e-08   
ref|WP_006980331.1|  dTDP-4-dehydrorhamnose reductase                 58.2    5e-08   
ref|XP_001899896.1|  NAD dependent epimerase/dehydratase family p...  63.2    5e-08   
ref|WP_009102860.1|  NAD-dependent epimerase/dehydratase              62.4    6e-08   
ref|WP_007336828.1|  NAD-dependent epimerase/dehydratase              55.8    3e-07   
gb|KHN77104.1|  putative rhamnose biosynthetic enzyme 1               60.5    4e-07   
gb|KHJ75955.1|  hypothetical protein OESDEN_24426                     57.8    4e-07   
ref|XP_001580918.1|  dTDP-D-glucose 4,6-dehydratase                   59.3    8e-07   
ref|XP_007040094.1|  Uncharacterized protein TCM_016156               54.7    1e-06   
ref|WP_007415292.1|  dTDP-4-dehydrorhamnose reductase                 50.4    1e-06   
ref|WP_007358812.1|  dTDP-4-dehydrorhamnose reductase                 52.0    2e-06   
emb|CEF68564.1|  dTDP-D-glucose 4,6-dehydratase                       54.3    5e-06   
ref|WP_018290562.1|  hypothetical protein                             55.5    1e-05   
gb|ETN85322.1|  putative dTDP-glucose 4,6-dehydratase                 55.5    2e-05   
emb|CDJ84938.1|  Unknown                                              52.8    3e-05   
ref|XP_001579612.1|  dTDP-D-glucose 4,6-dehydratase                   52.4    2e-04   
ref|XP_001317111.1|  hypothetical protein                             52.0    2e-04   
ref|WP_008105539.1|  dTDP-4-dehydrorhamnose reductase                 51.6    3e-04   
gb|EYC37170.1|  hypothetical protein Y032_0818g2516                   51.6    3e-04   
gb|EYC37169.1|  hypothetical protein Y032_0818g2516                   51.6    4e-04   



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   233 bits (595),  Expect(3) = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RYDKVVNIPNSMTVLDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYDKVVNIPNSMTVLDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKYMDP++KW NFTLEEQAKVIVA RSNNEMDA+KLK+EFPELLSIK+SLIKYVFEPNRK
Sbjct  604  KKYMDPSYKWTNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKYVFEPNRK  663


 Score = 76.3 bits (186),  Expect(3) = 3e-76, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL EY NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLNEYENVCTLRVRMPISSDLNNPRNF  547


 Score = 25.0 bits (53),  Expect(3) = 3e-76, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score =   233 bits (594),  Expect(3) = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  551  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  610

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP+FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPEL SIKESLIKYVFEPNRK
Sbjct  611  KKYIDPSFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELCSIKESLIKYVFEPNRK  670


 Score = 76.3 bits (186),  Expect(3) = 5e-76, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGS+YSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  514  TGSYYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  554


 Score = 25.0 bits (53),  Expect(3) = 5e-76, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  505  FKEEDKPNF  513



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   233 bits (595),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RYDKVVNIPNSMTVLDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYDKVVNIPNSMTVLDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKYMDP++KW NFTLEEQAKVIVA RSNNEMDA+KLK+EFPELLSIK+SLIKYVFEPNRK
Sbjct  604  KKYMDPSYKWTNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKYVFEPNRK  663


 Score = 78.2 bits (191),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLNNPRNF  547



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   233 bits (594),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPNRK
Sbjct  612  KKYIDPDFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNRK  671


 Score = 78.6 bits (192),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  515  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  555



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   231 bits (588),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP FKWANFTLEEQAKVIVA RSNNEMDASKLK EFPE+L IKESLIKYVFEPN+K
Sbjct  608  KKYIDPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 77.0 bits (188),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 2e-75, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   230 bits (587),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYSKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP FKWANFTLEEQAKVIVA RSNNEMDASKLK EFPE+L IKESLIKYVFEPN+K
Sbjct  608  KKYIDPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 77.0 bits (188),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 2e-75, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   232 bits (592),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RYDKVVNIPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYDKVVNIPNSMTMLDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKYMDP++KW NFTLEEQAKVIVA RSNNEMDA+KLK+EFPELLSIK+SLIKYVFEPNRK
Sbjct  604  KKYMDPSYKWTNFTLEEQAKVIVAPRSNNEMDAAKLKREFPELLSIKDSLIKYVFEPNRK  663


 Score = 78.2 bits (191),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLNNPRNF  547



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   228 bits (582),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYSKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP F+WANFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN++
Sbjct  607  KKYIDPKFQWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 78.2 bits (191),  Expect(3) = 3e-75, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLR+RMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYNNVCTLRIRMPISSDLNNPRNF  550


 Score = 24.6 bits (52),  Expect(3) = 3e-75, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   231 bits (589),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTVLDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP++KW NFTLEEQAKVIVA RSNNEMDA+KLKKEFPELLSIK+SL+KYVFEPNRK
Sbjct  604  KKYLDPSYKWTNFTLEEQAKVIVAPRSNNEMDATKLKKEFPELLSIKDSLVKYVFEPNRK  663


 Score = 78.6 bits (192),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  547



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   230 bits (587),  Expect(3) = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPNR+
Sbjct  607  KTYIDPKFKWENFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNRR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 77.0 bits (188),  Expect(3) = 4e-75, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  550


 Score = 23.5 bits (49),  Expect(3) = 4e-75, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            +KEEDKPNF
Sbjct  501  YKEEDKPNF  509



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   232 bits (592),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DPAF WANFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN+K
Sbjct  612  KKYIDPAFTWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKK  671

Query  270  T  268
            T
Sbjct  672  T  672


 Score = 77.0 bits (188),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  555



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   230 bits (587),  Expect(3) = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPNR+
Sbjct  607  KTYIDPKFKWENFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNRR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 75.5 bits (184),  Expect(3) = 5e-75, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV EL KEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  GSFYSKTKAMVEELFKEYDNVCTLRVRMPISSDLNNPRNF  550


 Score = 24.6 bits (52),  Expect(3) = 5e-75, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score =   231 bits (588),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPN+K
Sbjct  608  KKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 78.6 bits (192),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   231 bits (589),  Expect(3) = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVAARSNNEMD SKL KEFPE+LSIKESLIKYVFEPN++
Sbjct  608  KNYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLIKYVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 74.7 bits (182),  Expect(3) = 6e-75, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 6e-75, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score =   230 bits (587),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPN+K
Sbjct  608  KKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 78.6 bits (192),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score =   229 bits (584),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW NFTL+EQAKVIVA RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPN+K
Sbjct  608  KKYINPEFKWVNFTLDEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 78.6 bits (192),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   228 bits (581),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            ++Y+DP FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIK+VF PNRK
Sbjct  608  REYIDPQFKWTNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKFVFGPNRK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 78.6 bits (192),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 22.3 bits (46),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  502  FKEEDTPNF  510



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   229 bits (584),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP FKWANFTLEEQAKVIVAARSNNEMDASKLK EFPELLSIKESLIKYVFEPN+K
Sbjct  609  RDYIDPNFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKK  668

Query  270  T  268
            +
Sbjct  669  S  669


 Score = 77.0 bits (188),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552


 Score = 22.7 bits (47),  Expect(3) = 1e-74, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  503  FKEEDTPNF  511



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   229 bits (584),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  551  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  610

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  611  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  670

Query  270  T  268
            T
Sbjct  671  T  671


 Score = 77.4 bits (189),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  514  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  554


 Score = 22.3 bits (46),  Expect(3) = 2e-74, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  505  FKEEDTPNF  513



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   228 bits (582),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVV+IPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  551  PRNFITKISRYSKVVDIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  610

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K YMDP F WANFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IK+SLIKYVFEPN+K
Sbjct  611  KNYMDPNFSWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLHIKDSLIKYVFEPNKK  670

Query  270  T  268
            T
Sbjct  671  T  671


 Score = 79.0 bits (193),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  514  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  554



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   226 bits (577),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  551  PRNFITKISRYSKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  610

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP FKW NFTLEEQAKVIVA RSNNEMDA+KLKKEFP+LL IKESLIKYVFEPNRK
Sbjct  611  KQYIDPQFKWMNFTLEEQAKVIVAPRSNNEMDATKLKKEFPDLLPIKESLIKYVFEPNRK  670


 Score = 78.6 bits (192),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  514  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  554


 Score = 23.5 bits (49),  Expect(3) = 2e-74, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            +KEEDKPNF
Sbjct  505  YKEEDKPNF  513



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   228 bits (581),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYSKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP F+WANFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN++
Sbjct  607  KKYIDPKFQWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 79.0 bits (193),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYNNVCTLRVRMPISSDLNNPRNF  550



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   233 bits (593),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P F WANFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESL+KYVFEPN
Sbjct  607  MYKKYINPEFTWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLVKYVFEPN  666

Query  276  RKT  268
            RKT
Sbjct  667  RKT  669


 Score = 74.3 bits (181),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  552



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   228 bits (580),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAK+NLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKKNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVAARSNNEMD SKL KEFPE+LSIKESLIKYVFEPN++
Sbjct  608  KNYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLIKYVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 75.9 bits (185),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 3e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   228 bits (581),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYSKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY+DP F+WANFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN++
Sbjct  607  KKYIDPKFQWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 79.0 bits (193),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYNNVCTLRVRMPISSDLNNPRNF  550



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score =   230 bits (586),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RYDKVV+IPNSMT+LDELLPIS+EMAKRNLRG+WNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYDKVVDIPNSMTILDELLPISVEMAKRNLRGLWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  610  MYKKYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  669

Query  276  RKT  268
            +K 
Sbjct  670  KKA  672


 Score = 76.6 bits (187),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  555



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   226 bits (575),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRG+WNFTNPGVV HNEILEMY
Sbjct  524  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGVWNFTNPGVVSHNEILEMY  583

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVAARSNNEMD +KL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  584  KSYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGAKLSKEFPEMLSIKDSLIKYVFEPNKR  643

Query  270  T  268
            T
Sbjct  644  T  644


 Score = 77.8 bits (190),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  487  TGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  527


 Score = 24.6 bits (52),  Expect(3) = 3e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  478  FKEEDKPNF  486



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   229 bits (584),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  610  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 77.4 bits (189),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  553



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   231 bits (590),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVDIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+FKW NFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  610  MYKKYIDPSFKWTNFTVEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 74.7 bits (182),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  555



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   234 bits (596),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DPAF +ANFT+EEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN
Sbjct  610  MYKKYIDPAFTYANFTVEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 70.9 bits (172),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 4e-74, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   225 bits (574),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DPAFKW+NFTLEEQ+KVIVA RSNNEMDASKLK EFPE+L IKESLIK+VFEPN++
Sbjct  608  KSYIDPAFKWSNFTLEEQSKVIVAPRSNNEMDASKLKTEFPEMLPIKESLIKFVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 77.4 bits (189),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 4e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score =   230 bits (586),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RYDKVV+IPNSMT+LDELLPIS+EMAKRNLRG+WNFTNPGVV HNEILE
Sbjct  544  SNPRNFITKISRYDKVVDIPNSMTILDELLPISVEMAKRNLRGLWNFTNPGVVSHNEILE  603

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  604  MYKKYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  663

Query  276  RKT  268
            +K 
Sbjct  664  KKA  666


 Score = 76.3 bits (186),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  509  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  549



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   229 bits (585),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI++Y+KVV+IPNSMT+LDELLPIS+EMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISKYNKVVDIPNSMTILDELLPISVEMAKRNLKGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKYVFEPN
Sbjct  610  MYKKYIDPSFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 76.6 bits (187),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  555



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   229 bits (584),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P F WANFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN+K
Sbjct  612  KKYINPEFTWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKK  671

Query  270  T  268
            T
Sbjct  672  T  672


 Score = 77.0 bits (188),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  555



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   227 bits (578),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVAARSNNEMD  KL KEFPE+LSIKESLIKYVFEPN++
Sbjct  608  KNYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGVKLSKEFPEMLSIKESLIKYVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 75.9 bits (185),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 5e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   226 bits (577),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVAARSNNEMD  KL KEFPE+LSIKESLIKYVFEPN++
Sbjct  608  KNYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGVKLSKEFPEMLSIKESLIKYVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 75.9 bits (185),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 5e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   227 bits (578),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPIS+EMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTVLDELLPISVEMAKRNLKGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  609  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  668

Query  270  T  268
            T
Sbjct  669  T  669


 Score = 79.0 bits (193),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score =   227 bits (578),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  551  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  610

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP+FKW NFTL+EQAKVIVA RSNNEMDASKLK+EFPELLSIK+SL+KYVFEPN+K
Sbjct  611  KSYIDPSFKWVNFTLDEQAKVIVAPRSNNEMDASKLKEEFPELLSIKDSLVKYVFEPNKK  670


 Score = 78.6 bits (192),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  514  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  554



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   229 bits (584),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGV+ HNEILE
Sbjct  542  SNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGVISHNEILE  601

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+FKW+NFTLEEQAKVIVA RSNNEMD +KLK EFPELLSIKESL+KYVFEPN
Sbjct  602  MYKKYIDPSFKWSNFTLEEQAKVIVAPRSNNEMDGTKLKDEFPELLSIKESLVKYVFEPN  661

Query  276  RK  271
            RK
Sbjct  662  RK  663


 Score = 76.3 bits (186),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  507  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  547



>emb|CDY71423.1| BnaCnng72830D, partial [Brassica napus]
Length=431

 Score =   226 bits (577),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  311  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  370

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  371  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  430

Query  270  T  268
            T
Sbjct  431  T  431


 Score = 79.0 bits (193),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  274  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  314



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   231 bits (588),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P F WANFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESL+KYVFEPN
Sbjct  607  MYKKYINPDFTWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLVKYVFEPN  666

Query  276  RKT  268
            RKT
Sbjct  667  RKT  669


 Score = 74.3 bits (181),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  552



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   225 bits (574),  Expect(3) = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD SKL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPGFKWSNFTLEEQAKVIVAPRSNNEMDGSKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 8e-74, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 8e-74, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   228 bits (581),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            ++Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  609  REYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  668

Query  270  T  268
            T
Sbjct  669  T  669


 Score = 77.4 bits (189),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   230 bits (587),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVDIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  610  MYKNYIDPSFKWTNFTVEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 74.7 bits (182),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  555



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   226 bits (577),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW+NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIK VFEPNRK
Sbjct  612  KKYINPEFKWSNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKNVFEPNRK  671

Query  270  T  268
            T
Sbjct  672  T  672


 Score = 78.6 bits (192),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  515  TGSFYSKTKAMVEELLKEYPNVCTLRVRMPISSDLNNPRNF  555



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   230 bits (586),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKWANF LEEQAKVI+AARSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPSFKWANFNLEEQAKVIIAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 75.1 bits (183),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  551



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   228 bits (581),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYSKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K YMDP F WANFTLEEQAKVIVA RSNNEMDASKL KEFPELL IK+SLIKYVFEPN+K
Sbjct  610  KNYMDPNFSWANFTLEEQAKVIVAPRSNNEMDASKLNKEFPELLHIKDSLIKYVFEPNKK  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 75.9 bits (185),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK++ NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKDFDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.3 bits (46),  Expect(3) = 1e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   230 bits (586),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKWANF LEEQAKVI+AARSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPSFKWANFNLEEQAKVIIAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 74.7 bits (182),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  551



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   228 bits (580),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYSKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K YMDP F WANFTLEEQAKVIVA RSNNEMDASKL KEFPELL IK+SLIKYVFEPN+K
Sbjct  610  KNYMDPNFSWANFTLEEQAKVIVAPRSNNEMDASKLNKEFPELLHIKDSLIKYVFEPNKK  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 75.9 bits (185),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK++ NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKDFDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.3 bits (46),  Expect(3) = 1e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score =   227 bits (579),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  587  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  646

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  647  RDYINPDFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  706

Query  270  T  268
            T
Sbjct  707  T  707


 Score = 77.4 bits (189),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  550  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  590


 Score = 21.2 bits (43),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  541  FKEEDTPNF  549



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score =   228 bits (582),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPIS+EMAKRN RGIWNFTNPG V HNEILE
Sbjct  548  SNPRNFITKITRYNKVVNIPNSMTILDELLPISVEMAKRNCRGIWNFTNPGAVSHNEILE  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP+F WANFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  608  MYKKYIDPSFTWANFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKESLIKYVFEPN  667

Query  276  RK  271
            RK
Sbjct  668  RK  669


 Score = 75.9 bits (185),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  513  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  553



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score =   228 bits (580),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFP+LLSIK+SLIKYVFEPN
Sbjct  607  MYKKYINPDFKWTNFTLEEQAKVIVARRSNNEMDASKLKAEFPQLLSIKDSLIKYVFEPN  666

Query  276  RK  271
            RK
Sbjct  667  RK  668


 Score = 76.6 bits (187),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  552



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   225 bits (573),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPIS+EMAKRN RGIWNFTNPGV+ HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTVLDELLPISVEMAKRNCRGIWNFTNPGVISHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K YMD +FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SLIKYVFEPNRK
Sbjct  612  KTYMDSSFKWVNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKDSLIKYVFEPNRK  671


 Score = 76.6 bits (187),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  516  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  555


 Score = 23.5 bits (49),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            F+EEDKPNF
Sbjct  506  FREEDKPNF  514



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   224 bits (571),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW+NFTL+EQAKV+VA RSNNEMDASKLKKEFPELLSIKESLIK VFEPNRK
Sbjct  612  KKYINPEFKWSNFTLDEQAKVLVAPRSNNEMDASKLKKEFPELLSIKESLIKNVFEPNRK  671

Query  270  T  268
            T
Sbjct  672  T  672


 Score = 78.6 bits (192),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  515  TGSFYSKTKAMVEELLKEYPNVCTLRVRMPISSDLNNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDSPNF  514



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   230 bits (587),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKWANFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPNFKWANFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 73.6 bits (179),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  551



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   229 bits (583),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAK+NLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKKNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPNR+
Sbjct  607  KTYIDPKFKWENFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNRR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 75.1 bits (183),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKA+V ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  511  GSFYSKTKAVVEELLKEYDNVCTLRVRMPISSDLNNPRNF  550



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   227 bits (579),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKWANFTLEEQAKVIVAARSNNEMDASKLK EFPELL IK+SLIKYVFEPN+K
Sbjct  612  KSYIDPNFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLPIKDSLIKYVFEPNQK  671

Query  270  T  268
            +
Sbjct  672  S  672


 Score = 75.5 bits (184),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  515  AGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   229 bits (585),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVDIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  610  MYKNYIDPSFKWTNFTVEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 74.3 bits (181),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  555



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   229 bits (585),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVDIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  610  MYKNYIDPSFKWTNFTVEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 74.3 bits (181),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  555



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   226 bits (577),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRG+WNFTNPGVV HNE+LEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGVWNFTNPGVVSHNEVLEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  609  RDYINPEFKWANFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKYAFEPNKK  668

Query  270  T  268
            T
Sbjct  669  T  669


 Score = 77.4 bits (189),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   228 bits (581),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY KVVNIPNSMT+LDELLPIS+EMAKRN RGIWNFTNPG V HNEILE
Sbjct  548  SNPRNFITKITRYSKVVNIPNSMTILDELLPISVEMAKRNCRGIWNFTNPGAVSHNEILE  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKYMDP+F W NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  608  MYKKYMDPSFAWVNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKESLIKYVFEPN  667

Query  276  RK  271
            RK
Sbjct  668  RK  669


 Score = 75.9 bits (185),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  513  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  553



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   228 bits (580),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SLIKYVFEPNRK
Sbjct  610  KKYINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKAEFPELLSIKDSLIKYVFEPNRK  669


 Score = 75.1 bits (183),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK+Y NVCTLRVRMPISSDL NP  F
Sbjct  513  TGSFYSKTKAMVEELLKDYDNVCTLRVRMPISSDLGNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   229 bits (583),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  529  SNPRNFITKISRYNKVVDIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  588

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP FKWANFTLEEQAKVIVAARSNNEMDA+KLK EFPELL IKESLIKYVFEPN
Sbjct  589  MYKKYIDPEFKWANFTLEEQAKVIVAARSNNEMDATKLKTEFPELLPIKESLIKYVFEPN  648

Query  276  RKT  268
            + T
Sbjct  649  KNT  651


 Score = 74.7 bits (182),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  494  AGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  534



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   224 bits (571),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD SKL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFTLEEQAKVIVAPRSNNEMDGSKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   224 bits (571),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  545  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  604

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD +KL KEFPELLSI++SLIKYVFEPN++
Sbjct  605  KSYIEPGFKWSNFTLEEQAKVIVAPRSNNEMDGAKLSKEFPELLSIQDSLIKYVFEPNKR  664

Query  270  T  268
            T
Sbjct  665  T  665


 Score = 76.3 bits (186),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  508  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  548


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  499  FKEEDKPNF  507



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   222 bits (565),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+D  F+W NFTLEEQAKVIVA RSNNEMDASKLK EFPELL IKESLIKYVFEPN++
Sbjct  607  KTYIDSNFQWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 78.6 bits (192),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  550


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   224 bits (571),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD SKL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFTLEEQAKVIVAPRSNNEMDGSKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   224 bits (571),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD SKL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFTLEEQAKVIVAPRSNNEMDGSKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   228 bits (581),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  569  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  628

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  629  MYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  688

Query  276  RKT  268
            +KT
Sbjct  689  KKT  691


 Score = 72.4 bits (176),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  535  GSFYSKTKAMVEELLRDYDNVCTLRVRMPISSDLSNPRNF  574


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  525  FKEEDKPNF  533



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   228 bits (581),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  568  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  627

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  628  MYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  687

Query  276  RKT  268
            +KT
Sbjct  688  KKT  690


 Score = 72.4 bits (176),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  534  GSFYSKTKAMVEELLRDYDNVCTLRVRMPISSDLSNPRNF  573


 Score = 24.6 bits (52),  Expect(3) = 2e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  524  FKEEDKPNF  532



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   229 bits (585),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  548  TNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IKESLIKYVFEPN
Sbjct  608  MYKKYIDPDFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLHIKESLIKYVFEPN  667

Query  276  RK  271
            +K
Sbjct  668  KK  669


 Score = 74.3 bits (181),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTK MV ELLKEY NVCTLRVRMPISSDL NP  F
Sbjct  513  TGSFYSKTKGMVEELLKEYENVCTLRVRMPISSDLTNPRNF  553



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   228 bits (581),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 72.4 bits (176),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLRDYDNVCTLRVRMPISSDLSNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 3e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   225 bits (573),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNE+LEMY
Sbjct  550  PRNFITKISRYSKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEVLEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+D  FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN++
Sbjct  610  RDYIDSDFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKR  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 77.4 bits (189),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 3e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   224 bits (571),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RYDKVVNIPNSMT+LDELLPISIEMAKRNL+G+WNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYDKVVNIPNSMTILDELLPISIEMAKRNLKGVWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P F+W+NFTLEEQAKVIVA RSNNEMDASKLK+EFPE+L IKESL++YVFEPN++
Sbjct  607  KKYIEPGFEWSNFTLEEQAKVIVAPRSNNEMDASKLKEEFPEMLPIKESLVRYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 77.4 bits (189),  Expect(3) = 3e-73, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  766  KRKTNQISTGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            K K     TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  502  KEKDKPNFTGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLNNPRNF  550


 Score = 23.1 bits (48),  Expect(3) = 3e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKE+DKPNF
Sbjct  501  FKEKDKPNF  509



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   223 bits (567),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIARY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKIARYNKVVNIPNSMTILDELLPISIEMAKRNLNGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP F+W NFTLEEQAKVIVA RSNNEMDASKLK EFP+LL IKESLIKYVFEPN++
Sbjct  607  KAYIDPKFQWVNFTLEEQAKVIVAPRSNNEMDASKLKNEFPDLLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 78.6 bits (192),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  550


 Score = 23.1 bits (48),  Expect(3) = 4e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            +KEEDKPNF
Sbjct  501  YKEEDKPNF  509



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   223 bits (567),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIARY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKIARYNKVVNIPNSMTILDELLPISIEMAKRNLNGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP F+W NFTLEEQAKVIVA RSNNEMDASKLK EFP+LL IKESLIKYVFEPN++
Sbjct  607  KAYIDPKFQWVNFTLEEQAKVIVAPRSNNEMDASKLKNEFPDLLPIKESLIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 78.6 bits (192),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  550


 Score = 23.1 bits (48),  Expect(3) = 4e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            +KEEDKPNF
Sbjct  501  YKEEDKPNF  509



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score =   225 bits (574),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVV+IPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVDIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVAARSNNEMD SKL KEFPE+LSIKESL+KYVFEPN++
Sbjct  607  KNYIEPGFKWSNFTVEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLLKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 74.7 bits (182),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  511  GSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  550


 Score = 24.6 bits (52),  Expect(3) = 4e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   222 bits (566),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRG+WNFTNPGVV HNEILEMY
Sbjct  523  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGVWNFTNPGVVSHNEILEMY  582

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P+FKW+NFTLEEQAKVIVA RSNNEMD +KL KEFPE+L IKESLIKYVFEPN++
Sbjct  583  KSYIEPSFKWSNFTLEEQAKVIVAPRSNNEMDGAKLSKEFPEMLPIKESLIKYVFEPNKR  642

Query  270  T  268
            T
Sbjct  643  T  643


 Score = 77.8 bits (190),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  486  TGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  526


 Score = 24.6 bits (52),  Expect(3) = 4e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  477  FKEEDKPNF  485



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   224 bits (571),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY + PN+K
Sbjct  609  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAYGPNKK  668

Query  270  T  268
            T
Sbjct  669  T  669


 Score = 78.6 bits (192),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   223 bits (569),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  526  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  585

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD +KL KEFPELLSIK+SLIKYVFEPN++
Sbjct  586  KSYIEPGFKWSNFTLEEQAKVIVAPRSNNEMDGAKLSKEFPELLSIKDSLIKYVFEPNKR  645

Query  270  T  268
            T
Sbjct  646  T  646


 Score = 76.3 bits (186),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  489  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  529


 Score = 24.6 bits (52),  Expect(3) = 4e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  480  FKEEDKPNF  488



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   224 bits (571),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  502  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  561

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K  +DP FKW NFTLEEQAKVIVA RSNNEMDA+KLKKEFPELLSIKESLIKYVFE N+K
Sbjct  562  KSCIDPDFKWVNFTLEEQAKVIVAPRSNNEMDAAKLKKEFPELLSIKESLIKYVFEANKK  621

Query  270  T  268
            T
Sbjct  622  T  622


 Score = 78.6 bits (192),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  465  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  505



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score =   229 bits (583),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SL+KYVFEPN
Sbjct  610  MYKKYLNPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKDSLVKYVFEPN  669

Query  276  RK  271
            RK
Sbjct  670  RK  671


 Score = 73.9 bits (180),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGS+YSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  515  TGSYYSKTKAMVEELLQEYDNVCTLRVRMPISSDLSNPRNF  555



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   229 bits (583),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDEL+PISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELIPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP F WANFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN+K
Sbjct  608  KQYIDPKFTWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKK  667


 Score = 73.9 bits (180),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSYYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  551



>emb|CBI20105.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   226 bits (577),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  69   PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  128

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKWANFTLEEQAKVIVAARSNNEMDASKLK EFPELL IK+SLIKYVFEPN+K
Sbjct  129  KSYIDPNFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLPIKDSLIKYVFEPNQK  188

Query  270  T  268
            +
Sbjct  189  S  189


 Score = 76.3 bits (186),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  32   AGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  72



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   223 bits (568),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD +KL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFTLEEQAKVIVAPRSNNEMDGAKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 5e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   227 bits (578),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPG V HNEILEMY
Sbjct  550  PRNFITKITRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGAVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + YMDP+F+WANFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN+ 
Sbjct  610  RDYMDPSFEWANFTLEEQAKVIVAPRSNNEMDASKLKGEFPELLSIKESLIKYVFEPNKT  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 74.3 bits (181),  Expect(3) = 5e-73, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDL NP  F
Sbjct  513  TGSFYSKTKAMVEELLKEFENVCTLRVRMPISSDLKNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 5e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   229 bits (584),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP+FK++NFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPN+K
Sbjct  608  KQYIDPSFKYSNFTIEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKK  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 73.2 bits (178),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL E+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLNEFDNVCTLRVRMPISSDLNNPRNF  551



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score =   226 bits (575),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAK++ RGIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKQDCRGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFP+LLSIK+SLIKYVFEPN
Sbjct  607  MYKKYINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKAEFPQLLSIKDSLIKYVFEPN  666

Query  276  RK  271
            RK
Sbjct  667  RK  668


 Score = 76.6 bits (187),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  552



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   228 bits (580),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  559  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  618

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKWANFTLEEQAKVIVAARSNNEMDASKLK EFPELLSIKESLIKYVFE N
Sbjct  619  MYRDYIDPNFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLSIKESLIKYVFEAN  678

Query  276  RKT  268
            +K+
Sbjct  679  KKS  681


 Score = 73.6 bits (179),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK+Y NVCTLRVRMPISSDL+NP  F
Sbjct  524  AGSFYSKTKAMVEELLKDYDNVCTLRVRMPISSDLSNPRNF  564


 Score = 22.7 bits (47),  Expect(3) = 6e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  515  FKEEDTPNF  523



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   230 bits (586),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DPAF +ANFT+EEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIK VFEPN
Sbjct  610  MYKKYIDPAFTYANFTVEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKNVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 71.2 bits (173),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 6e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   223 bits (568),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVV+IPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVDIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
              Y++P FKW+NFTLEEQAKVIVAARSNNEMD SKL KEFPE+L IKESLIKYVFEPN++
Sbjct  608  TNYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGSKLSKEFPEMLPIKESLIKYVFEPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 75.9 bits (185),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 6e-73, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   224 bits (570),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNE+LEMY
Sbjct  550  PRNFITKISRYSKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEVLEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+D  FKWANFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIKY FEPN++
Sbjct  610  RDYIDSDFKWANFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKYAFEPNKR  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 77.4 bits (189),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 6e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   223 bits (568),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPIS+EMAKRN RGIWNFTNPGV+ HNEILEMY
Sbjct  552  PRNFITKISRYNKVVNIPNSMTVLDELLPISVEMAKRNCRGIWNFTNPGVISHNEILEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP F W NFTLEEQAKVIVA RSNNEMDASKLK EFPELL IK+SLIKYVFEPNRK
Sbjct  612  KRYIDPGFNWVNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLYIKDSLIKYVFEPNRK  671


 Score = 76.6 bits (187),  Expect(3) = 6e-73, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  516  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  555


 Score = 23.9 bits (50),  Expect(3) = 6e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            F+EEDKPNF
Sbjct  506  FREEDKPNF  514



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   223 bits (569),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIA+YDKVVNIPNSMTVLDELLPISIEMAKRN +GIWNFTNPGV+ HNEILEMY
Sbjct  549  PRNFITKIAKYDKVVNIPNSMTVLDELLPISIEMAKRNCKGIWNFTNPGVISHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP FKW NF LEEQAKVIVA RSNNEMDASKLKKEFPELLSI+ESLIKYVF+PN+K
Sbjct  609  RDYIDPKFKWTNFALEEQAKVIVAPRSNNEMDASKLKKEFPELLSIRESLIKYVFKPNKK  668


 Score = 78.6 bits (192),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   223 bits (569),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVV HNE+LEMY
Sbjct  552  PRNFITKISRYSKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEVLEMY  611

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+D  FKWANFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIKY FEPN++
Sbjct  612  RDYVDSDFKWANFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKYAFEPNKR  671

Query  270  T  268
            T
Sbjct  672  T  672


 Score = 77.4 bits (189),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  515  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 9e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score =   222 bits (565),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+K VN PNSMTVLDEL PISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYNKGVNSPNSMTVLDELFPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y++P FKWANFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPN+K
Sbjct  610  RDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKK  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 78.6 bits (192),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  513  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.3 bits (46),  Expect(3) = 9e-73, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score =   223 bits (568),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIK VFEPN+K
Sbjct  609  KAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKK  668

Query  270  T  268
            +
Sbjct  669  S  669


 Score = 78.6 bits (192),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   222 bits (566),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  526  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  585

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFTLEEQAKVIVA RSNNEMD +KL KEFPELLSIK+SLIKYVFEPN++
Sbjct  586  KSYIEPDFKWSNFTLEEQAKVIVAPRSNNEMDGAKLSKEFPELLSIKDSLIKYVFEPNKR  645

Query  270  T  268
            T
Sbjct  646  T  646


 Score = 76.3 bits (186),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  489  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  529


 Score = 24.6 bits (52),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  480  FKEEDKPNF  488



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   225 bits (574),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPG V HNEILE
Sbjct  547  SNPRNFITKITRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGAVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFTLEEQAKVIVA RSNNEMDA+KLK+EFPELLSIK+SLIKYVFEPN
Sbjct  607  MYKSYIDPSFKWVNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKYVFEPN  666

Query  276  RK  271
            +K
Sbjct  667  KK  668


 Score = 76.3 bits (186),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  552



>emb|CAN79484.1| hypothetical protein VITISV_006441 [Vitis vinifera]
Length=360

 Score =   226 bits (576),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  237  PRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  296

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKWANFTLEEQAKVIVAARSNNEMDASKLK EFPELL IK+SLIKYVFEPN+K
Sbjct  297  KSYIDPNFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLPIKDSLIKYVFEPNQK  356

Query  270  T  268
            +
Sbjct  357  S  357


 Score = 75.5 bits (184),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  200  AGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  240



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   222 bits (565),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NF LEEQAKVIVA RSNNEMD SKL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFNLEEQAKVIVAPRSNNEMDGSKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score =   228 bits (581),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NFTLEEQAKVIVA RSNNEMDA+KLK+EFPELLSIK+SLIK+VFEPN
Sbjct  610  MYRSYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKFVFEPN  669

Query  276  RK  271
            +K
Sbjct  670  KK  671


 Score = 73.6 bits (179),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  516  GSFYSKTKAMVEELLREYENVCTLRVRMPISSDLSNPRNF  555



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score =   222 bits (565),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RSNNEMD SKL KEFPE+L IKE+LIKYVFEPN++
Sbjct  607  KSYIEPGFKWSNFTVEEQAKVIVAPRSNNEMDGSKLSKEFPEMLPIKEALIKYVFEPNKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 76.3 bits (186),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  550


 Score = 24.6 bits (52),  Expect(3) = 1e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>gb|KHN18614.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=353

 Score =   228 bits (580),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  231  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  290

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKWANFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  291  MYRDYIDPNFKWANFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  350

Query  276  RKT  268
            +KT
Sbjct  351  KKT  353


 Score = 73.6 bits (179),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  197  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  236



>gb|KHN29165.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=584

 Score =   227 bits (579),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILE
Sbjct  462  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILE  521

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  522  MYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPN  581

Query  276  RKT  268
            +KT
Sbjct  582  KKT  584


 Score = 72.4 bits (176),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  428  GSFYSKTKAMVEELLRDYDNVCTLRVRMPISSDLSNPRNF  467


 Score = 22.7 bits (47),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  418  FKEEDKPNF  426



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score =   225 bits (573),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNF+TKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGI+NFTNPGVV HNEILE
Sbjct  551  SNPRNFVTKISRYNKVVNIPNSMTILDELLPISVEMAKRNLRGIYNFTNPGVVSHNEILE  610

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP+FKW NFTLEEQAKVIVA RSNNEMDA+KLK EFPELLSIK+SLIKYVFEPN
Sbjct  611  MYKQYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDATKLKNEFPELLSIKDSLIKYVFEPN  670

Query  276  RK  271
            RK
Sbjct  671  RK  672


 Score = 76.3 bits (186),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  516  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  556



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score =   224 bits (570),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNF+TKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGI+NFTNPGVV HNEILEMY
Sbjct  543  PRNFVTKISRYNKVVNIPNSMTMLDELLPISVEMAKRNLRGIYNFTNPGVVSHNEILEMY  602

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP+FKW NFTLEEQAKVIVA RSNNEMDA+KLKKEFPELLSIK+SLIK+VFEPNRK
Sbjct  603  KQYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDATKLKKEFPELLSIKDSLIKFVFEPNRK  662


 Score = 77.4 bits (189),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  506  TGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLNNPRNF  546



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score =   222 bits (566),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIK VFEPN+K
Sbjct  609  KAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKK  668


 Score = 78.6 bits (192),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   226 bits (576),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPG V HNEILE
Sbjct  549  SNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGAVSHNEILE  608

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP FKW NFTLEEQAKVIVA RSNNEMDASKLK+EFPELLSIK+SLIKYVFEPN
Sbjct  609  MYKAYIDPDFKWVNFTLEEQAKVIVAPRSNNEMDASKLKREFPELLSIKDSLIKYVFEPN  668

Query  276  RKT  268
            ++T
Sbjct  669  KRT  671


 Score = 74.7 bits (182),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  554



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score =   224 bits (572),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNF+TKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGI+NFTNPGVV HNEILE
Sbjct  541  SNPRNFVTKISRYNKVVNIPNSMTILDELLPISVEMAKRNLRGIYNFTNPGVVSHNEILE  600

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP+FKW NFTLEEQAKVIVA RSNNEMDA+KLK EFPELLSIK+SLIKYVFEPN
Sbjct  601  MYKQYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDATKLKNEFPELLSIKDSLIKYVFEPN  660

Query  276  RK  271
            RK
Sbjct  661  RK  662


 Score = 76.3 bits (186),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  506  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  546



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   226 bits (575),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NF LEEQAKVI+A RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPSFKWTNFNLEEQAKVIIAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 75.1 bits (183),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  551



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   226 bits (575),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NF LEEQAKVI+A RSNNEMDASKLK EFPELLSIKESLIKYVFEPN
Sbjct  606  MYRDYIDPSFKWTNFNLEEQAKVIIAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 74.7 bits (182),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  551



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score =   222 bits (565),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            KKY++P FKW NFTLEEQ+KVIVA RSNNEMDASKLK EF +L+SIK+SLIKYVFEPNRK
Sbjct  609  KKYINPDFKWTNFTLEEQSKVIVAPRSNNEMDASKLKAEFSQLMSIKDSLIKYVFEPNRK  668


 Score = 79.0 bits (193),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   224 bits (570),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNS+T+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSVTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNR  274
            K Y+DP F WANFT+EEQAKVIVAARSNNEMDASKLKKEFPELL +KESLIKYVFEPN+
Sbjct  608  KHYIDPKFTWANFTIEEQAKVIVAARSNNEMDASKLKKEFPELLPVKESLIKYVFEPNK  666


 Score = 76.6 bits (187),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  551



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   225 bits (574),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRSCRGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFTLEEQAKVIVA RSNNEMDASKLK+EFPELLSIK+S+IKYVFEPN
Sbjct  607  MYKSYIDPSFKWTNFTLEEQAKVIVAPRSNNEMDASKLKREFPELLSIKDSIIKYVFEPN  666

Query  276  RK  271
            +K
Sbjct  667  KK  668


 Score = 75.1 bits (183),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDL+NP  F
Sbjct  512  TGSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLSNPRNF  552



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   221 bits (562),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  544  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  603

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NF LEEQAKVIVA RSNNEMD +KL KEFPE+LSIK+SLIKYVFEPN++
Sbjct  604  KSYIEPDFKWSNFNLEEQAKVIVAPRSNNEMDGAKLSKEFPEMLSIKDSLIKYVFEPNKR  663

Query  270  T  268
            T
Sbjct  664  T  664


 Score = 76.3 bits (186),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  507  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  547


 Score = 24.6 bits (52),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  498  FKEEDKPNF  506



>gb|AAK82539.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
 gb|AAN72275.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
Length=498

 Score =   224 bits (571),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVV+IPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  378  PRNFITKISRYNKVVDIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  437

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVAARSNNEMD SKL KEFPE+LSIKESL+KYVFEPN++
Sbjct  438  KNYIEPGFKWSNFTVEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLLKYVFEPNKR  497

Query  270  T  268
            T
Sbjct  498  T  498


 Score = 74.3 bits (181),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  342  GSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  381


 Score = 22.7 bits (47),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  332  FKEEDKPNF  340



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score =   224 bits (571),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  549  PRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMY  608

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP FKW NFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIK VFEPN+K
Sbjct  609  KAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKK  668

Query  270  T  268
            T
Sbjct  669  T  669


 Score = 75.9 bits (185),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKA V ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  512  TGSFYSKTKATVEELLKEYDNVCTLRVRMPISSDLNNPRNF  552



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   223 bits (569),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+D  F W NFTLEEQAKVIVA RSNNEMD SKLKKEFPELL IKESLIKYVFEPN
Sbjct  606  MYKKYIDLDFSWENFTLEEQAKVIVAPRSNNEMDTSKLKKEFPELLPIKESLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 76.6 bits (187),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  511  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  551



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   220 bits (560),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFI KIARY+KVVNIPNSMT+LDELLPISIEMAKRNL+GIWNFTNPGVV HNEILEMY
Sbjct  547  PRNFIAKIARYNKVVNIPNSMTILDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMY  606

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP F+W NFTLEEQAKVIVA RSNNEMDASKLK EFP+LL IKESLIKYVFEP+++
Sbjct  607  KTYIDPKFQWVNFTLEEQAKVIVAPRSNNEMDASKLKNEFPDLLPIKESLIKYVFEPSKR  666

Query  270  T  268
            T
Sbjct  667  T  667


 Score = 78.2 bits (191),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  510  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLNNPRNF  550


 Score = 23.1 bits (48),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            +KEEDKPNF
Sbjct  501  YKEEDKPNF  509



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   225 bits (573),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNS+T+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSLTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNR  274
            K+Y+DP F WANFT+EEQAKVIVAARSNNEMDASKLKKEFPELL +KESLIKYVFEPN+
Sbjct  608  KQYIDPKFTWANFTIEEQAKVIVAARSNNEMDASKLKKEFPELLPVKESLIKYVFEPNK  666


 Score = 75.1 bits (183),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKE+ NVCTLRVRMPISSDLNNP  F
Sbjct  512  GSFYSKTKAMVEELLKEFDNVCTLRVRMPISSDLNNPRNF  551



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score =   225 bits (574),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI++Y+KVVNIPNSMTVLDELLPISIEMAKRNLRGI+NFTNPGVV HNEILE
Sbjct  544  SNPRNFITKISKYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIYNFTNPGVVSHNEILE  603

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP FK++NFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIK+SLIK VFEPN
Sbjct  604  MYKQYIDPDFKYSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKDSLIKIVFEPN  663

Query  276  RKT  268
            RKT
Sbjct  664  RKT  666


 Score = 74.7 bits (182),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  510  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  549



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score =   225 bits (573),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLP SIEMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  547  SNPRNFITKIARYDKVVNIPNSMTILDELLPFSIEMAKRDCRGIWNFTNPGVVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+KY++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SLIKYVFEPN
Sbjct  607  MYRKYINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKVEFPELLSIKDSLIKYVFEPN  666

Query  276  RK  271
            RK
Sbjct  667  RK  668


 Score = 74.7 bits (182),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  513  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  552



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score =   220 bits (561),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  545  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  604

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RSNNEMD +KL KEFPE+L IKE+LIKYVFEPN++
Sbjct  605  KSYIEPGFKWSNFTVEEQAKVIVAPRSNNEMDGAKLSKEFPEMLPIKEALIKYVFEPNKR  664

Query  270  T  268
            T
Sbjct  665  T  665


 Score = 76.3 bits (186),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  508  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  548


 Score = 24.6 bits (52),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  499  FKEEDKPNF  507



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score =   220 bits (561),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  545  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  604

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RSNNEMD +KL KEFPE+L IKE+LIKYVFEPN++
Sbjct  605  KSYIEPGFKWSNFTVEEQAKVIVAPRSNNEMDGAKLSKEFPEMLPIKEALIKYVFEPNKR  664

Query  270  T  268
            T
Sbjct  665  T  665


 Score = 76.3 bits (186),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  508  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  548


 Score = 24.6 bits (52),  Expect(3) = 3e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  499  FKEEDKPNF  507



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score =   225 bits (574),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  548  SNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILE  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK++++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SLIKYVFEPN
Sbjct  608  MYKEHINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKDSLIKYVFEPN  667

Query  276  RK  271
            RK
Sbjct  668  RK  669


 Score = 74.3 bits (181),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGS+YSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  513  TGSYYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  553



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   224 bits (572),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPIS+EMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKIARYDKVVNIPNSMTILDELLPISVEMAKRDCRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIK VFEPN
Sbjct  610  MYKEYINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKESLIKNVFEPN  669

Query  276  RK  271
            RK
Sbjct  670  RK  671


 Score = 73.6 bits (179),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK+Y NVCTLRVRMPISSDL+NP  F
Sbjct  515  VGSFYSKTKAMVEELLKDYDNVCTLRVRMPISSDLSNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 4e-72, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   224 bits (572),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPIS+EMAKR+ RGIWNFTNPGVV HNEILE
Sbjct  550  SNPRNFITKIARYDKVVNIPNSMTILDELLPISVEMAKRDCRGIWNFTNPGVVSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y++P FKW NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIK VFEPN
Sbjct  610  MYKEYINPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKESLIKNVFEPN  669

Query  276  RK  271
            RK
Sbjct  670  RK  671


 Score = 73.6 bits (179),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK+Y NVCTLRVRMPISSDL+NP  F
Sbjct  515  VGSFYSKTKAMVEELLKDYDNVCTLRVRMPISSDLSNPRNF  555


 Score = 22.7 bits (47),  Expect(3) = 4e-72, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  506  FKEEDTPNF  514



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   223 bits (568),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+D  FKW+NFTLEEQAKVI+A RSNNE+DASKLKKEFPELLSIKESLIK VF PNRK
Sbjct  610  KEYIDADFKWSNFTLEEQAKVIIAPRSNNELDASKLKKEFPELLSIKESLIKNVFGPNRK  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 74.3 bits (181),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPIS+DL+NP  F
Sbjct  514  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISADLDNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 6e-72, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  504  FKEEDTPNF  512



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   225 bits (573),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NF LEEQAKVIVA RSNNEMD +KLKKEFPELLSIK+SLIKYVFEPN
Sbjct  606  MYRDYIDPSFKWVNFNLEEQAKVIVAPRSNNEMDGAKLKKEFPELLSIKDSLIKYVFEPN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 73.9 bits (180),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  551



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   224 bits (570),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMT+LDELLPISIEMAKR+ RGIWNFTNPG V HNEILE
Sbjct  547  SNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNFTNPGAVSHNEILE  606

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY++P FKW NFTLEEQAKVIVA RSNNEMD SKLK EFP+LLSIK+SLIKYVFEPN
Sbjct  607  MYKKYINPDFKWTNFTLEEQAKVIVAPRSNNEMDTSKLKAEFPQLLSIKDSLIKYVFEPN  666

Query  276  RK  271
            RK
Sbjct  667  RK  668


 Score = 74.7 bits (182),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  513  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  552



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score =   219 bits (557),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RSNNEMD +KL KEFPE+L IKE+LIKYVF PN++
Sbjct  608  KSYIEPGFKWSNFTVEEQAKVIVAPRSNNEMDGAKLSKEFPEMLPIKEALIKYVFGPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 76.3 bits (186),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score =   219 bits (557),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  548  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  607

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RSNNEMD +KL KEFPE+L IKE+LIKYVF PN++
Sbjct  608  KSYIEPGFKWSNFTVEEQAKVIVAPRSNNEMDGAKLSKEFPEMLPIKEALIKYVFGPNKR  667

Query  270  T  268
            T
Sbjct  668  T  668


 Score = 76.3 bits (186),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  511  TGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  551


 Score = 24.6 bits (52),  Expect(3) = 8e-72, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score =   225 bits (573),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  535  SNPRNFITKIARYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  594

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F+W NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKES+IKYVFEPN
Sbjct  595  MYRDYIDPGFEWVNFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESIIKYVFEPN  654

Query  276  RKT  268
            +K+
Sbjct  655  KKS  657


 Score = 73.6 bits (179),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  500  VGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLSNPRNF  540



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score =   224 bits (571),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP FKW NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKES++KYVFE N
Sbjct  606  MYKKYIDPKFKWENFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESILKYVFEAN  665

Query  276  RKT  268
            +KT
Sbjct  666  KKT  668


 Score = 72.4 bits (176),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLRDYPNVCTLRVRMPISSDLSNPRNF  551


 Score = 23.1 bits (48),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  502  FKEEDKPNF  510



>ref|XP_004169238.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like, partial 
[Cucumis sativus]
Length=338

 Score =   224 bits (571),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  216  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  275

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYKKY+DP FKW NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKES++KYVFE N
Sbjct  276  MYKKYIDPKFKWENFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESILKYVFEAN  335

Query  276  RKT  268
            +KT
Sbjct  336  KKT  338


 Score = 72.0 bits (175),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL++Y NVCTLRVRMPISSDL+NP  F
Sbjct  182  GSFYSKTKAMVEELLRDYPNVCTLRVRMPISSDLSNPRNF  221


 Score = 22.7 bits (47),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  172  FKEEDKPNF  180



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   224 bits (570),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL GIWNFTNPG V HNEILE
Sbjct  676  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLSGIWNFTNPGAVSHNEILE  735

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NFTLEEQAKVIVAARSNNEMD +KLKKEFPELLSIKESLIKYVF PN
Sbjct  736  MYRDYIDPSFKWQNFTLEEQAKVIVAARSNNEMDGAKLKKEFPELLSIKESLIKYVFVPN  795

Query  276  RK  271
            +K
Sbjct  796  KK  797


 Score = 73.9 bits (180),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  642  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  681



>emb|CDP22060.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   221 bits (564),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  633  TPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEM  454
            +PRNFI KIA+YDKVVNIPNSMTVLDELLPISIEMAKRN +GIWNFTNPGV+ HNEILEM
Sbjct  233  SPRNFIAKIAKYDKVVNIPNSMTVLDELLPISIEMAKRNCKGIWNFTNPGVISHNEILEM  292

Query  453  YKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNR  274
            Y+  +DP FKWANFTLEEQAK+IVA RSNNEMDASKLKKEFPELLSI+ESLIKYVF+PN+
Sbjct  293  YRDNIDPKFKWANFTLEEQAKIIVAPRSNNEMDASKLKKEFPELLSIRESLIKYVFKPNK  352

Query  273  K  271
            K
Sbjct  353  K  353


 Score = 76.6 bits (187),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLN+P  F
Sbjct  197  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNSPRNF  237



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score =   218 bits (556),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  545  PRNFITKITRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  604

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP FKW NF+L+EQAKVIVA RSNNE+DASKL+KEFP LLSIK+S+IKYVFEPN++
Sbjct  605  RNYIDPEFKWVNFSLDEQAKVIVAPRSNNELDASKLQKEFPGLLSIKDSIIKYVFEPNKR  664

Query  270  T  268
            T
Sbjct  665  T  665


 Score = 75.9 bits (185),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLNNP  F
Sbjct  509  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNF  548


 Score = 24.6 bits (52),  Expect(3) = 2e-71, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  499  FKEEDKPNF  507



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score =   221 bits (563),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNF+TKI+RY+KVVNIPNSMT+LDELLPIS+EMAKRNLRGI+NFTNPGVV HNEILE
Sbjct  541  SNPRNFVTKISRYNKVVNIPNSMTILDELLPISVEMAKRNLRGIYNFTNPGVVSHNEILE  600

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+ P+FKW NF LEEQAKVI+A RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPN
Sbjct  601  MYKQYIHPSFKWTNFNLEEQAKVIIAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPN  660

Query  276  RK  271
            +K
Sbjct  661  QK  662


 Score = 76.3 bits (186),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  506  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  546



>ref|XP_009363628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009367987.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=660

 Score =   221 bits (562),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMA+RN RGIWNFTNPGV+ HNEILE
Sbjct  538  SNPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMARRNCRGIWNFTNPGVICHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIK+S+IKYVFEP 
Sbjct  598  MYRDYIDPKFKWQNFDLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKDSIIKYVFEPI  657

Query  276  RK  271
            +K
Sbjct  658  KK  659


 Score = 76.3 bits (186),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  503  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  543



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score =   226 bits (575),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            ++PRNFITKI RYDKVV+IPNSMT+LDELLPIS+EM KRN RGIWNFTNPGVV HNEILE
Sbjct  549  SSPRNFITKIVRYDKVVDIPNSMTILDELLPISVEMVKRNCRGIWNFTNPGVVSHNEILE  608

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +YKKY+DP+FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELL IK+SLIKYVFEPN
Sbjct  609  LYKKYIDPSFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLPIKDSLIKYVFEPN  668

Query  276  RKT  268
            +K+
Sbjct  669  KKS  671


 Score = 71.2 bits (173),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL++P  F
Sbjct  514  TGSFYSKTKAMVEELLKVYDNVCTLRVRMPISSDLSSPRNF  554



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   219 bits (559),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P F W NF LEEQAKVIVA RSNNEMDASKLK EFPELL IKESLIKYVFEPN++
Sbjct  610  KNYINPDFTWVNFDLEEQAKVIVAPRSNNEMDASKLKNEFPELLPIKESLIKYVFEPNKR  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 75.5 bits (184),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  514  GSYYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 3e-71, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            F EEDKPNF
Sbjct  504  FTEEDKPNF  512



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score =   218 bits (554),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMTVLDE+LP+SIEMAKRNLRGIWNFTNPG V HNEILEMY
Sbjct  543  PRNFITKISRYNKVVNIPNSMTVLDEVLPVSIEMAKRNLRGIWNFTNPGAVSHNEILEMY  602

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y+DP F+W NFTLEEQA+VIVA RSNNE+DA+KLK EFP+LLSIK+SLIKYVFEPN+K
Sbjct  603  KSYIDPDFQWVNFTLEEQAQVIVAPRSNNELDATKLKNEFPDLLSIKDSLIKYVFEPNKK  662


 Score = 78.6 bits (192),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  506  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  546



>ref|XP_010473526.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score =   221 bits (564),  Expect(3) = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  178  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  237

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIKYVFEPN
Sbjct  238  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKYVFEPN  297

Query  276  RKT  268
            +KT
Sbjct  298  KKT  300


 Score = 73.6 bits (179),  Expect(3) = 7e-71, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  143  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  183


 Score = 21.6 bits (44),  Expect(3) = 7e-71, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  134  FKEEDTPNF  142



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   219 bits (558),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  531  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  590

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP FKW NF L+EQAKVIVA RSNNE+D +KLK EFPELLSIK+S+IKYVF PN
Sbjct  591  MYREYIDPNFKWQNFNLQEQAKVIVAPRSNNELDTTKLKNEFPELLSIKDSIIKYVFGPN  650

Query  276  RKT  268
            RKT
Sbjct  651  RKT  653


 Score = 76.3 bits (186),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  496  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  536



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   221 bits (563),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPG V HNEILE
Sbjct  546  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLSGIWNFTNPGAVSHNEILE  605

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP +KW NFTLEEQAKVIVAARSNNEMDA+KLK EFPELL IKESLIKYVFEPN
Sbjct  606  MYRDYIDPNYKWENFTLEEQAKVIVAARSNNEMDATKLKNEFPELLPIKESLIKYVFEPN  665

Query  276  RK  271
            +K
Sbjct  666  KK  667


 Score = 73.9 bits (180),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  512  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  551



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score =   216 bits (551),  Expect(3) = 9e-71, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  545  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  604

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P FKW+NFT+EEQAKVIVA RS +EMD +KL KEFPE+L IKE+LIKYVFEPN++
Sbjct  605  KSYIEPGFKWSNFTVEEQAKVIVAPRSKHEMDGAKLSKEFPEMLPIKEALIKYVFEPNKR  664

Query  270  T  268
            T
Sbjct  665  T  665


 Score = 77.0 bits (188),  Expect(3) = 9e-71, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  766  KRKTNQISTGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            K + N   TGSFYSKTKAMV ELL+E+ NVCTLRVRMPISSDLNNP  F
Sbjct  500  KEEDNPNFTGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNF  548


 Score = 22.7 bits (47),  Expect(3) = 9e-71, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  499  FKEEDNPNF  507



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score =   218 bits (555),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEIL 
Sbjct  532  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILG  591

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP FKW NF L+EQAKVIVA RSNNE+D +KLKKEFPELLSIK+S+IKYVF PN
Sbjct  592  MYKDYIDPKFKWQNFDLQEQAKVIVAPRSNNELDMTKLKKEFPELLSIKDSIIKYVFGPN  651

Query  276  RKT  268
            +KT
Sbjct  652  KKT  654


 Score = 76.6 bits (187),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  497  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  537



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   222 bits (565),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIA Y+KVVNIPNSMT+LDELLPISIEMAK+N RGIWN+TNPGVV HNEILE
Sbjct  559  TNPRNFITKIANYNKVVNIPNSMTILDELLPISIEMAKKNCRGIWNYTNPGVVSHNEILE  618

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+FKW NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIKYVFEPN
Sbjct  619  MYRDYIDPSFKWVNFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKYVFEPN  678

Query  276  RK  271
            ++
Sbjct  679  KR  680


 Score = 72.4 bits (176),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYS+TKAMV ELL EY NVCTLRVRMPISSDL NP  F
Sbjct  524  TGSFYSQTKAMVEELLSEYENVCTLRVRMPISSDLTNPRNF  564



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   220 bits (561),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  548  SNPRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILD  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NF LEEQAKVIVA RSNNE+DASKLK EFPELL IKESLIKYVFEPN
Sbjct  608  MYKNYIDPNFSWVNFNLEEQAKVIVAPRSNNELDASKLKNEFPELLPIKESLIKYVFEPN  667

Query  276  RKT  268
            ++T
Sbjct  668  KRT  670


 Score = 73.9 bits (180),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            +GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  513  SGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  553



>ref|XP_007225132.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
 gb|EMJ26331.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
Length=660

 Score =   218 bits (554),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVVNIPNSMTVLDELLPISI+MA+R+ RGIWNFTNPGV+ HNEILE
Sbjct  538  SNPRNFITKIARYDKVVNIPNSMTVLDELLPISIDMARRDCRGIWNFTNPGVISHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNN++DASKLK EFPELLSIK+S+IKYVF+PN
Sbjct  598  MYRDYIDPTFKWQNFGLEEQAKVIVAPRSNNDLDASKLKTEFPELLSIKDSIIKYVFKPN  657

Query  276  RK  271
            +K
Sbjct  658  KK  659


 Score = 76.6 bits (187),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  503  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  543



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   218 bits (554),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEILEMY
Sbjct  550  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMY  609

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K Y++P F W NF LEEQAKVIVA RSNNEMDASKLK EFPELL IK SLIKYVFEPN++
Sbjct  610  KNYINPDFTWVNFDLEEQAKVIVAPRSNNEMDASKLKNEFPELLPIKGSLIKYVFEPNKR  669

Query  270  T  268
            T
Sbjct  670  T  670


 Score = 75.5 bits (184),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  514  GSYYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  553


 Score = 22.7 bits (47),  Expect(3) = 2e-70, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            F EEDKPNF
Sbjct  504  FTEEDKPNF  512



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score =   220 bits (560),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+ VV+IPNSMT+LDELLPIS+EMAKRNLRGIWNFTNPGV+ HNEILE
Sbjct  549  SNPRNFITKISRYNNVVDIPNSMTILDELLPISVEMAKRNLRGIWNFTNPGVLSHNEILE  608

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFT+EEQAKV+VA RSN E+DASKLKKEFPELL +KESLIKYVFEPN
Sbjct  609  MYKNYIDPSFKWTNFTVEEQAKVLVAGRSNCEVDASKLKKEFPELLPVKESLIKYVFEPN  668

Query  276  RKT  268
            +KT
Sbjct  669  KKT  671


 Score = 74.3 bits (181),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  514  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  554



>ref|XP_010430376.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=303

 Score =   220 bits (560),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  177  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIKYVFEPN
Sbjct  237  MYRDYIDPNFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKYVFEPN  296

Query  276  RKT  268
            +KT
Sbjct  297  KKT  299


 Score = 73.6 bits (179),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  142  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_006477360.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
 gb|KDO63611.1| hypothetical protein CISIN_1g022112mg [Citrus sinensis]
Length=302

 Score =   223 bits (569),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE+DASKLK EFPELLSIKESLIKYVFEPN
Sbjct  237  MYRQYIDPNFTWKNFTLEEQAKVIVAPRSNNELDASKLKTEFPELLSIKESLIKYVFEPN  296

Query  276  RKT  268
            +KT
Sbjct  297  KKT  299


 Score = 70.5 bits (171),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK + NVCTLRVRMPISSDL+NP  F
Sbjct  142  VGSFYSKTKAMVEELLKNFENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score =   219 bits (557),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILEMY
Sbjct  533  PRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILEMY  592

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            ++Y+DP FKW NF L+EQAKVIVA RSNNE+D +KLK EFPELLSIK+S+IKYVF PNRK
Sbjct  593  REYIDPNFKWQNFNLQEQAKVIVAPRSNNELDTTKLKNEFPELLSIKDSIIKYVFGPNRK  652

Query  270  T  268
            T
Sbjct  653  T  653


 Score = 75.1 bits (183),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL NP  F
Sbjct  496  TGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLCNPRNF  536



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score =   219 bits (557),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGV+ HN+ILE
Sbjct  533  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVISHNQILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y+ Y+DP++KW NF LEEQAKVIVA RSNNEMDASKLK EFPELLSIK+S+IK+VFEPN
Sbjct  593  LYRDYIDPSYKWVNFNLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKDSVIKFVFEPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 75.1 bits (183),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  499  GSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLSNPRNF  538



>gb|EPS62084.1| hypothetical protein M569_12709, partial [Genlisea aurea]
Length=617

 Score =   215 bits (548),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMA+R+LRGIWNFTNPGVV HNEILEMY
Sbjct  500  PRNFITKISRYNKVVNIPNSMTILDELLPISIEMARRDLRGIWNFTNPGVVSHNEILEMY  559

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            ++Y+DP F+W NFTLEEQAKVIVA RSNNEMDASKLK EFP+L+ IKESLIKYVF+PN
Sbjct  560  REYIDPGFEWRNFTLEEQAKVIVAPRSNNEMDASKLKGEFPQLMPIKESLIKYVFQPN  617


 Score = 78.6 bits (192),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDLNNP  F
Sbjct  463  TGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNF  503



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   218 bits (556),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY KVV+IPNSMT+LDELLPISIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  550  SNPRNFITKIARYSKVVDIPNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILQ  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEP-  280
            MYK Y+DP F W NFTLEEQA+VIVA RSNNE+DASKLK+EFPE+LSIK+SLIKYVFEP 
Sbjct  610  MYKDYIDPNFNWVNFTLEEQARVIVAPRSNNELDASKLKEEFPEILSIKDSLIKYVFEPN  669

Query  279  -NRKT  268
             NRKT
Sbjct  670  SNRKT  674


 Score = 75.5 bits (184),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  515  TGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  555



>ref|XP_010418304.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score =   219 bits (559),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  178  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  237

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  238  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  297

Query  276  RKT  268
            +KT
Sbjct  298  KKT  300


 Score = 73.6 bits (179),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  143  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  183


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  134  FKEEDTPNF  142



>ref|XP_002887985.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64244.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   219 bits (559),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  174  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  234  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  293

Query  276  RKT  268
            +KT
Sbjct  294  KKT  296


 Score = 73.6 bits (179),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  139  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  179


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  130  FKEEDTPNF  138



>gb|AAK62450.1|AF387005_1 Unknown protein [Arabidopsis thaliana]
Length=301

 Score =   219 bits (558),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  175  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  235  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  294

Query  276  RKT  268
            +KT
Sbjct  295  KKT  297


 Score = 73.6 bits (179),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|AAC32137.1| hypothetical protein [Picea mariana]
Length=271

 Score =   225 bits (574),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RYDKVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  146  SNPRNFITKISRYDKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  205

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP++ W NFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESL+KYVFEPN
Sbjct  206  MYRDYIDPSYTWRNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLVKYVFEPN  265

Query  276  RK  271
            +K
Sbjct  266  QK  267


 Score = 68.2 bits (165),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV +LLK + NVCTLRVRMPISSDL+NP  F
Sbjct  112  GSYYSKTKAMVEDLLKNFENVCTLRVRMPISSDLSNPRNF  151



>ref|XP_011031381.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=660

 Score =   218 bits (555),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  538  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNNE+D +KLK EFPE+LSIKES+++YVF+PN
Sbjct  598  MYRDYIDPEFKWMNFDLEEQAKVIVAPRSNNELDGTKLKNEFPEMLSIKESILEYVFKPN  657

Query  276  RKT  268
            +KT
Sbjct  658  KKT  660


 Score = 75.5 bits (184),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  503  TGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLSNPRNF  543



>ref|XP_008220004.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=660

 Score =   218 bits (555),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIA YDKVVNIPNSMTVLDELLPISI+MA+R+ RGIWNFTNPGV+ HNEILE
Sbjct  538  SNPRNFITKIACYDKVVNIPNSMTVLDELLPISIDMARRDCRGIWNFTNPGVISHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNNE+DASKLK+EFPELLS+K+S+IKYVFEPN
Sbjct  598  MYRDYIDPKFKWQNFGLEEQAKVIVAPRSNNELDASKLKREFPELLSVKDSIIKYVFEPN  657

Query  276  RK  271
            +K
Sbjct  658  KK  659


 Score = 75.5 bits (184),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  503  TGSFYSKTKAMVEELLQEYDNVCTLRVRMPISSDLSNPRNF  543



>ref|NP_564806.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
 sp|Q9LQ04.1|RMLCD_ARATH RecName: Full=Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase; AltName: Full=dTDP-L-rhamnose 
synthase [Arabidopsis thaliana]
 gb|AAF75813.1|AC011000_16 Contains weak similarity to 5-epimerase from Saccharopolyspora 
erythraea gb|L37354. ESTs gb|T41773, gb|R29767, gb|T88368, 
gb|F13963 come from this gene [Arabidopsis thaliana]
 gb|AAG48808.1|AF332445_1 unknown protein [Arabidopsis thaliana]
 gb|AAR99502.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana]
 gb|AEE34035.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
Length=301

 Score =   219 bits (558),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  175  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  235  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  294

Query  276  RKT  268
            +KT
Sbjct  295  KKT  297


 Score = 73.6 bits (179),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|ABK22031.1| unknown [Picea sitchensis]
Length=300

 Score =   225 bits (574),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RYDKVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKISRYDKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP++ W NFTLEEQAKVIVAARSNNEMDASKLKKEFPELL IKESL+KYVFEPN
Sbjct  235  MYRDYIDPSYTWRNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLVKYVFEPN  294

Query  276  RK  271
            +K
Sbjct  295  QK  296


 Score = 67.8 bits (164),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV +LLK + NVCTLRVRMPISSDL+NP  F
Sbjct  141  GSYYSKTKAMVEDLLKNFENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>ref|XP_002454480.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
 gb|EES07456.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
Length=307

 Score =   220 bits (561),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  182  SNPRNFITKITRYDKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  241

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NF LEEQAKVIVA RSNNE+D +KLK+EFPELLSIKESLIKYVFEPN
Sbjct  242  MYRDYIDPSFSWKNFNLEEQAKVIVAPRSNNELDQTKLKREFPELLSIKESLIKYVFEPN  301

Query  276  RKT  268
             KT
Sbjct  302  CKT  304


 Score = 72.0 bits (175),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  147  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  187


 Score = 21.6 bits (44),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  138  FKEEDTPNF  146



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score =   218 bits (556),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+ VV+IPNSMT+LDELLPIS+EMAKR+LRGIWNFTNPGV+ HNEILE
Sbjct  550  SNPRNFITKISRYNNVVDIPNSMTILDELLPISVEMAKRHLRGIWNFTNPGVLSHNEILE  609

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP+FKW NFT+EEQAKV+VA RSN E+DASKLKKEFPELL +KESLIKYVFEPN
Sbjct  610  MYKNYIDPSFKWTNFTVEEQAKVLVAGRSNCEVDASKLKKEFPELLPVKESLIKYVFEPN  669

Query  276  RKT  268
            +KT
Sbjct  670  KKT  672


 Score = 74.3 bits (181),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  515  AGSFYSKTKAMVEELLKEYENVCTLRVRMPISSDLSNPRNF  555



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score =   218 bits (554),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIAR DKVVNIPNSMTVLDELLPISIEMA+RN RGIWNFTNPGV+ HNEILE
Sbjct  538  SNPRNFITKIARXDKVVNIPNSMTVLDELLPISIEMARRNCRGIWNFTNPGVISHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP  KW NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIK+S+IKYVFEP 
Sbjct  598  MYRDYIDPKLKWQNFDLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKDSIIKYVFEPI  657

Query  276  RKT  268
            +KT
Sbjct  658  KKT  660


 Score = 75.1 bits (183),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  766  KRKTNQISTGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            K + N   TGSFYSKTKAMV ELLKEY  VCTLRVRMPISSDL+NP  F
Sbjct  495  KEEDNPNFTGSFYSKTKAMVEELLKEYDKVCTLRVRMPISSDLSNPRNF  543


 Score = 21.2 bits (43),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  494  FKEEDNPNF  502



>ref|XP_006857961.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
 gb|ERN19428.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
Length=300

 Score =   219 bits (557),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAK+NL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKKNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+DASKLKK+FP+LLSIKESLIKYVF PN
Sbjct  235  MYRDYIDPYFSWKNFTLEEQAKVIVAQRSNNELDASKLKKQFPQLLSIKESLIKYVFGPN  294

Query  276  RKT  268
             KT
Sbjct  295  HKT  297


 Score = 73.9 bits (180),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  180



>ref|XP_006440508.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
 gb|ESR53748.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
Length=302

 Score =   221 bits (564),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y++Y+DP F W NFTLEEQAKVIVA RSNNE+DASKLK EFPELLSIKESLIKYVFEPN
Sbjct  237  IYRQYIDPNFTWKNFTLEEQAKVIVAPRSNNELDASKLKTEFPELLSIKESLIKYVFEPN  296

Query  276  RKT  268
            +KT
Sbjct  297  KKT  299


 Score = 70.5 bits (171),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK + NVCTLRVRMPISSDL+NP  F
Sbjct  142  VGSFYSKTKAMVEELLKNFENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_004298763.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Fragaria vesca subsp. vesca]
Length=300

 Score =   221 bits (563),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKIARYDKVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  178  PRNFITKIARYDKVVNIPNSMTILDELLPISVEMAKRNLTGIWNFTNPGVVSHNEILEMY  237

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP++ W NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIK VF+PN+K
Sbjct  238  KQYIDPSYTWKNFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFKPNQK  297

Query  270  T  268
            T
Sbjct  298  T  298


 Score = 70.9 bits (172),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL NP  F
Sbjct  142  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLQNPRNF  181


 Score = 21.6 bits (44),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  132  FKEEDTPNF  140



>emb|CDY45969.1| BnaA09g12970D [Brassica napus]
Length=297

 Score =   218 bits (556),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  171  SNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  230

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKESLIK+VFEPN
Sbjct  231  MYREYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKSEFPEMLSIKESLIKFVFEPN  290

Query  276  RKT  268
            +KT
Sbjct  291  KKT  293


 Score = 73.6 bits (179),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  136  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  176



>ref|XP_006302532.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
 gb|EOA35430.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
Length=330

 Score =   219 bits (558),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  204  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  263

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  264  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  323

Query  276  RKT  268
            +KT
Sbjct  324  KKT  326


 Score = 72.4 bits (176),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYS+TKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  169  TGSFYSQTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  209


 Score = 21.6 bits (44),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  160  FKEEDTPNF  168



>emb|CDY45471.1| BnaC09g12890D [Brassica napus]
Length=297

 Score =   218 bits (556),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  171  SNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  230

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKESLIK+VFEPN
Sbjct  231  MYREYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPEMLSIKESLIKFVFEPN  290

Query  276  RKT  268
            +KT
Sbjct  291  KKT  293


 Score = 73.6 bits (179),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  136  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  176



>gb|KJB20764.1| hypothetical protein B456_003G163300 [Gossypium raimondii]
Length=300

 Score =   219 bits (558),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYDKVVNIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NF LEEQAKVIVA RSNNE+DA+KLK EFPELLSIKESLIKYVFEPN+K
Sbjct  237  RDYIDPNFTWKNFNLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKESLIKYVFEPNKK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 72.8 bits (177),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|ADB24764.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score =   219 bits (557),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYDKVVNIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NF LEEQAKVIVA RSNNE+DA+KLK EFPELLSIKESL+KYVFEPN+K
Sbjct  237  RDYIDPNFTWKNFNLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKESLVKYVFEPNKK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 72.8 bits (177),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|KFK43526.1| hypothetical protein AALP_AA1G137100 [Arabis alpina]
Length=296

 Score =   219 bits (557),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  174  SNPRNFITKIARYEKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPELLSIKESL+K+VFEPN
Sbjct  234  MYREYVDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKESLVKFVFEPN  293

Query  276  RK  271
            +K
Sbjct  294  KK  295


 Score = 72.8 bits (177),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPIS+DL+NP  F
Sbjct  139  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISADLSNPRNF  179


 Score = 21.6 bits (44),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  130  FKEEDTPNF  138



>ref|XP_006382137.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
 gb|ERP59934.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
Length=660

 Score =   216 bits (551),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  538  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNNE+D +KLK EFPE LSIKES+++YVF+PN
Sbjct  598  MYRDYIDPEFKWMNFDLEEQAKVIVAPRSNNELDGTKLKNEFPETLSIKESILEYVFKPN  657

Query  276  RKT  268
            +KT
Sbjct  658  KKT  660


 Score = 75.1 bits (183),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  503  TGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLSNPRNF  543



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   218 bits (555),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+L+ELLPISIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  548  SNPRNFITKISRYNKVVNIPNSMTILEELLPISIEMAKRNLRGIWNFTNPGVVSHNEILD  607

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NF LEEQAKVIVA RSNNE+DASKLK EFPELL IKESLIKYVFEPN
Sbjct  608  MYKNYIDPNFTWVNFNLEEQAKVIVAPRSNNELDASKLKNEFPELLPIKESLIKYVFEPN  667

Query  276  RKT  268
            ++T
Sbjct  668  KRT  670


 Score = 73.6 bits (179),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  514  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  553



>ref|XP_006647684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=307

 Score =   218 bits (556),  Expect(3) = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  182  SNPRNFITKITRYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  241

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+D +KLK EFPELLSIK+SLIKYVF+PN
Sbjct  242  MYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNELDCTKLKTEFPELLSIKDSLIKYVFKPN  301

Query  276  RKT  268
            +KT
Sbjct  302  QKT  304


 Score = 72.0 bits (175),  Expect(3) = 9e-70, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  147  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  187


 Score = 22.7 bits (47),  Expect(3) = 9e-70, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED+PNF
Sbjct  138  FKEEDRPNF  146



>ref|XP_006391796.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
 gb|ESQ29082.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
Length=297

 Score =   218 bits (555),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  171  SNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  230

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKESLIK+VFEPN
Sbjct  231  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPEMLSIKESLIKFVFEPN  290

Query  276  RKT  268
            +KT
Sbjct  291  KKT  293


 Score = 73.6 bits (179),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  136  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  176



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score =   219 bits (559),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGV+ HNEILE
Sbjct  533  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVISHNEILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +YK+Y+DP FKW NF LEEQAKVIVA RSNNEMDASKLK EFP LLSIK+S+IK+VFEPN
Sbjct  593  LYKEYIDPQFKWENFDLEEQAKVIVAQRSNNEMDASKLKNEFPNLLSIKDSVIKFVFEPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 72.0 bits (175),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV +LLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  499  GSYYSKTKAMVEDLLKEYDNVCTLRVRMPISSDLSNPRNF  538



>ref|XP_010533730.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=300

 Score =   218 bits (554),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  174  SNPRNFITKISRYNKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP+F W NFT+EEQAKVIVA RSNNE+DA+KLK EFPE++SIKESL+K+VFEPN
Sbjct  234  MYKEYIDPSFTWKNFTVEEQAKVIVAPRSNNELDATKLKAEFPEMMSIKESLVKFVFEPN  293

Query  276  RKT  268
            +KT
Sbjct  294  KKT  296


 Score = 73.9 bits (180),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  139  TGSFYSKTKAMVEELLKNYDNVCTLRVRMPISSDLSNPRNF  179



>gb|KHN09737.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=512

 Score =   218 bits (555),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILE
Sbjct  386  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILE  445

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KLKKEFPELLSIK+SLIKYVFEPN
Sbjct  446  MYRDYVDPNFTWNNFTLEEQAKVIVAPRSNNELDAAKLKKEFPELLSIKDSLIKYVFEPN  505

Query  276  RK  271
            +K
Sbjct  506  QK  507


 Score = 73.2 bits (178),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  351  TGSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  391



>gb|ACG28244.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=309

 Score =   219 bits (558),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  184  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  243

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF LEEQAKVIVA RSNNE+D +KLK+EFPELLSIKESLIKYVFEPN
Sbjct  244  MYRDYIDPGFSWKNFNLEEQAKVIVAPRSNNELDQTKLKREFPELLSIKESLIKYVFEPN  303

Query  276  RK  271
             K
Sbjct  304  CK  305


 Score = 72.0 bits (175),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  149  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  189


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  140  FKEEDTPNF  148



>ref|NP_001152718.1| LOC100286359 [Zea mays]
 gb|ACG49124.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
 gb|ACR38060.1| unknown [Zea mays]
 gb|AFW72796.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=307

 Score =   219 bits (557),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  182  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  241

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF LEEQAKVIVA RSNNE+D +KLK+EFPELLSIKESL+KYVFEPN
Sbjct  242  MYRDYIDPGFSWKNFNLEEQAKVIVAPRSNNELDQTKLKREFPELLSIKESLVKYVFEPN  301

Query  276  RK  271
             K
Sbjct  302  CK  303


 Score = 72.0 bits (175),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  147  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  187


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  138  FKEEDTPNF  146



>gb|AAM65668.1| unknown [Arabidopsis thaliana]
Length=300

 Score =   219 bits (559),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  174  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPEL+SIKESLIK+VFEPN
Sbjct  234  MYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELMSIKESLIKFVFEPN  293

Query  276  RKT  268
            +KT
Sbjct  294  KKT  296


 Score = 71.2 bits (173),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCT RVRMPISSDL NP  F
Sbjct  139  TGSFYSKTKAMVEELLKNYENVCTXRVRMPISSDLTNPRNF  179


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  130  FKEEDTPNF  138



>ref|NP_001173114.1| Os02g0678400 [Oryza sativa Japonica Group]
 dbj|BAD29243.1| dTDP-D-glucose 4,6-dehydratase-like [Oryza sativa Japonica Group]
 dbj|BAD29369.1| dTDP-D-glucose 4,6-dehydratase-like [Oryza sativa Japonica Group]
 dbj|BAG92682.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57572.1| hypothetical protein OsJ_07924 [Oryza sativa Japonica Group]
 dbj|BAH91843.1| Os02g0678400 [Oryza sativa Japonica Group]
Length=311

 Score =   219 bits (557),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  186  SNPRNFITKIARYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  245

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+D +KLK EFPELLSIK+SL++YVF+PN
Sbjct  246  MYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNELDCTKLKAEFPELLSIKDSLVRYVFKPN  305

Query  276  RKT  268
            +KT
Sbjct  306  QKT  308


 Score = 72.0 bits (175),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  151  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  191


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  142  FKEEDTPNF  150



>gb|KFK40550.1| hypothetical protein AALP_AA2G010500 [Arabis alpina]
Length=295

 Score =   217 bits (553),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKIARY+KVV+IPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  171  TNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  230

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVI+A RSNNE+DA+KLK EFPE+LSIKESLIK+VFEPN
Sbjct  231  MYRDYIDPSFTWKNFTLEEQAKVIIAPRSNNELDATKLKTEFPEMLSIKESLIKFVFEPN  290

Query  276  RK  271
            +K
Sbjct  291  KK  292


 Score = 73.6 bits (179),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  136  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNF  176


 Score = 21.6 bits (44),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  127  FKEEDTPNF  135



>ref|XP_009113029.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=297

 Score =   217 bits (552),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVV+IPNSMT+LDELLPISI+MAKRNL GI+NFTNPGVV HNEILE
Sbjct  171  SNPRNFITKIARYEKVVDIPNSMTILDELLPISIDMAKRNLTGIYNFTNPGVVSHNEILE  230

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKESLIK+VFEPN
Sbjct  231  MYREYIDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPEMLSIKESLIKFVFEPN  290

Query  276  RKT  268
            +KT
Sbjct  291  KKT  293


 Score = 73.6 bits (179),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  136  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  176



>gb|EEC73782.1| hypothetical protein OsI_08465 [Oryza sativa Indica Group]
Length=311

 Score =   218 bits (556),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  186  SNPRNFITKIARYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  245

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+D +KLK EFPELLSIK+SL++YVF+PN
Sbjct  246  MYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNELDCTKLKAEFPELLSIKDSLVRYVFKPN  305

Query  276  RKT  268
            +KT
Sbjct  306  QKT  308


 Score = 72.0 bits (175),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  151  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  191


 Score = 21.6 bits (44),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  142  FKEEDTPNF  150



>ref|XP_011072055.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Sesamum indicum]
Length=300

 Score =   219 bits (559),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKIARYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVI+A RSNNE+DA+KLK+EFPELLSIK+SLI++VF+PN
Sbjct  235  MYREYIDPNFTWTNFTLEEQAKVIIAPRSNNELDATKLKQEFPELLSIKDSLIEHVFKPN  294

Query  276  RKT  268
            RKT
Sbjct  295  RKT  297


 Score = 70.9 bits (172),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  141  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>ref|XP_002282339.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Vitis vinifera]
Length=302

 Score =   220 bits (560),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+DASKLKKEFPEL+SIKESLIKYVF+PN
Sbjct  237  MYRDYIDPNFAWKNFTLEEQAKVIVAPRSNNELDASKLKKEFPELMSIKESLIKYVFKPN  296

Query  276  RKT  268
            +K 
Sbjct  297  QKA  299


 Score = 70.5 bits (171),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  143  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>gb|KHG05296.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=300

 Score =   219 bits (558),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYDKVVNIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NF LEEQAKVIVA RSNNE+DA+KLK EFPELLSIKESLIKYVFEPN+K
Sbjct  237  RDYIDPNFTWKNFNLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKESLIKYVFEPNKK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 71.2 bits (173),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  141  GSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|ACJ11713.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score =   219 bits (558),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYDKVVNIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NF LEEQAKVIVA RSNNE+DA+KLK EFPELLSIKESLIKYVFEPN+K
Sbjct  237  RDYIDPNFTWKNFNLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKESLIKYVFEPNKK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 71.2 bits (173),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  141  GSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score =   216 bits (549),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  633  TPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEM  454
            +P NFITKI+ Y+KV+NIPN MT+LDELLP+SIEMAK+NLRGIWNFTNPGVV HNEILEM
Sbjct  450  SPHNFITKISCYNKVINIPNGMTILDELLPMSIEMAKKNLRGIWNFTNPGVVSHNEILEM  509

Query  453  YKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNR  274
            YK Y+DP F+W NFTLEEQAKVIVA RSNN+MDASKLKKEFPELL IKESL+KYVFEPN+
Sbjct  510  YKTYIDPNFEWMNFTLEEQAKVIVAPRSNNKMDASKLKKEFPELLPIKESLVKYVFEPNK  569

Query  273  KT  268
            +T
Sbjct  570  RT  571


 Score = 74.3 bits (181),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDLN+P  F
Sbjct  415  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNSPHNF  454



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score =   213 bits (543),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  532  SNPRNFITKITRYDKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  591

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF L+EQAKVIVA RSNNE+D +KLK EFPELLSIK+S+IKYVF PN
Sbjct  592  MYRDYIDPKFKWQNFDLQEQAKVIVAPRSNNELDMTKLKNEFPELLSIKDSIIKYVFGPN  651


 Score = 76.6 bits (187),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLKEY NVCTLRVRMPISSDL+NP  F
Sbjct  497  TGSFYSKTKAMVEELLKEYNNVCTLRVRMPISSDLSNPRNF  537



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   218 bits (555),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFI+KI RY K+VNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEI+EMY
Sbjct  546  PRNFISKIVRYQKIVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEIMEMY  605

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP+  W NFTLEEQAKVIVAARSNNEMDASKL KEFPE+L IKESL K+VFEPNRK
Sbjct  606  KEYIDPSLTWVNFTLEEQAKVIVAARSNNEMDASKLSKEFPEMLGIKESLKKFVFEPNRK  665

Query  270  T  268
            T
Sbjct  666  T  666


 Score = 68.2 bits (165),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GS+YSKTKAMV +LL E+ NVCTLRVRMPISSDL NP  F
Sbjct  509  AGSYYSKTKAMVEDLLSEFDNVCTLRVRMPISSDLENPRNF  549


 Score = 25.0 bits (53),  Expect(3) = 3e-69, Method: Composition-based stats.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  500  FKEEDKPNF  508



>ref|XP_004953442.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=307

 Score =   217 bits (553),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  182  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  241

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+  +DP+F W NF LEEQAKVIVA RSNNE+D +KLK EFPELLSIKESLIKYVFEPN
Sbjct  242  MYRDCIDPSFSWKNFNLEEQAKVIVAPRSNNELDQTKLKNEFPELLSIKESLIKYVFEPN  301

Query  276  RKT  268
            RKT
Sbjct  302  RKT  304


 Score = 72.4 bits (176),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  147  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  187


 Score = 21.6 bits (44),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  138  FKEEDTPNF  146



>ref|XP_004292875.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
 ref|XP_011459027.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
Length=660

 Score =   216 bits (549),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGV+ HNEILE
Sbjct  538  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVISHNEILE  597

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP FKW NF LEEQAKVIVA RSNNE+DASKLK+EFPELLSIK+S+ K+VFE N
Sbjct  598  MYRDYIDPKFKWQNFDLEEQAKVIVAPRSNNELDASKLKREFPELLSIKDSVKKFVFEAN  657

Query  276  RKT  268
            +KT
Sbjct  658  KKT  660


 Score = 73.9 bits (180),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  504  GSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNF  543



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score =   217 bits (553),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+I NSMT+LDELLP+SIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  552  SNPRNFITKITRYNKVVDISNSMTILDELLPVSIEMAKRNLRGIWNFTNPGVVSHNEILQ  611

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NF+L+EQAKVIVA RSNNE+DASKLK EFPELLSIK+SLIKYVFEPN
Sbjct  612  MYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNELDASKLKNEFPELLSIKDSLIKYVFEPN  671

Query  276  RKT  268
            RKT
Sbjct  672  RKT  674


 Score = 72.4 bits (176),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKA+V ELL+E+ NVCTLRVRMPISSDL+NP  F
Sbjct  517  TGSFYSKTKAVVEELLREFDNVCTLRVRMPISSDLSNPRNF  557



>emb|CDY57072.1| BnaCnng31530D [Brassica napus]
Length=323

 Score =   216 bits (550),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  197  SNPRNFITKITRYEKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  256

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++++DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKESL+K+VFEPN
Sbjct  257  MYREFVDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPEMLSIKESLVKFVFEPN  316

Query  276  RKT  268
            +KT
Sbjct  317  KKT  319


 Score = 73.6 bits (179),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  162  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  202



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score =   217 bits (553),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+I NSMT+LDELLP+SIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  552  SNPRNFITKITRYNKVVDISNSMTILDELLPVSIEMAKRNLRGIWNFTNPGVVSHNEILQ  611

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NF+L+EQAKVIVA RSNNE+DASKLK EFPELLSIK+SLIKYVFEPN
Sbjct  612  MYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNELDASKLKNEFPELLSIKDSLIKYVFEPN  671

Query  276  RKT  268
            RKT
Sbjct  672  RKT  674


 Score = 72.4 bits (176),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKA+V ELL+E+ NVCTLRVRMPISSDL+NP  F
Sbjct  517  TGSFYSKTKAVVEELLREFDNVCTLRVRMPISSDLSNPRNF  557



>ref|XP_009148579.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=321

 Score =   215 bits (548),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  195  SNPRNFITKITRYEKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  254

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++++DP+F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPE+LSIKE+L+K+VFEPN
Sbjct  255  MYREFVDPSFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPEMLSIKEALVKFVFEPN  314

Query  276  RKT  268
            +KT
Sbjct  315  KKT  317


 Score = 73.6 bits (179),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  160  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  200


 Score = 21.6 bits (44),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  151  FKEEDTPNF  159



>ref|XP_009766426.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=298

 Score =   217 bits (552),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI RY+KVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  173  TNPRNFITKITRYEKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  232

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DASKL KEFPE+ SIKESLI+YVF+PN
Sbjct  233  MYRDYVDPSFSWKNFTLEEQAKVIVAPRSNNELDASKLSKEFPEMKSIKESLIEYVFKPN  292

Query  276  RKT  268
            RKT
Sbjct  293  RKT  295


 Score = 72.4 bits (176),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPIS+DL NP  F
Sbjct  138  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISADLTNPRNF  178


 Score = 21.2 bits (43),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  129  FKEEDTPNF  137



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score =   218 bits (554),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  627  RNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMYK  448
            RNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKR+ RGIWNFTNPGVV HNEILEMYK
Sbjct  548  RNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRDCRGIWNFTNPGVVSHNEILEMYK  607

Query  447  KYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRKT  268
            KY+DP F W NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKES++KYVFE N+KT
Sbjct  608  KYIDPKFTWENFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESILKYVFEANKKT  667


 Score = 70.1 bits (170),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+N   F
Sbjct  511  GSFYSKTKAMVEELLREYPNVCTLRVRMPISSDLSNQRNF  550


 Score = 23.1 bits (48),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  501  FKEEDKPNF  509



>ref|XP_009620292.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=298

 Score =   217 bits (553),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI RY+KVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  173  TNPRNFITKITRYEKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  232

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFTLEEQAKVIVA RSNNE+DASKL KEFPE+ SIKESLI+YVF+PN
Sbjct  233  MYRDYIDPSFSWKNFTLEEQAKVIVAPRSNNELDASKLSKEFPEMKSIKESLIEYVFKPN  292

Query  276  RKT  268
            RKT
Sbjct  293  RKT  295


 Score = 71.6 bits (174),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGS+YSKTKAMV ELLK Y NVCTLRVRMPIS+DL NP  F
Sbjct  138  TGSYYSKTKAMVEELLKNYDNVCTLRVRMPISADLTNPRNF  178


 Score = 21.2 bits (43),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  129  FKEEDTPNF  137



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   218 bits (556),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFI+KI RY K+VNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEI+EMY
Sbjct  553  PRNFISKIVRYQKIVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEIMEMY  612

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP   W NFT+EEQAKVIVAARSNNEMDASKLKKEFPE+L IKESL KYVFEPNR+
Sbjct  613  KEYIDPELSWVNFTIEEQAKVIVAARSNNEMDASKLKKEFPEMLGIKESLKKYVFEPNRQ  672

Query  270  T  268
            T
Sbjct  673  T  673


 Score = 68.6 bits (166),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GS+YSKTKAMV +LL E+ NVCTLRVRMPISSDL NP  F
Sbjct  516  AGSYYSKTKAMVEDLLNEFDNVCTLRVRMPISSDLQNPRNF  556


 Score = 23.1 bits (48),  Expect(3) = 6e-69, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  507  FKEEDTPNF  515



>ref|XP_001781616.1| predicted protein [Physcomitrella patens]
 ref|XP_001781618.1| predicted protein [Physcomitrella patens]
 gb|EDQ53572.1| predicted protein [Physcomitrella patens]
 gb|EDQ53574.1| predicted protein [Physcomitrella patens]
Length=300

 Score =   220 bits (561),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP+F + NFTLEEQAKVIVAARSNNE+DASKL KEFPE+L IKESLIKYVFEPN
Sbjct  235  MYKEYVDPSFTYKNFTLEEQAKVIVAARSNNELDASKLSKEFPEMLPIKESLIKYVFEPN  294

Query  276  RKT  268
            +KT
Sbjct  295  KKT  297


 Score = 68.6 bits (166),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV ELL+E+ NVCTLRVRMPI+ DL+NP  F
Sbjct  141  GSYYSKTKAMVEELLREFDNVCTLRVRMPITGDLSNPRNF  180



>ref|XP_007040092.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
 gb|EOY24593.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
Length=300

 Score =   216 bits (549),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RYDKVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYDKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
              Y+D  F W NFTLEEQAKVI+A RSNNE+D +KLK EFPELLSIKESL+KYVFEPN+K
Sbjct  237  HDYIDSNFSWKNFTLEEQAKVIIAPRSNNELDTNKLKNEFPELLSIKESLVKYVFEPNKK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 73.2 bits (178),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  140  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  180


 Score = 21.2 bits (43),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>ref|XP_003549868.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=302

 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVV+IPNSMT+LDELLPISIEM KRNL GIWNFTNPGVV HNEILEMY
Sbjct  178  PRNFITKITRYEKVVDIPNSMTILDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILEMY  237

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KLKKEFPELLSIK+SLIKYVFEPN+K
Sbjct  238  RDYVDPNFTWNNFTLEEQAKVIVAPRSNNELDAAKLKKEFPELLSIKDSLIKYVFEPNQK  297


 Score = 71.2 bits (173),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL NP  F
Sbjct  141  TGSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLLNPRNF  181



>ref|XP_007158451.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
 gb|ESW30445.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
Length=303

 Score =   216 bits (551),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI RYDKVV+IPNSM++LDELLPIS+EMAKRNL GIWNFTNPGVV HNEILE
Sbjct  174  TNPRNFITKITRYDKVVDIPNSMSILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F+W NFTLEEQAKVIVA RSNNE+DASKLKKEFP LLSIK+SL+KYVF PN
Sbjct  234  MYRDYVDPSFRWKNFTLEEQAKVIVAPRSNNELDASKLKKEFPHLLSIKDSLLKYVFHPN  293

Query  276  R  274
             
Sbjct  294  H  294


 Score = 71.2 bits (173),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV +LL+ Y NVCTLRVRMPISSDL NP  F
Sbjct  139  TGSFYSKTKAMVEDLLENYDNVCTLRVRMPISSDLTNPRNF  179



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score =   214 bits (545),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMTVLDELL ISIEMAKRN RGIWNFTNPGV+ HNEILE
Sbjct  537  SNPRNFITKITRYNKVVNIPNSMTVLDELLLISIEMAKRNCRGIWNFTNPGVISHNEILE  596

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY  Y++P FKW NF+LEEQAKVIVA RSNNE+DA+KLKKEFPELLSIK+S+IKYVF+PN
Sbjct  597  MYNAYINPQFKWKNFSLEEQAKVIVAPRSNNELDAAKLKKEFPELLSIKDSIIKYVFKPN  656

Query  276  RKT  268
            +KT
Sbjct  657  KKT  659


 Score = 73.6 bits (179),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  503  GSFYSKTKAMVEELLQEYDNVCTLRVRMPISSDLSNPRNF  542



>ref|XP_010553490.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Tarenaya hassleriana]
Length=300

 Score =   213 bits (543),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  174  SNPRNFITKITRYSKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE+DA KL  EFPE++SIKESL+K+VFEPN
Sbjct  234  MYREYIDPNFTWKNFTLEEQAKVIVAPRSNNELDAKKLSAEFPEMMSIKESLVKFVFEPN  293

Query  276  RKT  268
            +KT
Sbjct  294  KKT  296


 Score = 73.6 bits (179),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  139  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  179


 Score = 21.6 bits (44),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  130  FKEEDTPNF  138



>gb|KCW77625.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=294

 Score =   215 bits (547),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  169  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  228

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE+D +KL +EFPELL IKESLIKYVF+PN
Sbjct  229  MYQEYIDPNFTWKNFTLEEQAKVIVAPRSNNELDMTKLSREFPELLPIKESLIKYVFKPN  288

Query  276  RKT  268
            +KT
Sbjct  289  QKT  291


 Score = 72.0 bits (175),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  134  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  174


 Score = 21.6 bits (44),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  125  FKEEDTPNF  133



>ref|XP_009389578.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   216 bits (551),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPG V HNEILE
Sbjct  181  TNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGAVSHNEILE  240

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQA+VIVA RSNNE+D +KLKKEFPELL IKESLIK+VFEPN
Sbjct  241  MYRDYIDPNFTWKNFTLEEQAQVIVAPRSNNELDTAKLKKEFPELLPIKESLIKHVFEPN  300

Query  276  RKT  268
            +KT
Sbjct  301  QKT  303


 Score = 69.7 bits (169),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELL  Y NVCTLRVRMPISSDL NP  F
Sbjct  147  GSFYSKTKAMVEELLTNYENVCTLRVRMPISSDLTNPRNF  186


 Score = 21.6 bits (44),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  137  FKEEDTPNF  145



>emb|CDP09826.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   216 bits (551),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKR+L GIWNFTNPGVV HNEILEMY
Sbjct  178  PRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRDLTGIWNFTNPGVVSHNEILEMY  237

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP F W NFTL+EQAKVIVA RSNNE+DA+KLK EFPELLSIKESL+KYVF+PN+K
Sbjct  238  KEYIDPKFTWKNFTLDEQAKVIVAPRSNNELDATKLKNEFPELLSIKESLLKYVFKPNQK  297

Query  270  T  268
            T
Sbjct  298  T  298


 Score = 70.1 bits (170),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL NP  F
Sbjct  142  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLANPRNF  181


 Score = 21.6 bits (44),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  132  FKEEDTPNF  140



>ref|XP_010053354.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Eucalyptus 
grandis]
 gb|KCW77624.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=302

 Score =   214 bits (546),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE+D +KL +EFPELL IKESLIKYVF+PN
Sbjct  237  MYQEYIDPNFTWKNFTLEEQAKVIVAPRSNNELDMTKLSREFPELLPIKESLIKYVFKPN  296

Query  276  RKT  268
            +KT
Sbjct  297  QKT  299


 Score = 72.0 bits (175),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  142  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_010933908.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score =   213 bits (541),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNS+T+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSITILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y+ Y+DP F W NF+LEEQAKVIVA RSNNE+D +KLK EFPELLS+KESLIKYVF+PN
Sbjct  237  IYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNELDTTKLKNEFPELLSVKESLIKYVFKPN  296

Query  276  RKT  268
            +KT
Sbjct  297  QKT  299


 Score = 73.6 bits (179),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  142  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_004143938.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004159969.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN50154.1| hypothetical protein Csa_5G156140 [Cucumis sativus]
Length=300

 Score =   216 bits (549),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+++DP F W NFTL+EQAKVIVA RSNNE+DA+KLK EFPELLSIK+SLIKYVF+PN
Sbjct  235  MYKQFIDPNFTWKNFTLDEQAKVIVAPRSNNELDATKLKNEFPELLSIKDSLIKYVFKPN  294

Query  276  RKT  268
            +KT
Sbjct  295  QKT  297


 Score = 70.9 bits (172),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  141  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  180



>gb|KDP25530.1| hypothetical protein JCGZ_20686 [Jatropha curcas]
Length=303

 Score =   214 bits (545),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  178  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  237

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NFTLEEQAKVIVA RSNNE+DASKL KEFP +L IKESLIKYVF+PN
Sbjct  238  MYKNYVDPNFTWKNFTLEEQAKVIVAPRSNNELDASKLSKEFPGMLPIKESLIKYVFKPN  297

Query  276  RKT  268
            +KT
Sbjct  298  QKT  300


 Score = 72.0 bits (175),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  144  GSFYSKTKAMVEELLKNYQNVCTLRVRMPISSDLSNPRNF  183


 Score = 21.2 bits (43),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  134  FKEEDTPNF  142



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score =   214 bits (545),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+I NSMT+LDELLP+SIEMAKRNLRGIWNFTNPGVV HNEIL+
Sbjct  552  SNPRNFITKITRYNKVVDISNSMTILDELLPVSIEMAKRNLRGIWNFTNPGVVSHNEILQ  611

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK Y+DP F W NF+L+EQAKVIVA RSNNE+DASKLK EFPELLSIK+SLIKYVFEPN
Sbjct  612  MYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNELDASKLKNEFPELLSIKDSLIKYVFEPN  671

Query  276  RKT  268
             KT
Sbjct  672  WKT  674


 Score = 72.4 bits (176),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKA+V ELL+E+ NVCTLRVRMPISSDL+NP  F
Sbjct  517  TGSFYSKTKAVVEELLREFDNVCTLRVRMPISSDLSNPRNF  557



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score =   216 bits (551),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGV+ HN+ILE
Sbjct  533  TNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVISHNQILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y+ Y+DP FKW NF LEEQAKVIVA RSNNEMDASKLK EFP LLSIK+S+IK+VF PN
Sbjct  593  LYRDYIDPQFKWENFDLEEQAKVIVAPRSNNEMDASKLKNEFPGLLSIKDSIIKFVFVPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 68.2 bits (165),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GS+YSKTKAMV +LL+ Y NVCTLRVRMPISSDL NP  F
Sbjct  499  GSYYSKTKAMVEDLLRNYENVCTLRVRMPISSDLTNPRNF  538


 Score = 22.7 bits (47),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  489  FKEEDKPNF  497



>ref|XP_010272587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score =   216 bits (549),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVI+A RSNNE+D +KLKKEFPELL IKESLIKYVF+PN
Sbjct  237  MYRDYIDPNFVWKNFTLEEQAKVIIAPRSNNELDTTKLKKEFPELLPIKESLIKYVFKPN  296

Query  276  RKT  268
            +KT
Sbjct  297  QKT  299


 Score = 70.5 bits (171),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  143  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  182



>ref|XP_010933909.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score =   212 bits (540),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF+LEEQAKVIVA RSNNE+D ++LK EFPELLSIKESLIKYVF+PN
Sbjct  237  MYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNELDTTQLKNEFPELLSIKESLIKYVFKPN  296

Query  276  RKT  268
            + T
Sbjct  297  QNT  299


 Score = 73.6 bits (179),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  142  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  182



>ref|XP_007155573.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
 gb|ESW27567.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
Length=300

 Score =   212 bits (539),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFI KI RY+KVV+IPNSM++LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  176  SNPRNFIAKITRYEKVVDIPNSMSILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  235

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KLK EFPELLSIK+SL+KYVF+PN
Sbjct  236  MYREYVDPNFTWKNFTLEEQAKVIVAPRSNNELDATKLKTEFPELLSIKDSLVKYVFQPN  295

Query  276  RK  271
            +K
Sbjct  296  QK  297


 Score = 73.9 bits (180),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  141  TGSFYSKTKAMVEELLKNYDNVCTLRVRMPISSDLSNPRNF  181



>gb|ACU23112.1| unknown [Glycine max]
Length=297

 Score =   217 bits (552),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEIL+
Sbjct  174  SNPRNFITKITRYDKVVDIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEILQ  233

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+Y+DP F W NFTLEEQAKVIVA RSNNE+DASKLK EFP+LLSIK+SL+KYVF+PN
Sbjct  234  MYKEYVDPNFTWKNFTLEEQAKVIVAPRSNNELDASKLKNEFPQLLSIKDSLVKYVFQPN  293

Query  276  RK  271
            +K
Sbjct  294  QK  295


 Score = 68.9 bits (167),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV +L+  Y NVCTLRVRMPISSDL+NP  F
Sbjct  139  TGSFYSKTKAMVEDLVGNYENVCTLRVRMPISSDLSNPRNF  179



>ref|XP_003545554.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
 gb|KHN14574.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   213 bits (541),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGV+ HN+ILE
Sbjct  533  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVISHNQILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +++ Y+DP FKW NF L EQAKVIVA RSNNEMDASKLK EFP+LLSI++S+IK+VFEPN
Sbjct  593  LFRDYIDPKFKWENFDLGEQAKVIVAPRSNNEMDASKLKNEFPDLLSIRDSIIKFVFEPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 71.2 bits (173),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  499  GSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  538


 Score = 22.7 bits (47),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  489  FKEEDKPNF  497



>ref|XP_003570100.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=300

 Score =   213 bits (542),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NF LEEQAKVIVA RSNNE+D  KLK EFPELLSIKESLIK VF+PN
Sbjct  235  MYRDYIDPSFSWKNFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPN  294

Query  276  RKT  268
            +KT
Sbjct  295  QKT  297


 Score = 72.0 bits (175),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  140  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>ref|XP_010255576.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score =   215 bits (547),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLIGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KLKKEFPELL IKESLI+YVF+PN
Sbjct  237  MYRDYIDPNFVWKNFTLEEQAKVIVAPRSNNELDATKLKKEFPELLPIKESLIRYVFKPN  296

Query  276  RK  271
            +K
Sbjct  297  QK  298


 Score = 70.5 bits (171),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  143  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  182



>ref|XP_006358852.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=301

 Score =   214 bits (545),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI+RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  176  TNPRNFITKISRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  235

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NFT+EEQAKVIVA RSNNE+DASKL KEFPE+ SIKESLI+ VF+PN
Sbjct  236  MYRDYIDPSFSWKNFTIEEQAKVIVAPRSNNELDASKLSKEFPEMKSIKESLIENVFKPN  295

Query  276  RKT  268
            RKT
Sbjct  296  RKT  298


 Score = 71.2 bits (173),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPIS+DL NP  F
Sbjct  142  GSFYSKTKAMVEELLKNYDNVCTLRVRMPISADLTNPRNF  181


 Score = 21.2 bits (43),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  132  FKEEDTPNF  140



>ref|XP_002509687.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF51074.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=302

 Score =   214 bits (544),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  179  PRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  238

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KL KEFPE+L IKESLIKYVF+PN+K
Sbjct  239  RDYVDPNFTWKNFTLEEQAKVIVAPRSNNELDATKLSKEFPEMLPIKESLIKYVFKPNQK  298

Query  270  T  268
            T
Sbjct  299  T  299


 Score = 71.2 bits (173),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  143  GSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLANPRNF  182


 Score = 21.2 bits (43),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>emb|CBI24007.3| unnamed protein product [Vitis vinifera]
Length=731

 Score =   212 bits (539),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVVNIPNSMTVLDELLPISIEMAKRN RGIWNFTNPGVV HNEILE
Sbjct  216  SNPRNFITKIARYNKVVNIPNSMTVLDELLPISIEMAKRNCRGIWNFTNPGVVSHNEILE  275

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKY  292
            MY+ Y+DP F+W NF LEEQAKVIVA RSNNE+DASKLKKEFPELLSIKES+IKY
Sbjct  276  MYRDYIDPGFEWVNFNLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESIIKY  330


 Score = 73.2 bits (178),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELL+EY NVCTLRVRMPISSDL+NP  F
Sbjct  181  VGSFYSKTKAMVEELLREYENVCTLRVRMPISSDLSNPRNF  221



>ref|XP_010108054.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC17786.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=300

 Score =   217 bits (552),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  177  PRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  236

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
              Y+DP F W NFTLEEQAKVIVA RSNNE+DA+KL KEFPELL IKESLIKYVFEPN+K
Sbjct  237  HDYIDPNFTWKNFTLEEQAKVIVAPRSNNELDATKLNKEFPELLPIKESLIKYVFEPNQK  296

Query  270  T  268
            T
Sbjct  297  T  297


 Score = 68.2 bits (165),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV  LLK Y NVCTLRVRMPISSDL NP  F
Sbjct  141  GSFYSKTKAMVENLLKNYENVCTLRVRMPISSDLLNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDSPNF  139



>ref|XP_008776517.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=302

 Score =   211 bits (537),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  177  SNPRNFITKISRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  236

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF+LEEQAKVIVA RSNNE+  ++LK EFPELL IKESLIKYVF+PN
Sbjct  237  MYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNELGTARLKNEFPELLPIKESLIKYVFKPN  296

Query  276  RKT  268
            +KT
Sbjct  297  QKT  299


 Score = 73.6 bits (179),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            TGSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  142  TGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  182


 Score = 21.6 bits (44),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  133  FKEEDTPNF  141



>ref|XP_010676576.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Beta vulgaris subsp. vulgaris]
Length=303

 Score =   216 bits (549),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKIARY+KVVNIPNSMT+LDELLPISIEMAKRNL GI+NFTNPGVV HNEILE
Sbjct  176  SNPRNFITKIARYEKVVNIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILE  235

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP F W NFTLEEQAKVIVA RSNNE++ +KLK+EFPELL IKESLIKYVFEPN
Sbjct  236  MYREYIDPKFTWKNFTLEEQAKVIVAPRSNNELETTKLKQEFPELLPIKESLIKYVFEPN  295

Query  276  RKT  268
            +KT
Sbjct  296  KKT  298


 Score = 68.9 bits (167),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LL  Y NVCTLRVRMPISSDL+NP  F
Sbjct  142  GSFYSKTKAMVEDLLNNYDNVCTLRVRMPISSDLSNPRNF  181


 Score = 21.6 bits (44),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  132  FKEEDTPNF  140



>ref|XP_009400458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   215 bits (547),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFITKI RY+KVVNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILEMY
Sbjct  183  PRNFITKITRYEKVVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILEMY  242

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            + Y+DP F W NF LEEQAKVIVA RSNNE+D +KLK EFPELL IKESLIKYVFEPN+K
Sbjct  243  RDYIDPKFTWKNFNLEEQAKVIVAPRSNNELDTTKLKGEFPELLPIKESLIKYVFEPNKK  302

Query  270  T  268
            T
Sbjct  303  T  303


 Score = 69.7 bits (169),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV ELLK Y NVCTLRVRMPIS+DL NP  F
Sbjct  147  GSFYSKTKAMVEELLKNYENVCTLRVRMPISTDLLNPRNF  186


 Score = 21.6 bits (44),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  137  FKEEDTPNF  145



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score =   214 bits (546),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFI+KI RY K+VNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVV HNEI+EMY
Sbjct  555  PRNFISKIVRYQKIVNIPNSMTILDELLPISLEMAKRNLTGIWNFTNPGVVSHNEIMEMY  614

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP   W NFTLEEQAKVIVAARSNNEMDASKL +EFPE+L IKESL K+VFEPNRK
Sbjct  615  KEYIDPELSWVNFTLEEQAKVIVAARSNNEMDASKLSREFPEVLGIKESLKKFVFEPNRK  674

Query  270  T  268
            T
Sbjct  675  T  675


 Score = 68.6 bits (166),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GS+YSKTKAMV +LL E+ NVCTLRVRMPISSDL NP  F
Sbjct  518  AGSYYSKTKAMVEDLLNEFDNVCTLRVRMPISSDLQNPRNF  558


 Score = 22.7 bits (47),  Expect(3) = 1e-67, Method: Composition-based stats.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  509  FKEEDTPNF  517



>ref|XP_008437195.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Cucumis melo]
Length=300

 Score =   214 bits (545),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MYK+++DP F W NF LEEQAKVIVA RSNNE+DA+KLK EFPELLSIK+SL+KYVF+PN
Sbjct  235  MYKQFIDPNFTWKNFNLEEQAKVIVAPRSNNELDATKLKNEFPELLSIKDSLLKYVFKPN  294

Query  276  RKT  268
            +KT
Sbjct  295  QKT  297


 Score = 70.5 bits (171),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  141  GSFYSKTKAMVEDLLKNYENVCTLRVRMPISSDLSNPRNF  180



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   214 bits (544),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  630  PRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILEMY  451
            PRNFI+KI RY K+VNIPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEI++MY
Sbjct  543  PRNFISKIVRYQKIVNIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEIMDMY  602

Query  450  KKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNRK  271
            K+Y+DP+  W NFTLEEQAKVIVAARSNNEMDASKL  EFPE+L IKESL K+VFEPNRK
Sbjct  603  KEYIDPSLTWENFTLEEQAKVIVAARSNNEMDASKLLSEFPEMLGIKESLKKFVFEPNRK  662

Query  270  T  268
            T
Sbjct  663  T  663


 Score = 70.9 bits (172),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GS+YSKTKAMV +LLKE+ NVCTLRVRMPISSDL NP  F
Sbjct  506  AGSYYSKTKAMVEDLLKEFDNVCTLRVRMPISSDLQNPRNF  546



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score =   211 bits (537),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGV+ HN+ILE
Sbjct  533  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVISHNQILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y+  +DP FKW NF L+EQAKVIVA RSNNEMDASKLK EFP LLSIK+S+IK+VFEPN
Sbjct  593  LYRDNIDPQFKWENFDLKEQAKVIVAPRSNNEMDASKLKNEFPNLLSIKDSIIKFVFEPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 71.2 bits (173),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  499  GSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  538


 Score = 22.7 bits (47),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  489  FKEEDKPNF  497



>gb|KHN30780.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   211 bits (537),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI+RY+KVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGV+ HN+ILE
Sbjct  533  SNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVISHNQILE  592

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            +Y+  +DP FKW NF L+EQAKVIVA RSNNEMDASKLK EFP LLSIK+S+IK+VFEPN
Sbjct  593  LYRDNIDPQFKWENFDLKEQAKVIVAPRSNNEMDASKLKNEFPNLLSIKDSIIKFVFEPN  652

Query  276  RKT  268
            +KT
Sbjct  653  KKT  655


 Score = 71.2 bits (173),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  499  GSFYSKTKAMVEDLLKNYDNVCTLRVRMPISSDLSNPRNF  538


 Score = 22.7 bits (47),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEEDKPNF
Sbjct  489  FKEEDKPNF  497



>gb|EYU36941.1| hypothetical protein MIMGU_mgv1a010842mg [Erythranthe guttata]
Length=300

 Score =   214 bits (546),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RY+KVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY++Y+DP+F W NF LEEQAKVIVA RSNNE+DASKLKKEFPE+L IKESLI+ VF+PN
Sbjct  235  MYREYIDPSFTWKNFNLEEQAKVIVAPRSNNELDASKLKKEFPEMLGIKESLIENVFKPN  294

Query  276  RKT  268
            RKT
Sbjct  295  RKT  297


 Score = 68.9 bits (167),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  739  GSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
            GSFYSKTKAMV +LL  Y NVCTLRVRMPISSDL+NP  F
Sbjct  141  GSFYSKTKAMVEDLLHNYENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|EMT13548.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=300

 Score =   211 bits (538),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF LEEQAKVIVA RSNNE+D  KLK EFPELLSIKESLIK VF+PN
Sbjct  235  MYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPN  294

Query  276  RKT  268
            +KT
Sbjct  295  QKT  297


 Score = 72.0 bits (175),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  140  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>gb|EPS68271.1| hypothetical protein M569_06499, partial [Genlisea aurea]
Length=297

 Score =   211 bits (537),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            T PRNFITKI RY+KVVNIPNSMTVLDELLPISIEM KRNL GIWNFTNPGVV HNEILE
Sbjct  176  TNPRNFITKITRYEKVVNIPNSMTVLDELLPISIEMGKRNLTGIWNFTNPGVVSHNEILE  235

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP+F W NF+LEEQAKVIVA RSNNE+DA+KLK  FP +L+IKESL++YVF PN
Sbjct  236  MYRDYVDPSFSWKNFSLEEQAKVIVAPRSNNELDATKLKDHFPRMLTIKESLLQYVFIPN  295

Query  276  RK  271
            RK
Sbjct  296  RK  297


 Score = 72.4 bits (176),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL NP  F
Sbjct  141  VGSFYSKTKAMVEELLKNYDNVCTLRVRMPISSDLTNPRNF  181


 Score = 21.6 bits (44),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  132  FKEEDTPNF  140



>gb|EMS50143.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=300

 Score =   211 bits (537),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  175  SNPRNFITKITRYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  234

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF LEEQAKVIVA RSNNE+D  KLK EFPELLSIKESLIK VF+PN
Sbjct  235  MYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPN  294

Query  276  RKT  268
            +KT
Sbjct  295  QKT  297


 Score = 72.0 bits (175),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  140  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  180


 Score = 21.6 bits (44),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  131  FKEEDTPNF  139



>dbj|BAJ95321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   211 bits (537),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  636  TTPRNFITKIARYDKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVGHNEILE  457
            + PRNFITKI RYDKVV+IPNSMT+LDELLPISIEMAKRNL GIWNFTNPGVV HNEILE
Sbjct  202  SNPRNFITKITRYDKVVDIPNSMTILDELLPISIEMAKRNLTGIWNFTNPGVVSHNEILE  261

Query  456  MYKKYMDPAFKWANFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPN  277
            MY+ Y+DP F W NF LEEQAKVIVA RSNNE+D  KLK EFPELLSIKESLIK VF+PN
Sbjct  262  MYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPN  321

Query  276  RKT  268
            +KT
Sbjct  322  QKT  324


 Score = 72.0 bits (175),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  742  TGSFYSKTKAMVGELLKEYGNVCTLRVRMPISSDLNNPSQF  620
             GSFYSKTKAMV ELLK Y NVCTLRVRMPISSDL+NP  F
Sbjct  167  VGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNF  207


 Score = 21.6 bits (44),  Expect(3) = 3e-67, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
 Frame = -3

Query  770  FKEEDKPNF  744
            FKEED PNF
Sbjct  158  FKEEDTPNF  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310