BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031N06

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    221   5e-63   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    220   2e-62   Nicotiana tomentosiformis
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...    209   2e-62   Nicotiana sylvestris
ref|XP_009364630.1|  PREDICTED: probable glycerophosphoryl dieste...    202   1e-60   
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    208   3e-58   
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...    197   2e-57   
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    204   9e-57   Sesamum indicum [beniseed]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    202   4e-56   Pyrus x bretschneideri [bai li]
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    201   7e-56   Solanum tuberosum [potatoes]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    200   2e-55   Solanum lycopersicum
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    198   9e-55   
emb|CDP13760.1|  unnamed protein product                                198   9e-55   Coffea canephora [robusta coffee]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    198   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    198   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    197   2e-54   Solanum tuberosum [potatoes]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    197   3e-54   Fragaria vesca subsp. vesca
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                196   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_006387051.1|  hypothetical protein POPTR_2051s00200g             184   4e-54   
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    194   2e-53   Solanum lycopersicum
gb|KJB13799.1|  hypothetical protein B456_002G094900                    194   4e-53   Gossypium raimondii
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    193   6e-53   Gossypium arboreum [tree cotton]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    192   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    191   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    191   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002300352.2|  hypothetical protein POPTR_0001s371702g            181   8e-52   
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    190   9e-52   Arabis alpina [alpine rockcress]
emb|CDY46687.1|  BnaA03g48210D                                          189   1e-51   Brassica napus [oilseed rape]
emb|CDX86807.1|  BnaA09g21970D                                          179   2e-51   
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    189   2e-51   Brassica rapa
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    189   2e-51   Camelina sativa [gold-of-pleasure]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    188   3e-51   Gossypium arboreum [tree cotton]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                187   6e-51   Erythranthe guttata [common monkey flower]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    187   8e-51   Sesamum indicum [beniseed]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    186   1e-50   
gb|AAP40466.1|  unknown protein                                         186   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    186   1e-50   Camelina sativa [gold-of-pleasure]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    186   1e-50   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    186   2e-50   Glycine max [soybeans]
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    186   2e-50   Cucumis melo [Oriental melon]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    185   5e-50   
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    185   5e-50   Ricinus communis
emb|CDX94294.1|  BnaC01g18900D                                          184   6e-50   
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    184   7e-50   Vitis vinifera
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    184   9e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             184   1e-49   Eutrema salsugineum [saltwater cress]
emb|CDX89312.1|  BnaA01g15810D                                          184   1e-49   
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    184   1e-49   Prunus mume [ume]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    183   1e-49   Brassica rapa
emb|CDX92806.1|  BnaC07g40640D                                          183   2e-49   
emb|CDY42328.1|  BnaC02g17050D                                          174   3e-49   Brassica napus [oilseed rape]
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     181   4e-49   Eucalyptus grandis [rose gum]
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    182   6e-49   Cucumis sativus [cucumbers]
emb|CDY45656.1|  BnaC09g31980D                                          181   6e-49   Brassica napus [oilseed rape]
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    181   7e-49   
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    181   8e-49   Fragaria vesca subsp. vesca
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    181   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             181   1e-48   Prunus persica
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    181   1e-48   Brassica rapa
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   183   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   181   1e-48   Genlisea aurea
emb|CDY13237.1|  BnaC09g24190D                                          181   1e-48   Brassica napus [oilseed rape]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    181   1e-48   Camelina sativa [gold-of-pleasure]
gb|AAF98210.1|AC007152_6  Unknown protein                               183   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    181   1e-48   Brassica rapa
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             180   2e-48   
emb|CDY17323.1|  BnaA10g09570D                                          181   2e-48   Brassica napus [oilseed rape]
ref|XP_010496105.1|  PREDICTED: glycerophosphodiester phosphodies...    169   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             180   2e-48   Capsella rubella
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             180   3e-48   Eutrema salsugineum [saltwater cress]
emb|CDY12605.1|  BnaA02g12730D                                          179   4e-48   Brassica napus [oilseed rape]
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    179   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             177   5e-48   
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    179   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    179   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    179   7e-48   Brassica rapa
ref|XP_002888566.1|  kinase family protein                              180   1e-47   
ref|XP_002867546.1|  MRH5/SHV3                                          178   1e-47   
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             178   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    177   2e-47   Populus euphratica
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    177   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    177   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    177   3e-47   
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             177   4e-47   Capsella rubella
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    176   6e-47   Arabis alpina [alpine rockcress]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    176   6e-47   Populus euphratica
emb|CDX92782.1|  BnaC07g40400D                                          179   7e-47   
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             176   8e-47   Populus trichocarpa [western balsam poplar]
gb|AAL07129.1|  unknown protein                                         176   9e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       176   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    176   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    176   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             175   1e-46   
ref|XP_010433459.1|  PREDICTED: glycerophosphodiester phosphodies...    166   2e-46   
emb|CDY11996.1|  BnaC03g14220D                                          174   3e-46   Brassica napus [oilseed rape]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    174   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             174   4e-46   Phaseolus vulgaris [French bean]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             173   5e-46   Capsella rubella
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    173   5e-46   
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    173   7e-46   Tarenaya hassleriana [spider flower]
emb|CDY36746.1|  BnaA03g11400D                                          173   7e-46   Brassica napus [oilseed rape]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    173   8e-46   Brassica rapa
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    173   9e-46   Brassica rapa
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    172   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    171   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    171   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    172   1e-44   
emb|CDY61647.1|  BnaCnng38120D                                          169   2e-44   Brassica napus [oilseed rape]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    171   2e-44   
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    169   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    168   5e-44   Citrus sinensis [apfelsine]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             168   6e-44   Citrus clementina [clementine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   168   8e-44   Citrus sinensis [apfelsine]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    170   8e-44   Brassica rapa
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    167   9e-44   
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    167   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    167   1e-43   Cicer arietinum [garbanzo]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    165   4e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    163   1e-42   
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    162   4e-42   Cicer arietinum [garbanzo]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    162   6e-42   Glycine max [soybeans]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    161   1e-41   Glycine soja [wild soybean]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             161   1e-41   Phaseolus vulgaris [French bean]
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             160   1e-41   Phaseolus vulgaris [French bean]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    161   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...    158   2e-41   Glycine max [soybeans]
emb|CDY46667.1|  BnaA03g48410D                                          163   2e-41   Brassica napus [oilseed rape]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             160   3e-41   Phaseolus vulgaris [French bean]
gb|KJB62956.1|  hypothetical protein B456_009G445400                    157   2e-40   Gossypium raimondii
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    157   3e-40   
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    157   3e-40   Cicer arietinum [garbanzo]
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    157   4e-40   Elaeis guineensis
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             157   4e-40   Phaseolus vulgaris [French bean]
gb|KJB62955.1|  hypothetical protein B456_009G445400                    157   5e-40   Gossypium raimondii
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    157   5e-40   Elaeis guineensis
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    155   1e-39   Populus euphratica
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    153   5e-39   Phoenix dactylifera
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    154   5e-39   Phoenix dactylifera
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    154   8e-39   Glycine soja [wild soybean]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             153   1e-38   Phaseolus vulgaris [French bean]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    153   1e-38   Phoenix dactylifera
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              153   1e-38   Medicago truncatula
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    152   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             151   3e-38   
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    151   3e-38   Glycine soja [wild soybean]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    152   4e-38   
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    151   4e-38   
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             151   5e-38   
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         151   6e-38   Jatropha curcas
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    149   3e-37   Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    149   3e-37   Glycine max [soybeans]
emb|CDY14478.1|  BnaC03g21170D                                          149   2e-36   Brassica napus [oilseed rape]
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    145   4e-36   
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    146   4e-36   Glycine soja [wild soybean]
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    146   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    145   8e-36   Elaeis guineensis
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    145   8e-36   Medicago truncatula
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              145   1e-35   
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    144   2e-35   Glycine max [soybeans]
emb|CDY58867.1|  BnaC09g52640D                                          144   2e-35   Brassica napus [oilseed rape]
gb|ACF74306.1|  putative glycerophosphoryl diesterphosphodiestera...    135   2e-35   Arachis hypogaea [goober]
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    142   6e-35   Glycine max [soybeans]
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    142   1e-34   Glycine max [soybeans]
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             141   2e-34   Capsella rubella
emb|CDX86766.1|  BnaA09g21560D                                          138   8e-34   
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    139   8e-34   Ricinus communis
gb|KHN41389.1|  Putative glycerophosphoryl diester phosphodiester...    133   9e-34   Glycine soja [wild soybean]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    137   8e-33   Setaria italica
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    137   8e-33   Phoenix dactylifera
emb|CDX82242.1|  BnaA03g35790D                                          134   8e-33   
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    136   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    136   1e-32   Prunus mume [ume]
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    135   1e-32   
ref|NP_001062173.1|  Os08g0503200                                       136   1e-32   
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             135   4e-32   Prunus persica
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    134   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    134   6e-32   
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    135   8e-32   Triticum urartu
ref|NP_001053060.1|  Os04g0472300                                       134   8e-32   
emb|CAH67272.1|  B0806H07.1                                             134   9e-32   Oryza sativa [red rice]
gb|ACF79780.1|  unknown                                                 130   1e-31   Zea mays [maize]
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    133   1e-31   Oryza brachyantha
emb|CDY12599.1|  BnaA02g12670D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    132   2e-31   
emb|CDY29432.1|  BnaC05g32380D                                          131   3e-31   Brassica napus [oilseed rape]
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    132   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    132   4e-31   
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    132   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    130   5e-31   
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    131   8e-31   Pyrus x bretschneideri [bai li]
emb|CDY02788.1|  BnaC02g11010D                                          130   1e-30   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    131   1e-30   
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    130   1e-30   Brachypodium distachyon [annual false brome]
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-30   
dbj|BAJ85772.1|  predicted protein                                      130   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY32730.1|  BnaA02g07920D                                          129   3e-30   Brassica napus [oilseed rape]
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    130   3e-30   Pyrus x bretschneideri [bai li]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    129   3e-30   Triticum urartu
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    129   3e-30   Brassica rapa
dbj|BAJ93663.1|  predicted protein                                      129   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    129   4e-30   Zea mays [maize]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    129   5e-30   Brassica rapa
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    129   5e-30   
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    129   6e-30   
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             129   6e-30   Capsella rubella
emb|CDX88656.1|  BnaA03g09930D                                          129   6e-30   
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    129   7e-30   
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    128   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    128   9e-30   Arabidopsis lyrata subsp. lyrata
gb|AAO42211.1|  unknown protein                                         128   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             128   1e-29   
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    128   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    127   1e-29   
emb|CDY36036.1|  BnaC03g41620D                                          127   2e-29   Brassica napus [oilseed rape]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    127   2e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    127   2e-29   Brassica rapa
dbj|BAC42822.1|  GPI-anchored protein                                   124   2e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87963.1|  predicted protein                                      127   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY02800.1|  BnaC02g10890D                                          126   3e-29   
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     125   3e-29   Eucalyptus grandis [rose gum]
emb|CDY60415.1|  BnaC02g45340D                                          126   7e-29   Brassica napus [oilseed rape]
gb|AFW58562.1|  hypothetical protein ZEAMMB73_533189                    120   1e-28   
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    124   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    124   2e-28   
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    124   2e-28   
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    124   2e-28   
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    124   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          124   3e-28   
dbj|BAD94535.1|  Glycerophosphodiesterase-like                          120   4e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32720.1|  BnaA02g07820D                                          123   6e-28   Brassica napus [oilseed rape]
emb|CDY19634.1|  BnaA05g20420D                                          122   7e-28   Brassica napus [oilseed rape]
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        122   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...    119   1e-27   
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    122   1e-27   Brassica rapa
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    122   1e-27   Arabis alpina [alpine rockcress]
ref|XP_007011972.1|  SHV3-like 5                                        122   1e-27   
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          122   1e-27   Sorghum bicolor [broomcorn]
ref|XP_002453429.1|  hypothetical protein SORBIDRAFT_04g005910          118   1e-27   
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    120   3e-27   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    120   4e-27   Populus euphratica
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    120   4e-27   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    120   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             119   8e-27   
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        119   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170117.1|  hypothetical protein                               119   1e-26   Zea mays [maize]
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    119   1e-26   Setaria italica
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             119   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    119   1e-26   
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             119   2e-26   
gb|KJB13801.1|  hypothetical protein B456_002G094900                    118   2e-26   Gossypium raimondii
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     118   3e-26   Zea mays [maize]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          117   4e-26   Sorghum bicolor [broomcorn]
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    117   6e-26   Populus euphratica
gb|KJB13800.1|  hypothetical protein B456_002G094900                    116   7e-26   Gossypium raimondii
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    116   1e-25   Phoenix dactylifera
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    116   2e-25   Elaeis guineensis
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    115   2e-25   Phoenix dactylifera
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    114   3e-25   
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    114   4e-25   Oryza brachyantha
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    114   7e-25   
ref|NP_001141559.1|  hypothetical protein                               109   8e-25   
emb|CDY43885.1|  BnaC09g33580D                                          114   8e-25   Brassica napus [oilseed rape]
gb|KDP38642.1|  hypothetical protein JCGZ_03995                         114   8e-25   Jatropha curcas
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          111   2e-24   
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    112   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             112   3e-24   
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    111   6e-24   
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     111   6e-24   Eucalyptus grandis [rose gum]
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    111   7e-24   Elaeis guineensis
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    111   7e-24   Morus notabilis
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   110   8e-24   Citrus sinensis [apfelsine]
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    110   8e-24   
emb|CDY59886.1|  BnaC02g47600D                                          104   1e-23   Brassica napus [oilseed rape]
gb|ABG22015.1|  Glycerophosphoryl diester phosphodiesterase famil...    107   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    110   1e-23   Setaria italica
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    110   2e-23   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    110   2e-23   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    110   2e-23   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    110   2e-23   
ref|NP_001066731.1|  Os12g0456700                                       107   2e-23   
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          109   3e-23   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   108   3e-23   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    108   6e-23   
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    107   1e-22   
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    107   1e-22   
emb|CBI18678.3|  unnamed protein product                                107   1e-22   
emb|CDY11832.1|  BnaC03g12580D                                          101   1e-22   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    107   1e-22   
ref|XP_003610370.1|  GPI-anchored protein                               107   1e-22   
ref|NP_001169682.1|  hypothetical protein precursor                     107   2e-22   
gb|EEE53168.1|  hypothetical protein OsJ_36008                          107   3e-22   
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          107   3e-22   
ref|NP_001047275.1|  Os02g0588500                                       106   3e-22   
gb|EAY86479.1|  hypothetical protein OsI_07859                          106   3e-22   
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    104   1e-21   
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             102   6e-21   
ref|XP_006301866.1|  hypothetical protein CARUB_v10022337mg           97.1    8e-21   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    102   8e-21   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    102   1e-20   
ref|XP_008336911.1|  PREDICTED: probable glycerophosphoryl dieste...  95.9    1e-20   
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    100   2e-20   
ref|NP_001159159.1|  uncharacterized protein LOC100304242             95.5    2e-20   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    100   2e-20   
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    100   3e-20   
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750        99.8    6e-20   
ref|XP_009129031.1|  PREDICTED: probable glycerophosphoryl dieste...  95.1    2e-19   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...  97.8    3e-19   
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...  96.3    6e-19   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  96.3    8e-19   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  96.3    8e-19   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  95.5    1e-18   
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...  94.7    2e-18   
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                  93.2    5e-18   
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                  92.8    8e-18   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  92.8    1e-17   
emb|CAN61355.1|  hypothetical protein VITISV_027762                   92.4    1e-17   
gb|KJB54927.1|  hypothetical protein B456_009G054700                  92.8    1e-17   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...  92.8    1e-17   
dbj|BAD94065.1|  Glycerophosphodiesterase-like                        86.7    1e-17   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...  92.4    2e-17   
emb|CDP10204.1|  unnamed protein product                              92.0    2e-17   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...  89.4    2e-16   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...  88.2    4e-16   
gb|EYU43134.1|  hypothetical protein MIMGU_mgv11b015422mg             81.6    4e-16   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...  87.4    7e-16   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg              87.0    8e-16   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           87.0    9e-16   
dbj|BAD94573.1|  Glycerophosphodiesterase-like                        81.6    9e-16   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  86.7    1e-15   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  85.1    4e-15   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  84.7    6e-15   
gb|EPS68532.1|  hypothetical protein M569_06231                       84.0    8e-15   
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...  84.0    9e-15   
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...  84.0    9e-15   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...  82.8    2e-14   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...  81.6    5e-14   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  81.6    5e-14   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           80.5    1e-13   
gb|AAD10252.1|  S222                                                  79.3    2e-13   
gb|EEC72640.1|  hypothetical protein OsI_06154                        79.7    2e-13   
ref|NP_001046128.1|  Os02g0187400                                     79.0    4e-13   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  79.0    4e-13   
ref|XP_007146555.1|  hypothetical protein PHAVU_006G0504000g          74.3    4e-13   
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...  78.6    5e-13   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  78.6    6e-13   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           77.8    7e-13   
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...  77.4    1e-12   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...  77.0    1e-12   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...  77.0    2e-12   
dbj|BAK08209.1|  predicted protein                                    73.6    2e-11   
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...  69.7    2e-10   
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...  65.5    8e-09   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...  63.9    3e-08   
emb|CDY28913.1|  BnaA02g25630D                                        60.1    5e-08   
ref|XP_006602095.1|  PREDICTED: uncharacterized protein LOC100782575  58.9    8e-08   
ref|XP_001766682.1|  predicted protein                                60.1    5e-07   
gb|EEE56466.1|  hypothetical protein OsJ_05675                        58.9    1e-06   
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  58.5    1e-06   



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FA SVII K SVFP++D+F++  TNVV KLQ+S + VYVQLF+NEFVSQAWDFFSD
Sbjct  567  EIKTFAKSVIITKESVFPSEDAFIIAQTNVVQKLQSSNLTVYVQLFNNEFVSQAWDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              +ELN+Y  GA     DGVIT +PATA RYRRNRCLG K++PPYM PV PGSLL L++P
Sbjct  627  SSLELNNYAVGAG---IDGVITEYPATAARYRRNRCLGLKDLPPYMSPVQPGSLLGLIAP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  684  QFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FA SVII K SVFP++D+F++  TNVV KLQ+S + VYVQL +NEFVSQ+WDFFSD
Sbjct  567  EIKTFAKSVIITKQSVFPSEDAFIIAQTNVVQKLQSSNLTVYVQLLNNEFVSQSWDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VELN+Y  GA     DGVIT +PATA RYRRNRCLG+K+ PPYM  V PGSLL+LM+P
Sbjct  627  SSVELNNYAVGAG---IDGVITEYPATAARYRRNRCLGFKDSPPYMTSVQPGSLLELMAP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  684  QFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_009794308.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2, partial [Nicotiana sylvestris]
Length=305

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FASSVI+ K SVFP+++ FL+G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD
Sbjct  120  EIKSFASSVIVTKKSVFPSEEQFLIGQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSD  179

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA     DGVIT FP TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+P
Sbjct  180  SSVEINNYISGAG---IDGVITEFPGTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAP  236

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  237  QLLPAAEAPNPILTDSDVVEPPLPPVAKI  265



>ref|XP_009364630.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
 ref|XP_009364651.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=242

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K+S+FP   +F+ GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSD
Sbjct  56   DIKKFADSVVVNKASIFPESKAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSD  115

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA+    DGVIT FP TA RY++N CL  KEIP YM PV P SL+Q+++P
Sbjct  116  PTVEINSFVSGAN---IDGVITDFPKTAARYKKNLCLRQKEIPSYMSPVQPASLVQVITP  172

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  173  SYLPPAEAPNPVLTESDVIEPPLPSVTAL  201



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FASSVI+ K SVFP+++ FL+G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD
Sbjct  555  EIKSFASSVIVTKKSVFPSEEEFLIGQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSD  614

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA     DG+IT FP TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+P
Sbjct  615  SSVEINNYISGAG---IDGIITEFPGTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAP  671

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  672  QLLPAAEAPNPILTDSDVVEPPLPPVAKI  700



>ref|XP_008345027.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=299

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 3/145 (2%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA SV+I K+S+FP  ++F+ GVT+VV+KLQ +K+ VYV+LFSNEFVSQ WDFFSDP
Sbjct  114  IKKFADSVVINKASIFPZVEAFITGVTDVVSKLQDAKLPVYVELFSNEFVSQPWDFFSDP  173

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  404
             VE+NS+V G +    DGVIT FP TA RY++NRCLG KE+P YM P+ P SL+Q+++P 
Sbjct  174  TVEINSFVSGVN---IDGVITDFPKTAARYKKNRCLGRKEVPNYMSPIQPASLIQVVTPS  230

Query  403  YLPPAEAPYPVLTESDVVEPPLPPV  329
            YLPPAEAP P L ESDV+EPPLP V
Sbjct  231  YLPPAEAPNPTLRESDVIEPPLPSV  255



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFASSV++ K SVFPTDD+F+ G TNVV KLQA  + VYVQ F NEFV+Q WDFFSD
Sbjct  572  EIKKFASSVVLSKGSVFPTDDAFVTGETNVVPKLQAFNLTVYVQYFRNEFVAQPWDFFSD  631

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
             YVE+N++V   S    +GV+T FPATA +YRRNRCLGYKE+P YM PV P  L+ LM+P
Sbjct  632  AYVEINTHV---SYMGINGVVTDFPATAAKYRRNRCLGYKEVPLYMTPVQPAGLISLMAP  688

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            ++LPPAEAP PVLTE+DV EPPLPPV +
Sbjct  689  KFLPPAEAPNPVLTENDVTEPPLPPVVE  716



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K+S+FP  ++F+ GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSD
Sbjct  566  DIKKFADSVVVNKASIFPESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA+    DGVIT FP TA RY++N CL  KEIP YM PV P SL+Q+++P
Sbjct  626  PTVEINSFVSGAN---IDGVITDFPKTAARYKKNLCLRQKEIPSYMSPVQPASLVQVITP  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  683  SYLPPAEAPNPVLTESDVIEPPLPSVTAL  711



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FASSVI+ K+SVFP++  FLVG TNVV KL +S + VYVQ F+NEFVSQAWDFFSD
Sbjct  566  EIKSFASSVILTKNSVFPSESKFLVGKTNVVEKLHSSNLSVYVQRFNNEFVSQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y  GA     DGVIT FP TA RYRRNRCL YK  P Y   V PG LLQ MS 
Sbjct  626  SSVEINNYFIGAG---IDGVITDFPRTAARYRRNRCLRYKVPPLYFSLVSPGVLLQFMSR  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  683  QSLPPAEAPSPILTESDVVEPPLPPVAKI  711



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FA SV+I K SVFP++D+F++G TN+V KLQ++ + VYV+LF+NEF+SQAWDFFSD
Sbjct  566  EIKTFAKSVVITKKSVFPSEDAFIIGQTNIVQKLQSANLPVYVRLFNNEFISQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
               E+N+YV GA     DG++T +P TA RYRRNRCL YK +PPYM PV PGSLL LM+ 
Sbjct  626  SSTEINNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKNLPPYMSPVQPGSLLGLMTV  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  683  QSMPPVEPPSPVLDVSDVTEPPLPPVAKI  711



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV+I K+S+FP  ++F+ GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSD
Sbjct  566  DIKKFADSVVINKASIFPESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+N +V GA+    DGVIT FP TA RY++N CL  KEIP YM P+ P SL+Q+++P
Sbjct  626  PTVEINLFVSGANV---DGVITDFPKTAARYKKNPCLRQKEIPSYMSPIPPASLVQVITP  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  683  SYLPPAEAPNPVLTESDVIEPPLPSVTAV  711



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI KFASSV++ K SV+P++++FL GVT VV K+QA  ++VYVQLFSNEFVSQAWDFFSD
Sbjct  563  EIMKFASSVLVTKGSVYPSEEAFLTGVTKVVPKVQALGLRVYVQLFSNEFVSQAWDFFSD  622

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            PYVE+N+Y+   + N   G++T +PATA RYR+NRCLGYK+ P YMLPV PGSL+ +M  
Sbjct  623  PYVEINTYISNMTIN---GLVTDYPATAARYRKNRCLGYKQAPSYMLPVQPGSLISVMDR  679

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPP EAP PVL E+DV EPPLP V
Sbjct  680  SLLPPTEAPKPVLKENDVTEPPLPHV  705



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV+I K+S+FP  ++F  GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSD
Sbjct  566  DIKKFADSVVIKKASIFPEVEAFTTGVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM P+ P SL+Q+++ 
Sbjct  626  PTVEINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTS  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
             YLPPAEAP P L ESDV+EPPLP V
Sbjct  683  AYLPPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV+I K+S+FP  ++F  GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSD
Sbjct  566  DIKKFADSVVIKKASIFPEVEAFTTGVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM P+ P SL+Q+++ 
Sbjct  626  PTVEINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTS  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
             YLPPAEAP P L ESDV+EPPLP V
Sbjct  683  AYLPPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK FA SV+I K+SVFP++ +F++G TNVV KLQ++ + VYV+LF+NEFVSQAWDFFSD
Sbjct  566  EIKTFAKSVVITKNSVFPSEGAFIIGQTNVVQKLQSANLPVYVRLFNNEFVSQAWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
               ELN+YV GA     DG++T +P TA RYRRNRCL YK++P YM PV PGSLL LM+ 
Sbjct  626  SSTELNNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKDLPSYMSPVQPGSLLGLMTV  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  683  QSMPPVEPPNPVLDVSDVTEPPLPPVAKI  711



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K+SVFP +  F+ GVT+VV KLQ  K+ +YV+LFSNEFVSQAWDFFSD
Sbjct  567  DIKKFANAVVIKKTSVFPENQEFVTGVTDVVTKLQGFKIPIYVELFSNEFVSQAWDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V G      DGVIT FP TA RY+RNRCL YKE P YM PV PGSL+Q++S 
Sbjct  627  PSVEINSFVTGPV---IDGVITDFPKTAARYKRNRCLSYKETPAYMSPVQPGSLIQVISS  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
             Y+PPAEAP P LTESDV+EPPLP
Sbjct  684  VYMPPAEAPKPYLTESDVIEPPLP  707



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFASSV+I K SVFPT+ +FLVG T VV KLQA  + VYVQ F NE+VSQ WDFFSD
Sbjct  572  QIKKFASSVVISKRSVFPTERAFLVGETPVVPKLQAFNLTVYVQFFRNEYVSQPWDFFSD  631

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
             YVE+N++V   S    +GVIT +PATA RY+RNRCLGYK+IP YM PV PG LL LM+ 
Sbjct  632  AYVEINTHV---SYMEINGVITDYPATAARYKRNRCLGYKDIPLYMTPVQPGGLLTLMTS  688

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
            Q+LPPAEAP PVLTE DV EPPLP V
Sbjct  689  QFLPPAEAPSPVLTEDDVAEPPLPAV  714



>ref|XP_006387051.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
 gb|ERP45965.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
Length=194

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA+SV+I K SVFP   SFL GVTNVV KLQ+  + VYV+ F+NEFVSQAWDFFSD
Sbjct  8    DIKDFANSVVISKISVFPKSSSFLTGVTNVVPKLQSHGLSVYVETFNNEFVSQAWDFFSD  67

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA+     GVIT FP T+ RY+RNRCLGY  +PPYM P  PG L+QL+SP
Sbjct  68   STVEINSYVMGAN---ISGVITEFPLTSARYKRNRCLGYNVLPPYMSPAQPGGLIQLISP  124

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPPAE P PVLT  DVVE PLP
Sbjct  125  FALPPAEPPNPVLTAPDVVEGPLP  148



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI+ FASSVI+ K SVFP++  FLVG TNVV KL +S + VYVQ F+NEFVSQ WDFFSD
Sbjct  564  EIRSFASSVILTKKSVFPSESQFLVGKTNVVEKLHSSNLSVYVQHFNNEFVSQPWDFFSD  623

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y  GA     DG+IT FP TA RYRRNRCL YK  P Y   V PG L Q MS 
Sbjct  624  SSVEINNYFVGAG---IDGIITDFPRTAARYRRNRCLHYKVPPMYFSLVSPGVLQQFMSR  680

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  681  QSLPPAEAPSPILTESDVVEPPLPPVAKI  709



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD
Sbjct  573  DIKRFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NS+  GAS N   GVIT FP T++RYRRNRCL    + P YM PV PGSLL L++
Sbjct  633  ATVEINSFCAGASIN---GVITDFPKTSDRYRRNRCLKRGNKTPTYMSPVQPGSLLSLVT  689

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  690  TDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ F NEF SQAWDFFSD
Sbjct  573  DIKRFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFRNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NS+  GA  N   GVIT FP T++RYRRNRCL    +IP YM PV PGSLLQL++
Sbjct  633  ATVEINSFYVGAGIN---GVITDFPKTSDRYRRNRCLKRGNKIPTYMSPVPPGSLLQLVT  689

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  690  TDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD
Sbjct  580  DIKKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG LL +MSP
Sbjct  640  ATVEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP     E+DV EPPL PV
Sbjct  697  LSLPPAQAPNQDFIEADVTEPPLSPV  722



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD
Sbjct  602  DIKKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSD  661

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG LL +MSP
Sbjct  662  ATVEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSP  718

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP     E+DV EPPL PV
Sbjct  719  LSLPPAQAPNQDFIEADVTEPPLSPV  744



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA++V+I K+SVFP  D+F+ G  NVV +LQ SK+ VYV+LF NEFVSQA+DFFSD 
Sbjct  586  IKKFANAVVINKASVFPDSDAFVTGKPNVVERLQKSKLSVYVELFRNEFVSQAYDFFSDA  645

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSP  407
             VELNSY+ GA  N   G IT FP TA RYRRNRCLG KEIPPYMLP+ PG LL  ++SP
Sbjct  646  TVELNSYISGAGIN---GTITEFPFTAARYRRNRCLGRKEIPPYMLPIQPGDLLHDVVSP  702

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP  ++T++D++EPPLPPV 
Sbjct  703  LSLPPAEAPNLIITDADLIEPPLPPVT  729



>ref|XP_002300352.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
 gb|EEE85157.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
Length=259

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 108/144 (75%), Gaps = 4/144 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV+I K+SVFP   SFL GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD
Sbjct  73   DIKDFASSVVISKASVFPESSSFLSGVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSD  132

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G +     GVIT FP T+ RY+RNRCLG KE+P YM P  PG L+QL+SP
Sbjct  133  STVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-KELPSYMSPAQPGGLMQLISP  188

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPPAE P PVLT  DVVE PLP
Sbjct  189  FALPPAEPPNPVLTAPDVVEGPLP  212



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   190 bits (482),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGK+SVFP  D+F+ G TNVV KLQ S++ VYV+LF NEFVSQ++DFFSD
Sbjct  572  DIKKFANAVVIGKTSVFPVADAFITGQTNVVEKLQKSQLPVYVELFQNEFVSQSYDFFSD  631

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS++ GA  N   G IT FP TA R++RNRCLG KE P YM+PV PG LL+++SP
Sbjct  632  ATVEINSFISGAGIN---GTITEFPFTAARFKRNRCLGAKETPNYMIPVEPGGLLKIVSP  688

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
               PPA+AP PV T++DV EPPLPPV
Sbjct  689  TSFPPAQAPNPVFTDADVTEPPLPPV  714



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I KSSVFP  + F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  527  DIKRFASAVVIVKSSVFPDSEGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  586

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV PG LLQ+++ 
Sbjct  587  ANVEINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNH  643

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  644  ASLPPAEAPNPVFTDADVTEPPLPPVT  670



>emb|CDX86807.1| BnaA09g21970D [Brassica napus]
Length=230

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGK SVF   DSF+   TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD
Sbjct  39   DIKKFANAVVIGKESVFSLLDSFITRQTNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSD  98

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NSY+ GA  N   G IT FP TA RY+RNRCLG +E +PPYM P  PGSLLQ ++
Sbjct  99   PTVEINSYILGAGIN---GTITEFPFTAARYKRNRCLGTQETLPPYMAPFKPGSLLQAVN  155

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               +PPA+AP PV T+ DV EPPLPPV 
Sbjct  156  A--IPPAQAPNPVFTDDDVTEPPLPPVT  181



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I KSSVFP  + F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  569  DIKRFASAVVIVKSSVFPDSEGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV PG LLQ+++ 
Sbjct  629  ANVEINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNH  685

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  686  ASLPPAEAPNPVFTDADVTEPPLPPVT  712



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEF+SQA+DFFSD
Sbjct  581  DIKKFANAVVINKESVFPDSDSFLTGQTNVVERLQKSQLPVYVELFRNEFISQAYDFFSD  640

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMS  410
              VE+N+Y++GA  N   G IT FP TA RY+RNRCLG KEIPPYM P+  G+LL+ L++
Sbjct  641  ATVEINTYIYGAGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMSPIQAGTLLKNLVT  697

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            P  LPPAEAP  ++T++D++EPPLPPV 
Sbjct  698  PLSLPPAEAPKLIITDADLIEPPLPPVT  725



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 111/148 (75%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I K SVFP   +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSD
Sbjct  588  DIKRFASAVVISKDSVFPETSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSD  647

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
            P VE+NS+  G   N   GVIT FP T+NRYRRNRCL    +IP YM PV PGSL QL++
Sbjct  648  PTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRGNQIPGYMSPVQPGSLYQLIT  704

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  705  APYLPPAEAPNPFLTEADVNEPPLPPVA  732



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FA++V+I K SVFPTD+S++ G T+VV K+QA  + VYVQ+F NEFV+QAWDFFSD
Sbjct  573  EIKEFATAVVISKRSVFPTDESYMTGQTSVVPKIQAFNLPVYVQIFQNEFVAQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
             Y+E+ +YV    A   +GV+T +PATA +++RNRCLGYK  PPYM PV PG L+ LM+P
Sbjct  633  AYLEMLNYV---DAMNINGVVTDYPATAAKFKRNRCLGYKNRPPYMTPVRPGGLISLMAP  689

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              L PAEAPYPVLT  DV EPPLP V
Sbjct  690  GSLTPAEAPYPVLTGDDVAEPPLPAV  715



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI+KFASSV+I K+S+FP+DD+F+ G T+++ K++A  + VYV+LF NEF SQ +DFFSD
Sbjct  569  EIRKFASSVVIRKASIFPSDDAFITGKTSIIPKIKAFDLPVYVKLFRNEFRSQPYDFFSD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
             YVE+N++ F       DGVIT +PATA R++RNRCLGYK+ PPYM+P+    L+ L+SP
Sbjct  629  AYVEINAHYFAG----IDGVITDYPATAARFKRNRCLGYKDTPPYMMPLQARLLIDLISP  684

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPPAEAP P+LT++DV EPPLPPV 
Sbjct  685  TYLPPAEAPSPILTDNDVAEPPLPPVT  711



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 111/148 (75%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K+SVFP    FL G T+VV KLQ+ K+ VYV+ FSNEFVSQAWDFFSD
Sbjct  555  DIKSFADSVVINKASVFPDIALFLTGSTDVVKKLQSYKLHVYVETFSNEFVSQAWDFFSD  614

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NSYV GA+    DGVIT FPATA RY+ NRCLG     P YM PV PGSL++L++
Sbjct  615  ATVEVNSYVTGANV---DGVITEFPATAARYKINRCLGLGNNTPAYMSPVQPGSLVELIT  671

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              YLPPAEAP PVLTE DV EPPLPP A
Sbjct  672  TDYLPPAEAPNPVLTEDDVSEPPLPPAA  699



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD
Sbjct  580  DIKKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y++GA  N   G IT FP TA RY+RNR LG +E+PPYMLPV PG LL +MSP
Sbjct  640  ATVEINAYIYGAGIN---GTITEFPFTAARYKRNRYLGREEVPPYMLPVNPGGLLNVMSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP     E+DV EPPL PV
Sbjct  697  LSLPPAQAPNQDFIEADVTEPPLSPV  722



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K+SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D
Sbjct  580  DIKKFANAVVINKASVFPVSDSFLTGQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMS  410
              VE+NSY+ GA  N   G IT FP TA RY+RNRCLG K IPPYM  + PG LL  L+S
Sbjct  640  ATVEINSYISGAGIN---GTITEFPYTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVS  696

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P  LPPA+AP PV T+ DV EPPLPPV
Sbjct  697  PLSLPPAQAPNPVFTDGDVTEPPLPPV  723



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K S+ P +D FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD
Sbjct  568  DIKSFASSVVVNKDSIIPNNDQFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PGSL  L++
Sbjct  628  ATVEINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLIT  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  685  KEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K S+ P +D FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD
Sbjct  568  DIKSFASSVVVNKDSIIPNNDQFLTAYTNIVPKLKNASLSVFVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PGSL  L++
Sbjct  628  ATVEINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLIT  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  685  KEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV I K+SVFP +  FL G TNVV KL+A  + VYV  FSNEFVSQAWDFFSD
Sbjct  573  DIKSFADSVTITKNSVFPVNQFFLTGATNVVKKLKALNLSVYVDTFSNEFVSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM PV PGSLLQL++P
Sbjct  633  ATVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLAMKETPNYMSPVQPGSLLQLVTP  689

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P PVL + DV EPPLPPV+
Sbjct  690  NYLPPKTPPSPVLDDKDVAEPPLPPVS  716



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+I K SVFP +++FL GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD
Sbjct  573  DIKSFASAVVISKDSVFPENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+NS+  G   N   GVIT FP T++RYRRNRCL   +  P YM PV PGSLLQL++
Sbjct  633  ATVEVNSFHVGGLIN---GVITDFPETSDRYRRNRCLNKGDNTPGYMSPVQPGSLLQLVT  689

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  690  AEYLPPAEAPNPYLTEADIAESPLPPVA  717



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +I+ FA+SV++ K+SVFP +  FL G T+VV KLQ++ + VYV+LFSNEFVSQAWDFFSD
Sbjct  579  DIRTFANSVVVNKNSVFPDNSLFLTGATDVVPKLQSAGLPVYVELFSNEFVSQAWDFFSD  638

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NSYV GA+ +   GVIT FP TA RY+RN+CL      P YM PV PGSLLQL++
Sbjct  639  ANVEINSYVIGANVS---GVITDFPKTAARYKRNKCLNMGNSTPAYMAPVQPGSLLQLIT  695

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
              YLPPAEAP PVLTE+DV E PLPPV
Sbjct  696  QDYLPPAEAPNPVLTEADVAEAPLPPV  722



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKKFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP
Sbjct  631  ATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSP  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              +PPAEAP PV T++DV EPPLPPV 
Sbjct  688  GSIPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA+SV+I K S++P + +F+ G T++V++L+ + + VYVQ F NEF+SQAWDFFSD
Sbjct  569  DIKKFATSVVISKDSIYPENKAFITGATDIVSRLKKNNLPVYVQRFDNEFISQAWDFFSD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA     DGVIT FP TA  YR+NRCL YK  P YM PV PGSL+Q+++ 
Sbjct  629  ATVEINSFVTGAG---IDGVITSFPQTAASYRKNRCLKYKNAPSYMSPVQPGSLMQVITS  685

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              +PPA APYPVLTESDV EPPL  VA
Sbjct  686  DDMPPALAPYPVLTESDVAEPPLQEVA  712



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I K SVFPT+  FL G TN+V+KLQ+S + VYV LF NEFVSQAWDFFSD
Sbjct  568  DIKQFAHSVAITKESVFPTNQLFLTGATNIVSKLQSSNLTVYVYLFRNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
            P VE+NS+V GA     DG+IT FP TA  YR N+CL   K  P YM PV PG+L+Q+++
Sbjct  628  PVVEINSFVMGAG---IDGIITDFPGTATAYRNNKCLKMGKNKPYYMNPVEPGALMQVIT  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             ++LPPAE+P PVLTESDV EPPL  + K
Sbjct  685  AEFLPPAESPNPVLTESDVAEPPLASITK  713



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K+SVFPT +SF  G TN+VA+LQ  ++ VYV++F NEFVSQ WDFFSD
Sbjct  582  DIKKFADAVVIKKTSVFPTSESFTTGQTNLVARLQKVQLPVYVEVFRNEFVSQPWDFFSD  641

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RNRCL  K+ P YM+PV P  LL ++SP
Sbjct  642  ATVEINSHVSGAGIN---GTITEFPLTAARYKRNRCLTRKDPPTYMIPVLPAGLLSIVSP  698

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV+TE+DV EPPLPPV 
Sbjct  699  TSLPPAEAPNPVITEADVTEPPLPPVT  725



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKTFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP
Sbjct  631  ATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSP  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  688  GSLPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV+I K+S+FP   +F+  VT+VV +LQA+K++VYV+LFSNEFVSQAWDFFSD
Sbjct  568  DIKKFADSVVINKASIFPQTQAFVARVTHVVPELQAAKLQVYVELFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+  G +    DGVIT FP TA RY+RNRCL  K +P YM P+   SL+Q+++ 
Sbjct  628  PTVEINSFATGVN---IDGVITDFPKTAARYKRNRCLSEKVLPNYMSPIQGASLIQVVTS  684

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
             YLPPAEAP P LT SDV+EPPLP V
Sbjct  685  DYLPPAEAPNPPLTASDVIEPPLPSV  710



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKTFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP
Sbjct  631  ATVEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSP  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  688  GSLPPAEAPNPVFTDADVTEPPLPPVT  714



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+I KSSVFP  + F+   TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  527  DIKAFASAVVIVKSSVFPDSEGFVTEQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  586

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G +T FP TA R+RRNRCLG KE PPYM PV PG LLQ+++ 
Sbjct  587  ANVEINSYVTGAGVN---GTVTEFPYTAARFRRNRCLGSKETPPYMAPVQPGGLLQVVNH  643

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  644  ASLPPAEAPNPVFTDADVTEPPLPPVT  670



>emb|CDY42328.1| BnaC02g17050D [Brassica napus]
Length=258

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V++ KSSVFP  DSF+ G TNVV +LQ SK+ VYV+LF NEFVSQ +DFF D
Sbjct  79   DIKKFANAVVLRKSSVFPVADSFVTGQTNVVERLQKSKLLVYVKLFHNEFVSQPYDFFCD  138

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA  N   G IT FP TA RY+RN+CLG K+ P YM P+ PG LL +++P
Sbjct  139  ATVEINTYITGAGLN---GTITEFPLTAARYKRNQCLGRKQTPSYMSPLKPGGLLSIVNP  195

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + LPPAE PY V T  DV E P PP  +
Sbjct  196  KSLPPAEPPYLVFTADDVTESPQPPATE  223



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD
Sbjct  453  DIKKFADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSD  512

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM PV PGSL+Q+++ 
Sbjct  513  ATVEVNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITT  568

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+APYPVL ESDV EPPLP V
Sbjct  569  PMLPPAQAPYPVLIESDVDEPPLPAV  594



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV I KSSVFP +  FL G T+VV KL+A  + VYV+ FSNEFVSQAWDFFSD
Sbjct  573  DIKSFADSVTITKSSVFPVNQFFLTGATDVVKKLKALNLSVYVESFSNEFVSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM PV PGSLLQL++ 
Sbjct  633  ATVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLTMKETPTYMSPVQPGSLLQLITQ  689

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P PVL + DV EPPLPPV+
Sbjct  690  PYLPPKTPPSPVLDDKDVAEPPLPPVS  716



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 107/146 (73%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++ K+SVFP   SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  467  DIKKFADAVVVRKNSVFPVSQSFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  526

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RNRCL  K++PPYM PV P  LL +MSP
Sbjct  527  ATVEINSHVTGAGIN---GTITEFPLTAARYKRNRCLTRKDLPPYMSPVQPAGLLSIMSP  583

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  584  TSLPPAEAPNPVFTDADVTEPPLPPV  609



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD
Sbjct  559  DIKKFADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSD  618

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM PV PGSL+Q+++ 
Sbjct  619  ATVEVNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITT  674

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+APYPVL ESDV EPPLP V
Sbjct  675  PMLPPAQAPYPVLIESDVDEPPLPAV  700



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K+SVFP +  +++G T+VV KL A  + VYV+LFSNE++SQAWDFFSD
Sbjct  563  DIKKFADAVVINKASVFPENVEYVIGATDVVTKLHAFDLHVYVELFSNEYLSQAWDFFSD  622

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V G +    DG+IT FP TA RY+RN+CL Y+E P YM P+ PG L   +SP
Sbjct  623  PTVEINSFVSGVNV---DGIITDFPKTAVRYKRNKCLFYRERPSYMKPIQPGVLFTAISP  679

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPP EAP PVLTESDV EPPLP
Sbjct  680  AQLPPVEAPNPVLTESDVTEPPLP  703



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+IGK+SVFP+  SF  G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD
Sbjct  581  DIKKFADAVVIGKTSVFPSSASFTTGQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSD  640

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP
Sbjct  641  ATVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSP  697

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV+EPPLPPV 
Sbjct  698  ASLPPAEAPNPVFTDADVIEPPLPPVT  724



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV+I K+S+FP   +F+  VT+VV KL+A+K+ VYV+LFSNEFVSQAWDFFSD
Sbjct  569  DIKKFADSVVINKASIFPETQAFITRVTDVVPKLKAAKLPVYVELFSNEFVSQAWDFFSD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V   +    DGVIT FP TA RY+RNRCL  K  P YM PV   SL+Q+++ 
Sbjct  629  PTVEINSFVLAVN---IDGVITDFPKTAARYKRNRCLSEKVPPSYMTPVQAASLIQVVTA  685

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
             YLPPAEAP P LT +DV+EPPLP V
Sbjct  686  DYLPPAEAPNPPLTATDVIEPPLPSV  711



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 109/145 (75%), Gaps = 3/145 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGKSSVFP   SF+ G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD
Sbjct  570  DIKKFANAVVIGKSSVFPDVGSFVTGQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSD  629

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG KE P YM P+ PG LL L +P
Sbjct  630  ATVEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKETPSYMSPIKPGILLSLANP  686

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
            + LPPAEAPYPV TE DV E P PP
Sbjct  687  RSLPPAEAPYPVFTEDDVTESPQPP  711



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVG-VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V+I K+SVFP  DSFL G  TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+
Sbjct  581  DIKKFANAVVINKASVFPNSDSFLTGQTTNVLERLQKFQLPVYVELFQNEFVSQPFDFFA  640

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG +L L+S
Sbjct  641  DETVEINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPVNPGGVLTLIS  697

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
               LPPA+ P P+ T  DV EPPLPPV
Sbjct  698  TSSLPPAQDPNPIFTHDDVTEPPLPPV  724



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 101/146 (69%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI KFASSV+I K SVFP D  F  G T VV  LQ   + VYVQ F NEF SQ WDF+SD
Sbjct  532  EIAKFASSVVISKESVFPLDRQFTTGQTTVVGFLQGYNLSVYVQDFQNEFFSQPWDFYSD  591

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G   N   GV+T +P TANRYRR RCLGYK  P YMLPV PGSL+ L+  
Sbjct  592  ATVEINSYVSGVGIN---GVVTDYPGTANRYRRRRCLGYKNTPNYMLPVQPGSLITLLVK  648

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA AP PVLTE DV+E PLPPV
Sbjct  649  NQLPPAPAPSPVLTEGDVIEAPLPPV  674



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKK A++V+IGK SVF   DSF+   TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD
Sbjct  568  DIKKCANAVVIGKESVFSLLDSFITRQTNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NSY+ GA  N   G IT FP TA RYRRNRCLG +E +PPYM PV PGSLLQ ++
Sbjct  628  PTVEINSYILGAGIN---GTITEFPFTAARYRRNRCLGTQETLPPYMAPVEPGSLLQAVN  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               +PPA+AP PV T+ DV EPPLPPVA
Sbjct  685  A--IPPAQAPNPVFTDDDVTEPPLPPVA  710



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA++V+I K+SVFP  DSFL G TNVV +LQ SK+ VYV LF NEFVSQ +DFF+D
Sbjct  582  KIKEFANAVVINKASVFPDSDSFLTGQTNVVERLQKSKLPVYVGLFQNEFVSQPYDFFAD  641

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+   S    +G+IT FP TA RY+ NRCLG KE PPYM PV P +LL  MSP
Sbjct  642  ATVEINTYI---SLVGINGIITEFPFTAARYKTNRCLGRKETPPYMEPVKPRALLAFMSP  698

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            Q LPPAEAP  ++T++DV+EPPLPP+ +
Sbjct  699  QSLPPAEAPNLIITDADVIEPPLPPITE  726



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVG-VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V+I K+SVFP  DSFL G  TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+
Sbjct  583  DIKKFANAVVINKASVFPNSDSFLTGQTTNVLERLQKFQLPVYVELFQNEFVSQPFDFFA  642

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG +L L+S
Sbjct  643  DETVEINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPVNPGGVLTLIS  699

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
               LPPA+ P P+ T  DV EPPLPPV
Sbjct  700  TSSLPPAQDPNPIFTHDDVTEPPLPPV  726



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 108/146 (74%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++ K+SVFP  +SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  582  DIKKFADAVVVRKNSVFPVSESFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  641

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV P  LL +MSP
Sbjct  642  ATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSP  698

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  699  TSLPPAEAPNPVFTDADVTEPPLPPV  724



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA ++++GK SVFPT  SF+   TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD
Sbjct  496  DIKKFADAIVVGKKSVFPTSASFITRQTNLVARLQKVQLPVYVELFQNEFVSQPWDFFSD  555

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV P  LL ++SP
Sbjct  556  ATVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSP  612

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  613  TSLPPAEAPNPVFTDADVTEPPLPPVT  639



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 108/146 (74%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++ K+SVFP  +SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  582  DIKKFADAVVVRKNSVFPVSESFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  641

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV P  LL +MSP
Sbjct  642  ATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSP  698

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  699  TSLPPAEAPNPVFTDADVTEPPLPPV  724



>ref|XP_010496105.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=177

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGKSSVFP    F+ G T VV +LQ S+++VYV+LF NEFVSQ  D F D
Sbjct  1    DIKKFANAVVIGKSSVFPATKRFVTGQTAVVERLQKSQLQVYVELFQNEFVSQKLDSFYD  60

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMS  410
              +E+N+Y +G   N   G IT +P TA RY+RNRCLG K IPPYM  + PG LL  L+S
Sbjct  61   ATIEINTYTYGLGIN---GTITEYPFTAARYKRNRCLGRKVIPPYMSAIEPGGLLNYLVS  117

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            P  LPPAEAP  V T +DV EPPLPPVAK
Sbjct  118  PLSLPPAEAPNLVFTNADVSEPPLPPVAK  146



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA ++++GK SVFPT  SF+   TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD
Sbjct  581  DIKKFADAIVVGKKSVFPTSASFITRQTNLVARLQKVQLPVYVELFQNEFVSQPWDFFSD  640

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV P  LL ++SP
Sbjct  641  ATVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSP  697

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  698  TSLPPAEAPNPVFTDADVTEPPLPPV  723



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+IGKSSVF   D  ++G T VV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKEFASAVVIGKSSVFEVTDGLVIGQTKVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G   N   G IT FP TA RY+RN CLG KEIP YM PV PG LL+++SP
Sbjct  631  ATVEINSYVTGVGIN---GTITEFPFTAARYKRNPCLGSKEIPFYMAPVPPGGLLEVVSP  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  688  GSLPPAEAPKPVFTDADVTEPPLPPVT  714



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 109/145 (75%), Gaps = 3/145 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGKSSVFP   SF+ G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD
Sbjct  537  DIKKFANAVVIGKSSVFPDVGSFVTGQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSD  596

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG K+ P YM P+ PG LL L +P
Sbjct  597  ATVEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKKTPSYMSPIKPGILLSLANP  653

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
            + LPPAEAPYPV TE DV E P PP
Sbjct  654  RSLPPAEAPYPVFTEDDVTESPQPP  678



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FA++V+I K SVF    SF  G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  449  EIKEFANAVVINKDSVFHYSGSFPNGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  508

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              +E+N+Y+  A  N   G+IT FP TA RY+RNRC+G KE PPYM PV PG+LL  MSP
Sbjct  509  ATIEINTYISLAGIN---GIITEFPFTAARYKRNRCMGRKETPPYMEPVKPGALLAYMSP  565

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            Q LPPAEAP  ++T++DV+EPPLPPV +
Sbjct  566  QSLPPAEAPNLIITDADVIEPPLPPVTE  593



>ref|XP_006279180.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12078.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=538

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+IGKSSV     SF    TNVV +LQ S++ VYV++F NEFVSQ  DFFSD
Sbjct  361  DIKKFADAVVIGKSSVSTATRSFATRQTNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSD  420

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+ PGSLL ++SP
Sbjct  421  PTVEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPIQPGSLLGVVSP  477

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP  + T++DV EP LPPV+
Sbjct  478  LSLPPAEAPSLIFTDADVTEPHLPPVS  504



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K SVFPT +SF  G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D
Sbjct  580  DIKKFADAVVISKKSVFPTSESFTTGQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFAD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K++PPYM+PV P  LL ++SP
Sbjct  640  ATVEINSHVTGAGIN---GTITEFPLTAARYKRNSCLTRKDVPPYMIPVQPAGLLTIVSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV+
Sbjct  697  ASLPPAEAPSPVFTDADVTEPPLPPVS  723



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++KKFA++V+IGK SVFP  D+FL G TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD
Sbjct  580  DMKKFANAVVIGKDSVFPIADNFLSGQTNVVEKLQKSKLPVYVELFQNEFVSQPFDFFSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMS  410
              VE+N+Y +G   N   G IT FP TA RY+RNRCLG K IPPYM P+  G LL+ L+S
Sbjct  640  ATVEINTYTYGFGIN---GTITEFPFTAARYKRNRCLGRKVIPPYMSPIQAGILLKNLVS  696

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P  LPP +AP PV T+ DV EPPLPPV
Sbjct  697  PLSLPPTQAPSPVFTDGDVTEPPLPPV  723



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGK SVF   DSF+   TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD
Sbjct  567  DIKKFANAVVIGKESVFSLLDSFITRQTNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NSY+ GA  N   G IT FP TA RY+RNRCLG +E +PPYM P  PGSLLQ ++
Sbjct  627  PTVEINSYILGAGIN---GTITEFPFTAARYKRNRCLGTQETLPPYMAPFKPGSLLQAVN  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               +PPA+AP PV T+ DV EPPLPPV 
Sbjct  684  A--IPPAQAPNPVFTDDDVTEPPLPPVT  709



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SV P  +SF+ G TNVV +LQ S++ VY++LF NEFVSQ +DFF D
Sbjct  562  DIKKFANAVVINKDSVSPNSESFVTGQTNVVERLQKSQLPVYMELFRNEFVSQPYDFFDD  621

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ G   N   G IT FP TA RY+RNRCLG KEIPPYMLP+ PG LL +M+P
Sbjct  622  ATVEINTYISGHGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNP  678

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP P+ T  DV EPP+PPV
Sbjct  679  LALPPAQAPNPIFTYDDVTEPPVPPV  704



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I KSSVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D
Sbjct  570  DIKKFADAVVIQKSSVFPLAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFAD  629

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP
Sbjct  630  ATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSP  686

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPA+AP PV T++DV EPPLPPV 
Sbjct  687  TSLPPAQAPNPVFTDADVTEPPLPPVT  713



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I +SSVFP  D F+   TNVV +L  S++ VYV+LF NEFVSQ +DF SD
Sbjct  577  DIKKFANAVVISRSSVFPFPDGFITRQTNVVERLHKSQLSVYVELFQNEFVSQPYDFLSD  636

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NSY+ G   N   G IT FP TA RY+RNRCLG KE PPYM  V PG LL ++SP
Sbjct  637  PTVEINSYISGVGIN---GTITEFPLTAARYKRNRCLGSKETPPYMAHVDPGGLLTVVSP  693

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPA+ P PV T++DV EPPLPPV 
Sbjct  694  SSLPPAKPPNPVFTDADVTEPPLPPVT  720



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K SVFP    FL GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD
Sbjct  568  DIKDFADSVVISKISVFPESSLFLTGVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP
Sbjct  628  STVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPPAE P PVLT +DVVE PLP
Sbjct  684  YALPPAEPPNPVLTATDVVEGPLP  707



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +++I K+SVFP+  SF  G TN+V +LQ  K+ VYV +F NEFVSQ +DFFSD
Sbjct  581  DIKKFADAIVITKTSVFPSTASFTTGQTNLVERLQKLKLPVYVDVFQNEFVSQPYDFFSD  640

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA     DG IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP
Sbjct  641  ATVEINSHVTGAG---IDGAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSP  697

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV+EPPLPPV 
Sbjct  698  ASLPPAEAPNPVFTDADVIEPPLPPVT  724



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA S++I KSS+FP + +FL GVT +V+KL +  + VY  +F NEFVS AWDF+SD
Sbjct  563  DIKQFAHSLVIRKSSIFPLNSAFLTGVTKIVSKLHSFNLTVYTSVFRNEFVSSAWDFYSD  622

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NS+V GA     DGVIT FP TA  YR+NRCL   + IP YM PV PG+L Q +S
Sbjct  623  PVVEINSFVMGAG---IDGVITDFPGTAIMYRKNRCLNRGDNIPSYMRPVQPGNLFQAIS  679

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             +YLP AEAP PVLT+SDV EPPLP V K
Sbjct  680  AEYLPLAEAPSPVLTDSDVAEPPLPHVIK  708



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K+SVFPT +SF  G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D
Sbjct  571  DIKKFADAVVIRKTSVFPTSESFTTGQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFAD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV P  LL ++SP
Sbjct  631  ATVEINSHVTGAGIN---GTITDFPLTAARYKRNSCLTRKDPPPYMIPVQPAGLLTIVSP  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV+T++DV EPPLPPV 
Sbjct  688  ASLPPAEAPNPVITDADVTEPPLPPVT  714



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+IGKSSV     SF    TNVV +LQ S++ VYV++F NEFVSQ  DFFSD
Sbjct  583  DIKKFADAVVIGKSSVSTATRSFATRQTNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSD  642

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+ PGSLL ++SP
Sbjct  643  PTVEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPIQPGSLLGVVSP  699

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP  + T++DV EP LPPV+
Sbjct  700  LSLPPAEAPSLIFTDADVTEPHLPPVS  726



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 107/146 (73%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I  +SVFP   SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDFFSD
Sbjct  578  DIKKFADAVVIKTTSVFPVSASFTTGQTNLVERLQKFQLPVYVELFRNEFVSQPWDFFSD  637

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN+CL  K+ PPYM+PV P  LL ++SP
Sbjct  638  ITVEINSHVTGAGIN---GTITEFPLTAARYKRNQCLTRKDPPPYMIPVQPAGLLTIVSP  694

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  695  NSLPPAEAPNPVFTDADVTEPPLPPV  720



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K SVFP    FL GVTNVV KLQ+  + VYV+ F NEFVSQAWDFFSD
Sbjct  568  DIKDFADSVVISKISVFPESSLFLTGVTNVVPKLQSHGLSVYVETFRNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP
Sbjct  628  STVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPPAE P PVLT +DVVE PLP
Sbjct  684  YALPPAEPPNPVLTATDVVEGPLP  707



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FAS+V+I K+SVFPT D FL+G TNVV +LQ S++ VYV+LF NEFVSQ +DF SD
Sbjct  569  EIKEFASAVVITKASVFPTFDGFLMGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFLSD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G IT FP TA RYR+NRCLG KE PPYM PV PG+LLQ+++P
Sbjct  629  ATVEINSYVTGAGVN---GTITEFPFTAARYRKNRCLGSKETPPYMAPVQPGALLQVVNP  685

Query  406  QYLPPAEAPYPVLTESDV  353
              LPPAEAP PV T++DV
Sbjct  686  ASLPPAEAPNPVFTDADV  703



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA+SV+I K+SVFP   SFL GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD
Sbjct  568  DIKDFANSVVISKASVFPESSSFLSGVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G +     GVIT FP T+ RY+RNRCLGY  +P YM P  PG L+ L+ P
Sbjct  628  STVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLGYNVLPHYMSPAQPGGLMPLIPP  684

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              LPPAE P PVLT  DVVE PLP
Sbjct  685  FALPPAEPPNPVLTAPDVVEGPLP  708



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D
Sbjct  573  DIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFAD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP
Sbjct  633  ATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSP  689

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
               PPAEAP PV T++DV EPPLPPV 
Sbjct  690  TAFPPAEAPNPVFTDADVTEPPLPPVT  716



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 106/146 (73%), Gaps = 3/146 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D
Sbjct  584  DIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFAD  643

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP
Sbjct  644  ATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSP  700

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
               PPAEAP PV T++DV EPPLPPV
Sbjct  701  TAFPPAEAPNPVFTDADVTEPPLPPV  726



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D
Sbjct  573  DIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFAD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP
Sbjct  633  ATVEINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSP  689

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
               PPAEAP PV T++DV EPPLPPV 
Sbjct  690  TAFPPAEAPNPVFTDADVTEPPLPPVT  716



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +++I K SVFP+  SF  G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD
Sbjct  583  DIKKFADAIVITKKSVFPSSPSFTTGQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSD  642

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP
Sbjct  643  ATVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSP  699

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  700  ASLPPAEAPNPVFTDADVTEPPLPPVT  726



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V+I K SVF   +SF+ G TNVV +L  S++ VYV+LF NEFVSQ +DFF+D
Sbjct  583  EIKKFADAVVINKDSVFLQSESFVTGQTNVVERLHKSQLPVYVELFQNEFVSQPYDFFTD  642

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ GA  N   G IT FP TA RY+RNRCL  K+ PPYMLP+ PGSLL + + 
Sbjct  643  ATVEINSYINGAGIN---GTITEFPFTAARYKRNRCLARKDTPPYMLPIKPGSLLGVANR  699

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP  + T++DV EPPLPPV 
Sbjct  700  YLLPPAEAPSLIFTDADVSEPPLPPVT  726



>ref|XP_010433459.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=225

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA+ V+I K SVF    SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  39   DIKKFANVVVIQKLSVFRIAQSFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSD  98

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ G   N   G IT FP TA RY+RN CL  KE  PYM PV PG LL L+S 
Sbjct  99   ATVEINSYITGPGIN---GTITEFPFTAARYKRNLCLASKENIPYMAPVQPGELLTLVSS  155

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPA+AP  V T++DV+EPPLPPV 
Sbjct  156  TSLPPAQAPTQVFTDADVIEPPLPPVT  182



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DFFSD
Sbjct  580  DIKKFADAVVVGRYSLYPVSASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFFSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP
Sbjct  640  ATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +LPPAEAP PV T++D+ EPPLPPV 
Sbjct  697  TFLPPAEAPNPVFTDADITEPPLPPVT  723



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I KS+VFP + +F+ G+T VV+KLQA  +  YV LF NEFVSQAWD FSD
Sbjct  565  DIKRFAHSVAITKSNVFPVNQAFITGMTKVVSKLQAFNLTAYVYLFRNEFVSQAWDVFSD  624

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
            P VE+N++V   +    DG+I+ FP TA  YR+NRCLG  K IP YM PV PGSL+Q+++
Sbjct  625  PTVEINTFV---TLGKIDGIISDFPGTAAAYRKNRCLGMGKNIPIYMTPVQPGSLMQVIT  681

Query  409  PQYLPPAEAPYPVLTESDVVEPPLP  335
            P +LPPAEAP PVL +S+V EPP P
Sbjct  682  PDFLPPAEAPNPVLEDSNVAEPPFP  706



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+VI+ K SVF  +D FL   T +V KL A+ + V+V+ FSNEFVSQ+WDFFSD
Sbjct  570  DIKKFASAVIVSKDSVFSNNDKFLTSTTKIVPKLNAANLSVFVETFSNEFVSQSWDFFSD  629

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP-YMLPVGPGSLLQLMS  410
              VE+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P YM PV PG L  L++
Sbjct  630  ATVEINSYL-NAEGVKIDGIITDFPKTADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLIT  688

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            P +LPP EAP P LTES+V EP LPPV KI
Sbjct  689  PGFLPPTEAPLPPLTESEVAEPALPPVVKI  718



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  +SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKKFANAVVIQKPSVFPLAESFITQQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+FG   N   G IT FP TA RY+RN CL  K+  PYM PV PG+LL L+S 
Sbjct  631  ATVEINSYIFGPGIN---GTITEFPFTAARYKRNLCLSSKDNVPYMAPVQPGALLALVSS  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV T++DV EPPLPPV 
Sbjct  688  ASLPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+I K SVFP +++FL GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD
Sbjct  573  DIKSFASAVVISKDSVFPENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+NS+  G   N   GVIT FP T++R+  NRCL   +  P YM PV PGSLLQL++
Sbjct  633  ATVEVNSFHVGGLIN---GVITDFPETSDRW--NRCLNKGDNTPGYMSPVQPGSLLQLVT  687

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  688  AEYLPPAEAPNPYLTEADIAESPLPPVA  715



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 108/146 (74%), Gaps = 5/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA+SV++GK SVFP  ++F  G T+VV KLQ S + VYV+LF NEFVSQ +DFFSD
Sbjct  568  DIKKFANSVVVGKKSVFPLSEAFTTGQTDVVTKLQKSLLPVYVELFQNEFVSQPYDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G IT FP TA RY++NRCLG KE PPY  PV  G+L+ L + 
Sbjct  628  ATVEINSYVRGAGVN---GTITEFPLTAARYKKNRCLGLKEPPPYSSPVQAGALVSLATA  684

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPAEAP PV T++DV EPPLPPV
Sbjct  685  --LPPAEAPNPVFTDADVTEPPLPPV  708



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD
Sbjct  580  DIKKFADAVVVGRFSLYPISASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP
Sbjct  640  ATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCMARKDTPVYMIPVRPAGLLEIVSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +LPPAEAP PV T++DV EPPLPPV 
Sbjct  697  TFLPPAEAPNPVFTDADVTEPPLPPVT  723



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD
Sbjct  580  DIKKFADAVVVGRFSLYPISASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP
Sbjct  640  ATVEINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSP  696

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +LPPAEAP PV+T++DV EPPLPPV 
Sbjct  697  TFLPPAEAPNPVITDADVTEPPLPPVT  723



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 110/150 (73%), Gaps = 8/150 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPT-DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V+IGK +VFP  DD F++  TNVV KL  SK+ VYV++F NEFVSQ +DFFS
Sbjct  571  DIKKFANAVVIGKETVFPLFDDGFIIRQTNVVEKLHKSKLPVYVEVFQNEFVSQPFDFFS  630

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE--IPPYMLPVGPGSLLQL  416
            DP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE   PPYM PV PG  L L
Sbjct  631  DPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKESLAPPYMSPVRPGFFLNL  687

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            ++   +PPA+AP PV T+ DV EPPLPPV 
Sbjct  688  VNA--IPPAQAPNPVFTDDDVTEPPLPPVT  715



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 104/149 (70%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I K+SVFPT+  FL G TN+V+KL +S + VYV +F NE++SQAWDF+SD
Sbjct  568  DIKQFAHSVAITKNSVFPTNKLFLTGATNIVSKLHSSNLTVYVHVFHNEYLSQAWDFWSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
            P  E+N++V GA     DG+IT FP TAN YR NRCL      P YM PV P  LL L +
Sbjct  628  PNFEINNFVMGAR---IDGIITDFPGTANAYRNNRCLKMGNRKPRYMNPVLPNGLLSLGN  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            P  LP  EAP PVLTESDV EPPLP V K
Sbjct  685  PALLPSVEAPNPVLTESDVAEPPLPSVTK  713



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 106/149 (71%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGKSSVFP    FL G T VV +LQ S+++VYV+LF NEFVSQ  D F D
Sbjct  478  DIKKFANAVVIGKSSVFPATKRFLTGQTAVVERLQKSQLQVYVELFENEFVSQKLDSFYD  537

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMS  410
              +E+N+Y +G   N   G IT +P TA RY+RNRCLG K IPPYM  + PG LL  L+S
Sbjct  538  ATIEINTYTYGFGIN---GTITEYPFTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVS  594

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            P  LPPAEAP  V T  DV EPPLPPVAK
Sbjct  595  PLSLPPAEAPNLVFTNVDVSEPPLPPVAK  623



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 106/147 (72%), Gaps = 5/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA+SV + K SVF     F  G T+VV KLQ  +V VYV+LF NEFVSQ +DFFSD
Sbjct  578  DIKKFANSVTLTKQSVFSLGGPFTTGQTDVVTKLQKLQVPVYVELFRNEFVSQPFDFFSD  637

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NSYV GA  N   G IT FP TA RY+RNRCLG++E P Y  PV PGSLL L + 
Sbjct  638  PTVEINSYVNGAGVN---GTITEFPLTAARYKRNRCLGFRETPSYSSPVQPGSLLTLATA  694

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPPAEAP PV +++DV EPPLPPVA
Sbjct  695  --LPPAEAPNPVFSDADVTEPPLPPVA  719



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA++V+I K+SVFP  D+FL G TNVV KLQ S++ VYV+LF NEFVSQ +DFF+D 
Sbjct  618  IKKFANAVVINKASVFPIADNFLSGQTNVVEKLQKSQLPVYVELFQNEFVSQPFDFFTDA  677

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-P  407
             VE+NSY+ GA  N   G IT FP TA RY++NRCL  ++IPPYM P  PG +L+L+S  
Sbjct  678  TVEINSYISGAGIN---GTITEFPXTAARYKKNRCLRRQDIPPYMSPFEPGGVLKLVSRS  734

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP PV T+ DV E PLPPV
Sbjct  735  NSLPPAQAPSPVFTDGDVTESPLPPV  760



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 111/150 (74%), Gaps = 8/150 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPT-DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V+I K+SVFP  DD F++  TNVV KL  SK+ VYV+LF NEFVSQ +DFFS
Sbjct  570  DIKKFANAVVIVKTSVFPLFDDGFIIRQTNVVEKLHKSKLPVYVELFQNEFVSQPFDFFS  629

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPP-YMLPVGPGSLLQL  416
            DP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE IPP YM PV PG  L L
Sbjct  630  DPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKETIPPQYMSPVPPGLFLNL  686

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            ++   +PPA+AP PV T+ DV EPPLPPV 
Sbjct  687  VNA--IPPAQAPNPVFTDDDVTEPPLPPVT  714



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA++V+I K+SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D 
Sbjct  599  IKKFANAVVINKASVFPDSDSFLTGQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTDA  658

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-P  407
             VE+NSY+ GA  N   G IT FP TA RY++NRCL  + IPPYM P  PG +L+L++  
Sbjct  659  TVEINSYISGAGIN---GTITEFPYTAARYKKNRCLRRQHIPPYMSPFEPGGVLKLVNRS  715

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              LPPA+AP  V T+SDV E PL PV
Sbjct  716  NSLPPAQAPSSVFTDSDVTESPLSPV  741



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP   +F+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKKFANAVVIQKLSVFPVAQAFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P  PG+LL L+S 
Sbjct  631  PTVEINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPAQPGALLTLVSS  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              LPPA+AP P+ T++DV EPPLPPV +
Sbjct  688  TSLPPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSD
Sbjct  574  DIKKFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSD  633

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++
Sbjct  634  PTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLIT  690

Query  409  PQYLPPAEAPYPVLTESDVVE  347
              YLPPAEAP P+LTE+ V E
Sbjct  691  SDYLPPAEAPNPILTEAAVTE  711



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSD
Sbjct  574  DIKKFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSD  633

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++
Sbjct  634  PTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLIT  690

Query  409  PQYLPPAEAPYPVLTESDVVE  347
              YLPPAEAP P+LTE+ V E
Sbjct  691  SDYLPPAEAPNPILTEAAVTE  711



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSD
Sbjct  621  DIKKFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSD  680

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++
Sbjct  681  PTVEINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLIT  737

Query  409  PQYLPPAEAPYPVLTESDVVE  347
              YLPPAEAP P+LTE+ V E
Sbjct  738  SDYLPPAEAPNPILTEAAVTE  758



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 3/138 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FAS+V+I K SVFPT   F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  568  EIKEFASAVVITKVSVFPTFYGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G IT FP TA RYRRN+CLG KE  PYM PV PG LL+++SP
Sbjct  628  ATVEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSKETLPYMAPVQPGGLLEVVSP  684

Query  406  QYLPPAEAPYPVLTESDV  353
              LPPAEAP PV T++DV
Sbjct  685  ASLPPAEAPNPVFTDADV  702



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+IGKSSVFP    F+ G T VV +LQ S+++VYV+LF NEFVSQ  D+F D
Sbjct  584  DIKKFANAVVIGKSSVFPATKRFVTGQTAVVERLQKSQLQVYVELFQNEFVSQKLDWFYD  643

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM--  413
              VELN+Y +GA  N   G IT FP TA +Y+RNRCLG K IPPYM  + PG+LL ++  
Sbjct  644  ATVELNTYTYGAGIN---GTITEFPFTAAKYKRNRCLGRKVIPPYMSAIQPGNLLNILVS  700

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            SP + PPA+AP  V T +DV E PLPPVAK
Sbjct  701  SPAF-PPAQAPNLVFTNADVSEAPLPPVAK  729



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  571  DIKKFANAVVIQKLSVFPVAQSFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P  PG+LL L+S 
Sbjct  631  ATVEINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPAQPGALLTLVSS  687

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              LPPA+AP P+ T++DV EPPLPPV +
Sbjct  688  TSLPPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 108/151 (72%), Gaps = 5/151 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVG-VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA SV++ K SVFP D +FL   +T  V KL+AS + V+V+ FSNEFVSQAWDFFS
Sbjct  567  DIKSFAGSVVVDKVSVFPRDVAFLTSSLTRTVPKLKASNLSVFVETFSNEFVSQAWDFFS  626

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLM  413
            DP VE+NS++  A     DGVIT FP TANRY RN+CL   + +PPYM PV  GSL  ++
Sbjct  627  DPIVEINSFIQEAG---IDGVITDFPKTANRYSRNKCLNLGDKVPPYMQPVQAGSLYGII  683

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
              + LPPA AP P LT S+VVEPPLPPV KI
Sbjct  684  PSESLPPALAPLPSLTNSEVVEPPLPPVTKI  714



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
             IK FA +VI+ K+S+FP+D  FL+  T+VV +  + K+ VYV++  NEF+SQA+DFFSD
Sbjct  567  NIKSFADAVIVSKASIFPSDGGFLIAATDVVKQFHSHKLPVYVRVLRNEFISQAYDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NSYV GA     DGVIT FP TA +Y+RN CL  K IP YM PV P  L+ LM+P
Sbjct  627  PIVEINSYVMGAEV---DGVITDFPKTAAQYKRNSCLKMKNIPAYMSPVQPNQLMALMNP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              +PPA AP P+L  SDV E PLP
Sbjct  684  ALMPPASAPQPLLDVSDVSESPLP  707



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  +SFL   TNVV +L+ S++ VYV+LF NEFVSQ +DFF+D
Sbjct  581  DIKKFANAVVINKDSVFPNSESFLTKQTNVVERLKKSQLTVYVELFRNEFVSQPYDFFAD  640

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y+ GA  +   G IT FP TA RY+RNRCLG KEIPPYMLP+ PG LL +M+P
Sbjct  641  ATVEINTYISGAGVS---GTITEFPFTAARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNP  697

Query  406  QYLPPAEAPYP  374
              LPPA+AP P
Sbjct  698  LALPPAQAPNP  708



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K+SVFP  ++FLV  TN V + Q+ K+ VYV+ FSNEFVSQAWD++SD
Sbjct  560  DIKTFADSVVIQKASVFPQSEAFLVNSTNTVERFQSFKLSVYVETFSNEFVSQAWDYYSD  619

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
             +VE+NS+V GA  N   G+IT FP TA RY +N+CL ++   PY  P+ PG LL+ ++ 
Sbjct  620  AFVEINSFVIGAKVN---GIITDFPKTAARYTKNKCLKHRNKAPYTRPIEPGKLLKQITQ  676

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             YLP    P P+L +++V EPPLP V++
Sbjct  677  LYLPAPVPPLPILNDNNVTEPPLPSVSR  704



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD
Sbjct  568  DIKSFASSVVVNKDSVIPNNNKFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PG L  L++
Sbjct  628  PTVEINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLIT  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             ++LPPAEAP P LTES+V E PLPPVAKI
Sbjct  685  KEFLPPAEAPLPPLTESEVAESPLPPVAKI  714



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD
Sbjct  568  DIKSFASSVVVNKDSVIPNNNLFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
            P VE+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PG L  L++
Sbjct  628  PTVEINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLIT  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             ++LPPAEAP P LTES+V E PLPPVAKI
Sbjct  685  KEFLPPAEAPLPPLTESEVAESPLPPVAKI  714



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+VI+ K SVF  +D FL G T  V KL A+K+ V+V+ FSNEFVSQAWDF SD
Sbjct  565  DIKKFASAVIVNKESVFSINDKFLTGTTKTVPKLNAAKLSVFVETFSNEFVSQAWDFLSD  624

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP-YMLPVGPGSLLQLMS  410
              VE+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P YM PV PG L  L+S
Sbjct  625  ATVEINSYL-NAEGIKIDGIITDFPKTADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLIS  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            P +LPPAEAP P LTES+V EP LPPVAKI
Sbjct  684  PDFLPPAEAPLPPLTESEVAEPALPPVAKI  713



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 102/151 (68%), Gaps = 5/151 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA SV++ + SV+P +  F V G T  V+K ++  + VYVQ F NEFVSQAWDF S
Sbjct  479  DIKTFAHSVVVVRDSVYPRNALFFVTGSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLS  538

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLM  413
            D  V++N++V  A     DGVITGFP TANRYRRNRCL   +  PPYM PV  G L QL+
Sbjct  539  DATVQINTFVQDAG---IDGVITGFPQTANRYRRNRCLNLGDSTPPYMRPVEIGGLFQLV  595

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
                LPPA AP P LTE+DV EPPL P +KI
Sbjct  596  DKSSLPPAMAPAPSLTEADVTEPPLAPFSKI  626



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 104/149 (70%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FA +V I + SV+P    F    T++V+KLQ + + VYV LF NEFV+Q WDFFSD
Sbjct  573  EIKEFADAVAIDRQSVYPVTQQFTTRQTDIVSKLQNAGLAVYVYLFQNEFVAQPWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              VE+N+YV GA     DG+IT FPATA+ Y+RN C  +G K  P YM P   G LLQL+
Sbjct  633  ATVEINTYVQGAGV---DGIITDFPATASTYKRNSCRKMG-KNAPSYMSPAQGGGLLQLI  688

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            SPQ LPPA +P PVL  SDVVEPPLPPVA
Sbjct  689  SPQSLPPALSPMPVLDVSDVVEPPLPPVA  717



>ref|XP_006603452.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=425

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 103/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FS+EFVS AWDFF+D
Sbjct  240  DIKSFASSVVVNKDSVIPNNNQFLTTYTNIVPKLKIANLLVFVETFSSEFVSPAWDFFAD  299

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N+Y+ GA     DG+IT FP   +RYRRN+CLG  +  P YM PV  G +  L++
Sbjct  300  ATVEINTYIEGAQ---IDGIITNFPKIVDRYRRNKCLGLGDNKPTYMEPVQSGGIFGLIT  356

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PP EA +P L ES V EPPLPPVAKI
Sbjct  357  KELFPPVEATFPPLIESKVAEPPLPPVAKI  386



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 102/138 (74%), Gaps = 3/138 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIK+FAS+V+I K SVFPT   F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD
Sbjct  570  EIKEFASAVVITKVSVFPTFYGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSD  629

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV GA  N   G IT FP TA RYRRN+CLG  E  PYM PV PG LL++++P
Sbjct  630  ATVEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSIETLPYMAPVQPGGLLEVVNP  686

Query  406  QYLPPAEAPYPVLTESDV  353
              LPPAEAP  V T++DV
Sbjct  687  ASLPPAEAPNSVFTDADV  704



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 102/151 (68%), Gaps = 5/151 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA SV++ + SV+P +  F V G T  V+K ++  + VYVQ F NEFVSQAWDF S
Sbjct  574  DIKTFAHSVVVVRDSVYPRNALFFVTGSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLS  633

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLM  413
            D  V++N++V  A     DGVITGFP TANRYRRNRCL   +  PPYM PV  G L QL+
Sbjct  634  DATVQINTFVQDAG---IDGVITGFPQTANRYRRNRCLNLGDSTPPYMRPVEIGGLFQLV  690

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
                LPPA AP P LTE+DV EPPL P +KI
Sbjct  691  DKSSLPPAMAPAPSLTEADVTEPPLAPFSKI  721



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 102/148 (69%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+I K SVFP + +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSD
Sbjct  417  DIKSFASAVVISKDSVFPENSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSD  476

Query  586  PYVELNSYVFGASANPFDGVITGFPATA-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            P VE+NS+  G   N   GVIT FP T+    R        +IP YM PV PGSL  L++
Sbjct  477  PTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLIT  533

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  534  APYLPPAEAPNPFLTEADVNEPPLPPVA  561



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F+VG T +V  L+++ + VYV L  NEFVSQ WDF SD
Sbjct  543  DIKQFAHSVAVSKQSIFPETWKFVVGQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSD  602

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM
Sbjct  603  PTVEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLM  658

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +P+ LPPA AP PVL  SDVVEPPLPP ++
Sbjct  659  APEALPPALAPMPVLEVSDVVEPPLPPASQ  688



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 105/147 (71%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K SVFP +  F+ G TN V KLQAS + V+V+ FSNEFVSQAWDFFSD
Sbjct  575  DIKTFAGSVVINKDSVFPQNSGFITGATNTVPKLQASNLSVFVETFSNEFVSQAWDFFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NSY+ GA     DGVIT FP TA+RY RN+CL   K  PPYM  V  G L  ++S
Sbjct  635  STVEINSYIQGAG---IDGVITDFPKTASRYSRNKCLNLGKNTPPYMEAVETGGLYSIIS  691

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            PQ LPPA AP P LT+S+VVEPPLP V
Sbjct  692  PQSLPPALAPIPPLTKSEVVEPPLPSV  718



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F+VG T +V  L+++ + VYV L  NEFVSQ WDF SD
Sbjct  578  DIKQFAHSVAVSKQSIFPETWKFVVGQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSD  637

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM
Sbjct  638  PTVEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLM  693

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +P+ LPPA AP PVL  SDVVEPPLPP ++
Sbjct  694  APEALPPALAPMPVLEVSDVVEPPLPPASQ  723



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+IGK SVFP   +FLV  TN+VAKL++ K++VYV+ FSNEFVSQAWD++SD
Sbjct  565  DIKTFADSVVIGKKSVFPETSAFLVNSTNIVAKLKSFKLRVYVETFSNEFVSQAWDYYSD  624

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              +E+NS+V G   N   G+IT FP TANRYRRN CL      PYM P+ PG L Q +S 
Sbjct  625  ASIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNVNKAPYMSPIEPGKLYQQISD  681

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +LPP   P PVL +S+V E PLP V+
Sbjct  682  FFLPPLPPPPPVLIDSNVTEAPLPSVS  708



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 102/148 (69%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FAS+V+I K SVFP + +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSD
Sbjct  573  DIKSFASAVVISKDSVFPENSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATA-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            P VE+NS+  G   N   GVIT FP T+    R        +IP YM PV PGSL  L++
Sbjct  633  PTVEINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLIT  689

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  690  APYLPPAEAPNPFLTEADVNEPPLPPVA  717



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 101/149 (68%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F+VG T +V  L+++ + V+V L  NEFVSQ WDFFSD
Sbjct  579  DIKQFAHSVAVSKQSIFPESQQFVVGQTELVKNLKSAGLNVHVYLLMNEFVSQPWDFFSD  638

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+N YV GA A   DG+IT FP TA  YRRN C  LG K  P YMLPV  G LL+LM
Sbjct  639  PIVEINQYVQGAGA---DGIITDFPGTATAYRRNACSKLGDKA-PNYMLPVQVGGLLELM  694

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
             P  LPPA +P PVL  SDVVEPPL P +
Sbjct  695  VPDALPPALSPMPVLEVSDVVEPPLMPAS  723



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA+SV++ K+SVFP   SFL+ VTNVV KL    + VYV+ FSNEFVSQAWDFFSD
Sbjct  568  DIKDFANSVVVSKASVFPKSSSFLIRVTNVVPKLILHGLSVYVETFSNEFVSQAWDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PGSL++L+SP
Sbjct  628  STVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGSLMELISP  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLP  335
              +PPAE P PVLT SDV E PLP
Sbjct  684  AAMPPAEPPNPVLTASDVTEGPLP  707



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F++G T +V KL+++ + VYV L  NEFVSQ WDF SD
Sbjct  468  DIKQFAHSVAVSKQSIFPESLKFVIGQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSD  527

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P  E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+PV  G LL LM
Sbjct  528  PTAEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLM  583

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +P+ LPPA AP PVL  SDV EPPLPP ++
Sbjct  584  APESLPPALAPMPVLEVSDVAEPPLPPASR  613



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 101/149 (68%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F++  T +V KL+++ + VYV L  NEFVSQ WDFFSD
Sbjct  579  DIKQFAHSVAVSKQSIFPESQQFVIEQTELVNKLKSAGLNVYVYLLMNEFVSQPWDFFSD  638

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM
Sbjct  639  PIVEINQYVQGAYV---DGIITDFPGTAAAYKRNACSKLGDKA-PNYMLPVQVGGLLGLM  694

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            +P+ LPPA AP PVL  SDVVEPPL P +
Sbjct  695  TPEALPPALAPMPVLEASDVVEPPLMPAS  723



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SVI+ KSSV+P +D FL G T +V K ++S + VYV+ FSNEFVS AWDF SD
Sbjct  574  DIKRFAHSVILHKSSVYPLNDFFLTGSTKIVPKFKSSNISVYVETFSNEFVSSAWDFLSD  633

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N++V  A     DGVIT FP TANRYRRN+CL   E  PPYM PV  G L + ++
Sbjct  634  STVEINTFVQDAE---IDGVITDFPKTANRYRRNKCLNLGENTPPYMKPVQVGGLFKQIA  690

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LTE +V EPPLP V+KI
Sbjct  691  KYSLPPAVAPAPALTEDEVTEPPLPSVSKI  720



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
             IK+FA SV++ K+SV+P  + F +G T +V+K ++S + VYV+ FSNEFVSQ WDF SD
Sbjct  578  NIKRFAHSVVVKKASVYPVSELFAIGSTKIVSKFKSSNLSVYVETFSNEFVSQDWDFMSD  637

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
             YVE+N++V  A     DGVIT FP TANRYRRN+CL   E  P YM PV  G LLQ M 
Sbjct  638  AYVEINTFVQDAE---IDGVITDFPKTANRYRRNKCLNLGEKTPAYMEPVAVGGLLQAMD  694

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LTE +V EPPLPP++KI
Sbjct  695  KSLLPPAMAPAPPLTEDEVTEPPLPPLSKI  724



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV + K S+FP    F++G T +V KL+++ + VYV L  NEFVSQ WDF SD
Sbjct  580  DIKQFAHSVAVSKQSIFPESLKFVIGQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSD  639

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P  E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+PV  G LL LM
Sbjct  640  PTAEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLM  695

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +P+ LPPA AP PVL  SDV EPPLPP ++
Sbjct  696  APESLPPALAPMPVLEVSDVAEPPLPPASR  725



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV+I K+SV+P +  ++   TN+V KLQASK+ V+V+ FSNEFVSQA+DFFSD
Sbjct  568  DIKTFASSVVINKNSVYPQNAGYVTTKTNIVEKLQASKLSVFVETFSNEFVSQAFDFFSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+NS++ GA  N   GVIT FP TA+RY RN+CL      PPYM PV  GSL  ++S
Sbjct  628  STVEINSFIQGAGIN---GVITDFPKTAHRYSRNKCLNLGNSTPPYMQPVEAGSLFGVIS  684

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LT+ +VVEPPLPPVAKI
Sbjct  685  NTSLPPAMAPLPPLTKDEVVEPPLPPVAKI  714



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA  + I K SV+P    F+ G T +V KLQ++   VYV LF NEFVSQ WDF SD
Sbjct  586  DIKQFAHMIAISKQSVYPVSQQFITGQTKLVQKLQSAGFAVYVYLFRNEFVSQPWDFLSD  645

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+N YV GA+    DG+IT +P TA  YRRN C  LG  + P YM PV  G LLQ+M
Sbjct  646  PTVEINMYVQGAAV---DGIITEYPGTAAAYRRNTCSKLG-DQAPSYMSPVPIGGLLQIM  701

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
             PQ LPP  AP P L  +DVVEPPLP V+
Sbjct  702  DPQALPPTLAPMPSLHAADVVEPPLPAVS  730



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL   TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D
Sbjct  560  DIKKFANAVVINKVSVFPNSDSFLSKHTNVVERLQKSQLPVYVELFQNEFVAQAYDFFAD  619

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+ PG LL ++SP
Sbjct  620  ATVEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSP  676

Query  406  QY  401
             +
Sbjct  677  LF  678



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA +V+IGK+SVFP   +FLV  TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SD
Sbjct  549  DIKTFADAVVIGKASVFPESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSD  608

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P +E+NS+V G   N   G+IT FP TANRYRRN CL +    PYM P+ PG L + +S 
Sbjct  609  PSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISN  665

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P P+LT+S+V E PLP V+
Sbjct  666  LYLPPLPPPLPILTDSNVTEAPLPGVS  692



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 107/148 (72%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+I K SVFP +  F++G TN V KL+AS + V+V+ FSNEFVSQAWDFFSD
Sbjct  576  DIKTFAGSVVINKGSVFPHNGDFIMGATNTVPKLKASNLSVFVETFSNEFVSQAWDFFSD  635

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              VE+NS++ GA     DGVIT FP TA+RY RN+C  LG K  PPYM  V  G L  ++
Sbjct  636  STVEINSFIQGAG---IDGVITDFPKTASRYSRNKCXNLG-KNTPPYMEAVETGGLYSII  691

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPV  329
            SPQ LPPA AP P LT+S+VVEPPLP V
Sbjct  692  SPQSLPPALAPIPPLTKSEVVEPPLPSV  719



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA +V+IGK+SVFP   +FLV  TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SD
Sbjct  562  DIKTFADAVVIGKASVFPESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSD  621

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P +E+NS+V G   N   G+IT FP TANRYRRN CL +    PYM P+ PG L + +S 
Sbjct  622  PSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISN  678

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P P+LT+S+V E PLP V+
Sbjct  679  LYLPPLPPPLPILTDSNVTEAPLPGVS  705



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA++V+I K SVFP  DSFL   TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D
Sbjct  583  DIKKFANAVVINKVSVFPNSDSFLSKHTNVVERLQKSQLPVYVELFQNEFVAQAYDFFAD  642

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+ PG LL ++SP
Sbjct  643  ATVEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSP  699

Query  406  QY  401
             +
Sbjct  700  LF  701



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 108/148 (73%), Gaps = 6/148 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK  A SV++ KSSVFP +  FL G+T+VV +L  S + VYV+ FSNEFVSQAWDFFSD
Sbjct  571  DIKTVADSVVVSKSSVFPDNALFLTGITDVVPRLTKSGLPVYVETFSNEFVSQAWDFFSD  630

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              VE+N++V  A+ +   G+IT FP TA RY+RNRCL   K +P YM PV  G L+QL++
Sbjct  631  ATVEINTFVVEANVS---GIITDFPKTAARYKRNRCLNLGKNMPSYMRPVEAGGLMQLIA  687

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               LPPAEAP PVLTESDV+EPPLP V 
Sbjct  688  N--LPPAEAPNPVLTESDVMEPPLPSVT  713



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+IGK+SVFP   +FLV  TN VA+L++ K+ VYV+ FSNEFVSQAWD++SD
Sbjct  562  DIKTFADSVVIGKASVFPESSAFLVNSTNTVARLKSFKLPVYVETFSNEFVSQAWDYYSD  621

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P +E+NS+V G   N   G+IT FP TANRYRRN CL      PY  P+ PG L + +S 
Sbjct  622  PSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISN  678

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P PVLT+S+V E PLP V+
Sbjct  679  LYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV+IGK+SVFP   +FLV  TN VA+L++ K+ VYV+ FSNEFVSQAWD++SD
Sbjct  562  DIKTFADSVVIGKASVFPESSAFLVNSTNTVARLKSFKLPVYVETFSNEFVSQAWDYYSD  621

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P +E+NS+V G   N   G+IT FP TANRYRRN CL      PY  P+ PG L + +S 
Sbjct  622  PSIEINSFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISN  678

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             YLPP   P PVLT+S+V E PLP V+
Sbjct  679  LYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 98/138 (71%), Gaps = 6/138 (4%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA++V+I K +VF   DSF+   TNVV KLQ S + VYV+LF NEFVSQ +DFF+DP
Sbjct  607  IKKFANAVVIRKETVFSLFDSFITTQTNVVKKLQKSWLPVYVELFQNEFVSQPYDFFADP  666

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSP  407
             VE+NSY+ GA      G I  FP TA RY+RNRCLG KE +PPYM PV PG LL  ++ 
Sbjct  667  TVEINSYITGAG---ISGTIIEFPFTAARYKRNRCLGTKEPLPPYMSPVLPGGLLPFLNA  723

Query  406  QYLPPAEAPYPVLTESDV  353
            +  PPA+AP PV TE DV
Sbjct  724  K--PPAQAPNPVFTEEDV  739



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 97/149 (65%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I   S++P    F+   T++V KL    + VYV L  NEFVSQ WDFFSD
Sbjct  488  DIKEFADSVAIDTDSIYPETQLFIATQTDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSD  547

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              V++NS+  GA     DG+IT FP TA  Y+RN C  LG + +P +M PV PG+LLQL+
Sbjct  548  ATVQINSFFKGAEV---DGIITDFPGTARTYKRNSCRNLGSR-MPVFMEPVEPGALLQLI  603

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
                 PPA AP PVL  SDVVEPPLPPVA
Sbjct  604  PAASQPPALAPMPVLNVSDVVEPPLPPVA  632



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ F NEFVSQAWDF SD
Sbjct  574  DIKRFAHSVVVKKASVYPVSKFFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSD  633

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMS  410
              VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV  GSLL  M 
Sbjct  634  ATVEINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMD  690

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LTE+ V EPPLPP++KI
Sbjct  691  KYSLPPALAPAPPLTEAKVTEPPLPPLSKI  720



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +I  FA++V + K S++P ++ F    T +V KLQA+ + VYV +  NEFVSQ WDF SD
Sbjct  568  DIDAFANAVALRKESIYPVNNLFTTEQTGLVPKLQAAGLDVYVYVLLNEFVSQPWDFLSD  627

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              VE+N+YV GA     DG+IT FP TA+RY+RN C  LG K+ P YMLP+  G LL LM
Sbjct  628  ATVEINAYVVGAGV---DGIITDFPRTASRYKRNSCSKLGSKK-PNYMLPIEAGQLLPLM  683

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            +P   PPA AP PVL  SDVVEPP P V 
Sbjct  684  APAVQPPALAPMPVLNASDVVEPPFPQVT  712



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 97/149 (65%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I   S++P    F+   T++V KL    + VYV L  NEFVSQ WDFFSD
Sbjct  573  DIKEFADSVAIDTDSIYPETQLFIATQTDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              V++NS+  GA     DG+IT FP TA  Y+RN C  LG + +P +M PV PG+LLQL+
Sbjct  633  ATVQINSFFKGAEV---DGIITDFPGTARTYKRNSCRNLGSR-MPVFMEPVEPGALLQLI  688

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
                 PPA AP PVL  SDVVEPPLPPVA
Sbjct  689  PAASQPPALAPMPVLNVSDVVEPPLPPVA  717



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV++ K+SVF  + +FLV  TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SD
Sbjct  564  DIKTFADSVVLQKASVFTQNLAFLVNSTNTVARLQSFKLPVYVETFSNEFVSQAWDYYSD  623

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+ P+ PG LL+ +  
Sbjct  624  PSVEINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPK  680

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPP   P PVL +S+V EPPLP V+
Sbjct  681  LDLPPPTPPLPVLNDSNVTEPPLPSVS  707



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA SV++ K+SVF  + +FLV  TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SD
Sbjct  587  DIKTFADSVVLQKASVFTQNLAFLVNSTNTVARLQSFKLPVYVETFSNEFVSQAWDYYSD  646

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P VE+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+ P+ PG LL+ +  
Sbjct  647  PSVEINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPK  703

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
              LPP   P PVL +S+V EPPLP V+
Sbjct  704  LDLPPPTPPLPVLNDSNVTEPPLPSVS  730



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ F NEFVSQAWDF SD
Sbjct  574  DIKRFAHSVVVKKASVYPVSKFFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSD  633

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMS  410
              VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV  GSLL  M 
Sbjct  634  ATVEINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMD  690

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
               LPPA AP P LTE+ V EPPLPP++K
Sbjct  691  KYSLPPALAPAPPLTEAKVTEPPLPPLSK  719



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 95/147 (65%), Gaps = 9/147 (6%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V++ + SV+ T + FL G T++V KL    + VYV+ F NEFVSQ WDFFSD
Sbjct  536  EIKKFADAVVVSRLSVYSTRNFFLTGQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSD  595

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+YV GA  +   G IT FP TA RY+RNRCL  K+ PPYM  V P  LL  ++ 
Sbjct  596  ATVEINTYVAGAGVS---GTITEFPLTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN-  651

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
                  ++P+P  T  DV EPPLPPV 
Sbjct  652  -----HDSPHPAFTADDVTEPPLPPVT  673



>gb|ACF74306.1| putative glycerophosphoryl diesterphosphodiesterase 2 precursor 
[Arachis hypogaea]
Length=191

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 5/142 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTD-DSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA+SV++ K SV+PT+ D FL   TN+V  L  + + VY Q FSNEFVSQAWDFFS
Sbjct  2    DIKSFANSVVLQKKSVYPTNSDLFLTVSTNIVTTLHHANLSVYAQTFSNEFVSQAWDFFS  61

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLM  413
            DP VE+N++V        DGVIT FP TA+RYRRN+CL   + +P YMLPV  G LLQ +
Sbjct  62   DPTVEINTFV---QEGLVDGVITDFPKTADRYRRNKCLTMGDNMPVYMLPVQIGGLLQAV  118

Query  412  SPQYLPPAEAPYPVLTESDVVE  347
            +  YLPPA AP P L ES+V E
Sbjct  119  TKDYLPPASAPLPPLKESEVKE  140



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ FSNEFVSQAWDF SD
Sbjct  478  DIKRFAHSVVVKKASVYPDRKQFVTGSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSD  537

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV    LL  + 
Sbjct  538  ATVEINTFVKDAG---IDGVITDFPKTANRYRRNRCLNLGDRKPPYMKPVQLPGLLSKID  594

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LTE++V EPPLPP++KI
Sbjct  595  NFSLPPALAPVPPLTEAEVTEPPLPPLSKI  624



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ FSNEFVSQAWDF SD
Sbjct  573  DIKRFAHSVVVKKASVYPDRKQFVTGSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV    LL  + 
Sbjct  633  ATVEINTFVKDAG---IDGVITDFPKTANRYRRNRCLNLGDRKPPYMKPVQLPGLLSKID  689

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
               LPPA AP P LTE++V EPPLPP++KI
Sbjct  690  NFSLPPALAPVPPLTEAEVTEPPLPPLSKI  719



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 11/148 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVT--NVVAKLQASKVKVYVQLFSNEFVSQAWDFF  593
            +IK FA SV+I K SVFPT+D F++     +V  +L+ S ++VYV+ FSNEF+SQ +DFF
Sbjct  555  DIKNFAGSVVISKKSVFPTNDGFVIHKKGPDVTQRLKNSGLRVYVETFSNEFISQPFDFF  614

Query  592  SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM  413
            SDP +E++ +V G      DG+IT FPAT  RYR+N+C  Y ++ P    VG G L+   
Sbjct  615  SDPTLEIDCFVKGI---KIDGIITDFPATTARYRKNQC--YSKLNP----VGTGELITFG  665

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPV  329
            +P +  PA+APYP L +SDV EPPLP V
Sbjct  666  NPMFFGPAKAPYPFLNDSDVTEPPLPEV  693



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 13/147 (9%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V++ + SV+     FL G T++V KL    + VYV+ F NEFVSQ WDFFSD
Sbjct  451  EIKKFADAVVVSRRSVY----FFLSGQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSD  506

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N+YV GA  N   G IT FP TA RY+RNRCL  K+ PPYM  V P  LL  ++ 
Sbjct  507  ATVEINTYVAGAGVN---GTITEFPLTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN-  562

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPVA  326
                  ++P+P  T  DV EPPLPPV 
Sbjct  563  -----HDSPHPAFTADDVTEPPLPPVT  584



>ref|XP_002523503.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF38842.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=753

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V + ++S+ PT++ + V  TNVV ++ A+ + VYV L  NEF +  +DFFSD
Sbjct  564  EIKKFADAVNLPRTSLVPTNNGYAVTTTNVVHEMHAANLTVYVSLLRNEFATLPFDFFSD  623

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P VE+ +Y+ G  A   DG+IT +PATA+RY RN C  L Y ++P  +LP+ P  LLQ +
Sbjct  624  PTVEIATYIAGLEA---DGIITEYPATASRYLRNVCSNLNY-DLPFTVLPIEPPLLLQFI  679

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + + LPPA AP PVL  +DVV+PPLP VAK
Sbjct  680  NSEMLPPAAAPSPVLDVADVVDPPLPAVAK  709



>gb|KHN41389.1| Putative glycerophosphoryl diester phosphodiesterase 3, partial 
[Glycine soja]
Length=245

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 88/129 (68%), Gaps = 4/129 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FS+EFVS AWDFF+D
Sbjct  119  DIKSFASSVVVNKDSVIPNNNQFLTTYTNIVPKLKIANLLVFVETFSSEFVSPAWDFFAD  178

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N+Y+ GA     DG+IT FP   +RYRRN+CLG  +  P YM PV PG +  L++
Sbjct  179  EIVEINTYIEGAQ---IDGIITNFPKIVDRYRRNKCLGLGDNKPTYMEPVQPGGIFGLIT  235

Query  409  PQYLPPAEA  383
             +  PP EA
Sbjct  236  KELFPPVEA  244



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+V +  SSVFP    F +  TN+V  LQ + + VYV    NEFVSQ +DFF+D
Sbjct  565  DIKKFASAVSVDTSSVFPEPHHFTMYKTNLVQTLQTAGLSVYVYTLMNEFVSQPYDFFAD  624

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
              V++N+YV GA     DG+IT FPATA RY+ N C+      P +M P   G L+Q++S
Sbjct  625  ATVQINAYVKGAGV---DGLITDFPATARRYKVNSCMNMGNSAPIFMAPPRAGDLMQIIS  681

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPP  332
                PPA AP P+LT+SDV EPPLPP
Sbjct  682  KLAQPPALAPMPLLTDSDVAEPPLPP  707



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 95/149 (64%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FA SV I   S++P    F+   T++V K     + VYV L  NEFVSQ WD+FSD
Sbjct  621  DIKEFADSVAILTDSIYPDTQLFITSKTDIVNKFHRYNLSVYVYLLQNEFVSQPWDYFSD  680

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
            P V++NS+V GA     DG+IT FP TA  Y+RN C  LG K  P +M PV  G LLQL+
Sbjct  681  PIVQINSFVEGAKV---DGIITDFPRTARAYKRNSCRNLGPKA-PVFMEPVEAGDLLQLI  736

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
                 PPA AP PVL  S+VVEPPLPPVA
Sbjct  737  PFAAQPPALAPMPVLNVSNVVEPPLPPVA  765



>emb|CDX82242.1| BnaA03g35790D [Brassica napus]
Length=443

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 9/146 (6%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI  FA +++I K SV P +   +   T+VVA+L+AS  +VYV+ FSNEFV+Q +D FSD
Sbjct  273  EIMSFAGTIVISKESVLPYNGGLVKKKTDVVARLKASGFRVYVETFSNEFVTQPFDLFSD  332

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE+N +V G      DG+IT FPAT  RYR+++C  Y+E+  +      G LL   +P
Sbjct  333  STVEINFFVQGVK---IDGIITDFPATTARYRKSQC--YREMGMFR----TGELLPFANP  383

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
            + L PA+APYP+L ESDV+EPPLP V
Sbjct  384  RLLSPAQAPYPLLVESDVMEPPLPDV  409



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 98/149 (66%), Gaps = 10/149 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDD-SFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKK+ASS++I K SV+      F+   T VV  L++ K++VYV+ FSNEFVSQA DFFS
Sbjct  563  DIKKYASSIVISKRSVYHQMSYGFITRATPVVKMLKSHKLRVYVETFSNEFVSQAQDFFS  622

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+NS+V   +    DG+IT FPATA R+RR RC         ++P G   LL L +
Sbjct  623  DTTVEINSFV---NEMGIDGLITDFPATAARFRRKRC------DMSLVPTGREKLLDLAN  673

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             + LPPA+APYP L ESD+ EPPLP V +
Sbjct  674  EKSLPPAQAPYPSLKESDIDEPPLPDVIQ  702



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V I K S+    D F+ G TNVV +++A+ + VYV    NEFVS  +D+FSD
Sbjct  579  EIKKFADAVTISKDSIVKISDYFISGKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSD  638

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPY-MLPVGPGSLLQL  416
            P +E+ SY         DG++T FPATAN+Y R  C  +  K   PY +LPV PGSLL L
Sbjct  639  PIIEIASYALEFQV---DGIVTDFPATANKYMRCPCNDMDPKATIPYPILPVEPGSLLGL  695

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + P+ L PA+AP P L  S+VV+PPLP V K
Sbjct  696  VVPEALSPAQAPSPALQASNVVDPPLPEVVK  726



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 99/147 (67%), Gaps = 10/147 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSF-LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA S++I K SVFP      L   TNVV+KL++S ++VYV+ FSNEFV+QA+DF+ 
Sbjct  556  DIKNFAGSIVISKKSVFPYVGFITLTQGTNVVSKLKSSGLRVYVERFSNEFVTQAFDFYE  615

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            DP +E++S+V        DG+IT FPAT  RYR+N+C G      ++LP   G L    +
Sbjct  616  DPTLEIDSFVRDIQ---IDGIITDFPATTARYRKNQCYG-----KFVLP-ETGELRTFGN  666

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P  LPPAEAPYP+L +SDV EPPLP V
Sbjct  667  PLLLPPAEAPYPLLGDSDVTEPPLPEV  693



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 5/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++KKFA +VI+ + S+FP    F++  TN+V  L+++ + +Y Q+F NEFVS  WDFFSD
Sbjct  587  DVKKFADAVIVDRESIFPESQGFIMKETNLVKDLRSAGLAIYAQVFRNEFVSPPWDFFSD  646

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMS  410
              VE+NSYV   S N  DG+IT FP T  RY+ N C G    +P YM P   G L QL++
Sbjct  647  VTVEINSYV--QSVN-IDGIITDFPKTVRRYKMNSCTGLGVNMPSYMNPAEIGGLAQLLN  703

Query  409  -PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              Q  PPA AP PVL  SDV EPP P  A
Sbjct  704  GSQAQPPALAPMPVLNSSDVTEPPFPSAA  732



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA +V + K S+    D F+ G TNVV +++A+ + VYV    NEFVS  +D+FSD
Sbjct  579  EIKKFADAVTVTKDSIVKISDYFISGKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSD  638

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQL  416
            P +E+ SYV        DG++T FPATAN+Y R  C        IP  +LPV PGSLL L
Sbjct  639  PIIEIASYVLDYQV---DGIVTDFPATANKYMRCPCNDMDPKANIPYPILPVEPGSLLGL  695

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + P+ L PA+AP P L  S+V +PPLP V K
Sbjct  696  VVPEALSPAQAPSPALQASNVADPPLPEVVK  726



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDD-SFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA SV++ + SV P +   FL  +TNVV++ QA ++ VYVQ+ SNEF S  +D FS
Sbjct  579  DIKTFADSVVVDRKSVLPFNQMGFLTNLTNVVSQFQAFELPVYVQVLSNEFSSIPFDAFS  638

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            DP V++N++V  A+     GVIT FP TA+ YRRN CL     P YM+P  PG+L+ ++ 
Sbjct  639  DPVVQINTFVHAANVT---GVITDFPRTADAYRRNVCLNMNNTPAYMMPAQPGALIGILP  695

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P   PPA +P PVLT  DV +PPL  V
Sbjct  696  PGASPPAGSPTPVLTVDDVSQPPLTSV  722



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   134 bits (338),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 95/151 (63%), Gaps = 8/151 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++KKFA +V+I K+SVF     F++  T++V  LQ++ + VYVQ+F NEFVSQ WDFFSD
Sbjct  590  DVKKFAHAVVIDKNSVFTLSAHFIIRQTSLVKDLQSAGLAVYVQVFRNEFVSQPWDFFSD  649

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLM-  413
              VE+++YV    +   DG+IT FP T  RY+RN C G   +IP YM PV  G L QL+ 
Sbjct  650  ETVEISNYV---QSVKVDGLITDFPKTVRRYKRNSCTGLGNDIPSYMKPVSVGDLAQLIK  706

Query  412  ---SPQYLPPAEAPYPVLTESDVVEPPLPPV  329
                    PPA AP P L  S VV+ P PPV
Sbjct  707  KYAGTNAQPPALAPMPELNSSSVVQAPFPPV  737



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   135 bits (340),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++K+FA +V++ ++S F     F++  T++V  L+++ + VY Q+F NEF+SQ WDFFSD
Sbjct  584  DVKEFAEAVVVDRNSFFAISLQFIINQTSLVKDLRSAGLTVYAQVFRNEFLSQPWDFFSD  643

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM--  413
              VE+NSY   A +   DG+IT FP T  RY+RN C G K+ P YM  V  G L+QL+  
Sbjct  644  ETVEINSY---AQSLKVDGLITDFPKTVRRYKRNSCTG-KDKPAYMETVDVGGLVQLLQR  699

Query  412  --SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
              +P+  PPA AP   L E++V++PP PPVA
Sbjct  700  NAAPEAQPPAVAPMRELNETEVLQPPFPPVA  730



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  +S+FP +  F    TN+V  LQ + + VYV    NEF SQ +DFFSD 
Sbjct  566  IKKFADAVSVEGNSIFPENRHFTTYQTNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDA  625

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P  PG LLQ++S 
Sbjct  626  TAQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISK  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA +P P+LT SDV EPPLPP
Sbjct  683  PAQPPAMSPMPLLTGSDVAEPPLPP  707



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  +S+FP +  F    TN+V  LQ + + VYV    NEF SQ +DFFSD 
Sbjct  566  IKKFADAVSVEGNSIFPENRHFTTYQTNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDA  625

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P  PG LLQ++S 
Sbjct  626  TAQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISK  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA +P P+LT SDV EPPLPP
Sbjct  683  PAQPPAMSPMPLLTGSDVAEPPLPP  707



>gb|ACF79780.1| unknown [Zea mays]
Length=379

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 5/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V +  +SV P    +L   TN +V  LQ++ ++VYV +  NEF SQ  DFF+
Sbjct  200  DIKKFANAVSVSTTSVLPQTHYYLTNQTNKLVTSLQSAGLQVYVYVLMNEFASQPNDFFA  259

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLM  413
            D   ++N+YV GA     DG+IT FP TA+RY+ N C       P +M P  PGSLL  M
Sbjct  260  DATSQINAYVQGAK---VDGIITDFPGTAHRYKLNSCTSMGNSAPLFMQPPQPGSLLLTM  316

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            +P   PPA AP P+LT++DV EP LPPV+
Sbjct  317  APDVQPPAAAPMPLLTDADVAEPALPPVS  345



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  SS+FP +  F    TN+V  L  + + VYV    NEF SQ +DFFSD 
Sbjct  567  IKKFADAVSVEGSSIFPENHHFTTYRTNLVESLHKAGLPVYVYTLMNEFASQPYDFFSDA  626

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++N+YV GA     DGVIT FPATA RY+ N C+      P +M P  PG L+Q++S 
Sbjct  627  TAQINAYVQGAGV---DGVITDFPATARRYKLNTCMNMGNNTPSFMAPAHPGDLMQIISK  683

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PP  AP P+LT SDV EPPLPP
Sbjct  684  PAQPPEMAPMPLLTGSDVAEPPLPP  708



>emb|CDY12599.1| BnaA02g12670D [Brassica napus]
Length=408

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 97/148 (66%), Gaps = 13/148 (9%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA +V+I K SV P  DDSF+ G TNVV +LQ SK+ VYV+LF NEFVS       
Sbjct  247  DIKKFADAVVIIKPSVLPLCDDSFVTGKTNVVERLQKSKLLVYVELFQNEFVS-------  299

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ ++
Sbjct  300  DATVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVN  356

Query  409  P--QYLPPAEAPYPVLTESDVVEPPLPP  332
            P      P+ AP PV T+  V  PPLPP
Sbjct  357  PLSPAPAPSPAPSPVFTDDYVAGPPLPP  384



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 97/146 (66%), Gaps = 5/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++KKFA +V++ + S+FPT   F++  TN++  L+++ + +Y Q+F NEFVS  WDFFSD
Sbjct  592  DVKKFADAVVVQRVSIFPTSQGFIMRETNLMKDLRSAGLAIYAQVFRNEFVSPPWDFFSD  651

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMS  410
              VE+N+YV    +   DG IT FP T  RY+ N C+G  + +P YMLPV    L QL++
Sbjct  652  VTVEINTYV---QSVKIDGFITDFPKTVKRYKMNSCMGLGDNMPQYMLPVEIAGLAQLLN  708

Query  409  PQYL-PPAEAPYPVLTESDVVEPPLP  335
               + PPA +P PVL+ S+V EPPLP
Sbjct  709  GSTVQPPALSPMPVLSSSNVTEPPLP  734



>emb|CDY29432.1| BnaC05g32380D, partial [Brassica napus]
Length=596

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  593
            +IK FA S++I K SV P  +    L   T+VV +L++S ++VYV+ FSNEF++Q +DFF
Sbjct  415  DIKSFAGSIVISKKSVVPYSEGITRLEKETDVVPRLRSSGLRVYVETFSNEFITQPYDFF  474

Query  592  SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM  413
            SDP VE++ +V   + N  DG+IT FPAT +RY +N+C    E       +  G L+ L 
Sbjct  475  SDPTVEIDYFV--RADNEIDGIITDFPATTSRYIKNQCYSKME------QIRTGELVSLA  526

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPV  329
            +P+ L PAEAPYP+L +S+V EPPLP V
Sbjct  527  NPEILSPAEAPYPLLLDSNVTEPPLPEV  554



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+F    SF+ G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKHAEAVNLKRTSLFTVSQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  626  PTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVAK+
Sbjct  683  KEAQPPASAPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 96/147 (65%), Gaps = 10/147 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVT-NVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA S++I K+SVFP    F+     NVV+KL++S ++VYV+ FSNEFV+Q +DF+ 
Sbjct  558  DIKNFAGSIVIRKNSVFPYKGFFIFKKGPNVVSKLKSSGLRVYVETFSNEFVTQEYDFYE  617

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            DP +E++ +V        DG+IT FPAT  RYR+N+C G  ++P        G L  L +
Sbjct  618  DPTLEIDCFVRDIQV---DGIITDFPATTARYRKNQCYGKFDLP------DTGELRTLGN  668

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P  L PAEAPYP+L  SDV EPPLP V
Sbjct  669  PMILAPAEAPYPLLRISDVTEPPLPEV  695



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+F    SF+ G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKHADAVNLKRTSLFTVSQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  626  PTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVAK+
Sbjct  683  KEAQPPAGAPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+F    SF  G TNVV ++  + + VYV +  NE++S A+D+FSD
Sbjct  442  EIKKHADAVNLKRTSLFTVSQSFTTGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSD  501

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +  
Sbjct  502  PTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVAD  558

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA I
Sbjct  559  KEAQPPASAPNPPLDAKDVIDPPLPPVANI  588



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSD
Sbjct  575  EIKKYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQL  416
            P  E+ SYV G      DG++T FP TA++Y R+ C        +P  +LPV PG+L  L
Sbjct  635  PITEIASYVQGFEV---DGIVTDFPGTASKYMRSPCSDTDPKASVPYAILPVEPGALSGL  691

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  692  IGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  558  EIKKHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSD  617

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + +
Sbjct  618  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAA  674

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVAK+
Sbjct  675  KEAQPPAIAPSPPLNAKDVIDPPLPPVAKM  704



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFV+Q +DFFSD 
Sbjct  671  IKKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYTLMNEFVAQPYDFFSDA  730

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              E+ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LLQL+S 
Sbjct  731  TAEIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAPPRPGDLLQLISK  787

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA AP P+L +SDV EPPLPP
Sbjct  788  PAQPPALAPMPLLMDSDVSEPPLPP  812



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+V +   S+FP +  FL   + +V  L+ + + +Y     NEF+SQ +DFFSD
Sbjct  566  DIKKFASAVSVDTGSIFPENHHFLTSPSGLVQSLKTANLSIYAYTLMNEFLSQPYDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
               ++N+YV GA     DG+IT +PATA RY+ N C    K+ P +M P  PG LLQ++S
Sbjct  626  ATAQINAYVQGAKV---DGLITDYPATARRYKLNACKNMGKKAPSFMAPARPGDLLQIIS  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLP  335
                PPA AP P+L +SDV EPPLP
Sbjct  683  KPAQPPALAPMPLLVDSDVTEPPLP  707



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFAS+V +   SVFPT + FL+  TN +V  LQ++ + VY  +  NEF SQ +DFFS
Sbjct  568  DIKKFASAVSVNTQSVFPTTNQFLINQTNKLVPTLQSAGLSVYAYVLMNEFTSQPYDFFS  627

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D   ++N+YV  A     DG+IT FP TA+RY+ N C+G K  P +M P  PG L+ +M 
Sbjct  628  DATAQINAYVQSAKV---DGIITDFPGTAHRYKLNSCMG-KNAPDFMRPAQPGGLISVMD  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             +  PPA AP P+LT+SDV EPPLPPV+ 
Sbjct  684  QRAQPPAAAPMPLLTDSDVAEPPLPPVSN  712



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD 
Sbjct  566  IKKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDA  625

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LLQL+S 
Sbjct  626  TAQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAPPRPGDLLQLISK  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA AP P+L +SDV EPPLPP
Sbjct  683  PAQPPALAPMPLLLDSDVSEPPLPP  707



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  558  EIKKHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSD  617

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + +
Sbjct  618  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAA  674

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA I
Sbjct  675  KEAQPPAIAPSPPLDAKDVIDPPLPPVANI  704



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +VI+ K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSD
Sbjct  575  EIKKYADAVIVTKDSIVKITDYFISGTTNVVDEMKAANISVYAHWMKNEFVSLMFDYFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQL  416
            P  E+ SY  G      DG++T FP TA++Y R+ C        IP  +LPV PGSL  L
Sbjct  635  PITEIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANIPYAILPVEPGSLSSL  691

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPV  329
            ++P+ + PA+AP P L  S VV+PPLP V
Sbjct  692  IAPEAMSPAQAPSPALQTSQVVDPPLPEV  720



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD 
Sbjct  566  IKKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDA  625

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LLQL+S 
Sbjct  626  TAQIIAYVQGAGV---DGLITDFPATARRYKSNTCVNMGNKTPSFMAPPRPGDLLQLISK  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA AP P+L +SDV EPPLPP
Sbjct  683  PAQPPALAPMPLLMDSDVSEPPLPP  707



>ref|XP_009126795.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Brassica rapa]
Length=751

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  564  EIKKHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSD  623

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + +
Sbjct  624  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAA  680

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA I
Sbjct  681  KEAQPPAIAPSPPLDAKDVIDPPLPPVANI  710



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 8/151 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++KKFA +V++ ++S F T   F++  T++V  LQ++ + VY Q+F NEF+SQ WDFFSD
Sbjct  583  DVKKFAEAVVVDRNSFFATSVQFIINQTSLVKDLQSAGLTVYAQVFRNEFLSQPWDFFSD  642

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-  410
              VE+NSY   A +   DG+IT FP T  RY+RN C   K  P YM  V  G L QL+  
Sbjct  643  ETVEINSY---AQSLKVDGLITDFPKTVRRYKRNSCTE-KVKPAYMETVEVGGLAQLLER  698

Query  409  ---PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               PQ  PP  +P P L  ++V +PP PPVA
Sbjct  699  NAVPQAQPPTVSPMPGLNATEVQQPPFPPVA  729



>ref|XP_010483369.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Camelina sativa]
Length=542

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSD
Sbjct  354  EIKKHADAVNLKRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSD  413

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +  
Sbjct  414  PTVELATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVAD  470

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  471  KEAQPPASAPNPPLDAKDVIDPPLPPVANM  500



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 5/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA++V +  +SV P    +L   TN +V  LQ++ ++VYV +  NEF SQ  DFF+
Sbjct  571  DIKKFANAVSVSTTSVLPQTHYYLTNQTNKLVTSLQSAGLQVYVYVLMNEFASQPNDFFA  630

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLM  413
            D   ++N+YV GA     DG+IT FP TA+RY+ N C       P +M P  PGSLL  M
Sbjct  631  DATSQINAYVQGAKV---DGIITDFPGTAHRYKLNSCTSMGNSAPLFMQPPQPGSLLLTM  687

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +P   PPA AP P+LT++DV EP LPPV+ 
Sbjct  688  APDVQPPAAAPMPLLTDADVAEPALPPVSN  717



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+  T  +F  G TNVV ++    V VYV +  NE++S A+D+FSD
Sbjct  567  EIKKHAEAVNLKRSSLVTTSKNFATGKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VE+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LPV  G+LL + +
Sbjct  627  PTVEIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPVEAGALLSVAA  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPP+A I
Sbjct  684  KEAQPPASAPNPPLDARDVIDPPLPPIANI  713



>ref|XP_008343908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
 ref|XP_008343909.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=781

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSD
Sbjct  575  EIKKYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY--KEIPPY-MLPVGPGSLLQL  416
            P  E+ SY  G      DG++T FP TA++Y R+ C     K   PY +LPV PG+L  L
Sbjct  635  PITEIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPILPVEPGALSGL  691

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  692  IGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSD
Sbjct  575  EIKKYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY--KEIPPY-MLPVGPGSLLQL  416
            P  E+ SY  G      DG++T FP TA++Y R+ C     K   PY +LPV PG+L  L
Sbjct  635  PITEIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPILPVEPGALSGL  691

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            + P+ L PAEAP P L  S+VV+PPLP VAK
Sbjct  692  IGPEALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G TNVV ++  S + VYV +  NE++S A+D+FSD
Sbjct  564  EIKKHADAVNLKRTSLVTVSQSFATGKTNVVEEMHKSNISVYVSVLRNEYISIAFDYFSD  623

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  624  PTVELATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVAD  680

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  681  KEAQPPASAPNPPLDAKDVIDPPLPPVANM  710



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+  T  +F  G TNVV ++    V VYV +  NE++S A+D+FSD
Sbjct  590  EIKKHAEAVNLKRSSLVTTSKNFATGKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSD  649

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VE+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LPV  G+LL + +
Sbjct  650  PTVEIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPVEAGALLSVAA  706

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPP+A I
Sbjct  707  KEAQPPASAPNPPLDARDVIDPPLPPIANI  736



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 97/148 (66%), Gaps = 13/148 (9%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA +V+I K SV P  DDSF+ G TNVV +LQ SK+ VYV+LF NEFVS       
Sbjct  562  DIKKFADAVVIIKPSVLPLCDDSFVTGKTNVVERLQKSKLLVYVELFQNEFVS-------  614

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ ++
Sbjct  615  DATVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVN  671

Query  409  P--QYLPPAEAPYPVLTESDVVEPPLPP  332
            P      P+ AP PV T+  V  PPLPP
Sbjct  672  PLSPAPAPSPAPSPVFTDDYVAGPPLPP  699



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 93/145 (64%), Gaps = 10/145 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA S++I K SVFP     ++   TN+ +KL+++ ++VYV+ FSNE V+ A+DF+ 
Sbjct  556  DIKNFAGSIVISKKSVFPYKGFIILEKETNIASKLKSNGLRVYVERFSNECVTHAFDFYD  615

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            DP +E++S+V        DG+IT FPAT  RYR+N+C G   +         G L+   +
Sbjct  616  DPTLEIDSFVRDVQ---IDGIITDFPATTARYRKNKCYGEFGL------TTTGELITFAN  666

Query  409  PQYLPPAEAPYPVLTESDVVEPPLP  335
            P  LPPAEAPYP L +SDV EPPLP
Sbjct  667  PMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKYADAVNLMRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  626  PTVELATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  683  KEAQPPASAPNPPLDAKDVIDPPLPPVANL  712



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 93/145 (64%), Gaps = 10/145 (7%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IK FA S++I K SVFP     ++   TN+ +KL+++ ++VYV+ FSNE V+ A+DF+ 
Sbjct  556  DIKNFAGSIVISKKSVFPYKGFIILEKETNIASKLKSNGLRVYVERFSNECVTHAFDFYD  615

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            DP +E++S+V        DG+IT FPAT  RYR+N+C G   +         G L+   +
Sbjct  616  DPTLEIDSFVRDVQ---IDGIITDFPATTARYRKNKCYGEFGLAT------TGELITFAN  666

Query  409  PQYLPPAEAPYPVLTESDVVEPPLP  335
            P  LPPAEAPYP L +SDV EPPLP
Sbjct  667  PMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+    +SF  G TNVV ++    + VYV +  NEFVS  +D+FSD
Sbjct  567  EIKKHADAVNLKRTSLVTVSNSFATGKTNVVEEMHKGNISVYVSVLRNEFVSIVFDYFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + +
Sbjct  627  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAA  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PP  AP P L   DV++PPLPPVA +
Sbjct  684  KEAQPPTSAPNPPLDAKDVIDPPLPPVANM  713



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA++V + K S++P    F  G T +V+KL  + + VYV +F NEFVSQ WDFFSD
Sbjct  566  DIKTFANAVALDKESIYPATRLFTTGETGLVSKLHDAGIDVYVYVFQNEFVSQPWDFFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  413
              VE+N++V GA     DG+IT FP TA RY+RN C  LG   +P YM PV  G L+ LM
Sbjct  626  ATVEINAHVLGARV---DGIITDFPETARRYKRNSCRNLG-NSMPNYMQPVLAGGLISLM  681

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLP  335
            +   LPPA AP P L  SDVVEPPLP
Sbjct  682  NSDSLPPALAPIPPLDVSDVVEPPLP  707



>ref|XP_008361197.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=773

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +VI+ K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSD
Sbjct  575  EIKKYADAVIVTKDSIVKITDYFISGTTNVVKEMKAANISVYAHWMKNEFVSLMFDYFSD  634

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQL  416
            P  E+ SY  G      DG++T FP TA++Y R+ C        +P  +LPV PGSL  L
Sbjct  635  PMTEIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANVPYAILPVEPGSLSSL  691

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPV  329
            ++P+ L PA+AP   L  S VV+PPLP V
Sbjct  692  IAPEALSPAQAPSQALQTSKVVDPPLPEV  720



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EI  FA +++I K SV P +   +   T+VVA+L+AS  +VYV+ FSNEFV+Q +D FSD
Sbjct  679  EIMSFAGTIVISKESVLPYNGGLVKKKTDVVARLKASGFRVYVETFSNEFVTQPFDLFSD  738

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
              VE++ +V    A   DG+IT FPAT  RYR+++C  Y+E+  +      G LL   +P
Sbjct  739  STVEIDFFV---QAVKIDGIITDFPATTARYRKSQC--YREMSMFR----TGELLPFGNP  789

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
            + L PA+APYP+L ESDV+EPPL  V
Sbjct  790  RLLSPAQAPYPLLVESDVMEPPLLDV  815



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKHADAVNLMRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  626  PTVELATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  683  KEAQPPASAPNPPLDAKDVIDPPLPPVANM  712



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V I +SS+     SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  567  EIKKHADAVNILRSSLVSISGSFAAGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VE  +++ G   N  DGVIT FPATA+RY R+ C    +  PY +LP   G+L+ + +
Sbjct  627  PTVEFATFIAG---NGVDGVITEFPATASRYLRSPCSDLNKEQPYAILPAEAGALISVAN  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  684  KEAQPPASAPNPPLDAKDVIDPPLPPVANM  713



>dbj|BAC42822.1| GPI-anchored protein [Arabidopsis thaliana]
Length=359

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + ++S+     SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  175  EIKKYAEAVNLLRTSLVTVSQSFTTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSD  234

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P +EL +++ G+     DGVIT FPATA RY ++ C    +  PY +LP   G L+ +  
Sbjct  235  PTIELATFISGSG---VDGVITEFPATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVAD  291

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  292  KEAQPPASAPNPPLEAKDVIDPPLPPVANL  321



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD 
Sbjct  566  IKKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDA  625

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LL L+S 
Sbjct  626  TAQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAPPRPGDLLLLISK  682

Query  406  QYLPPAEAPYPVLTESDVVEPPLPP  332
               PPA AP P+L +SDV EPPLPP
Sbjct  683  PAQPPALAPMPLLLDSDVSEPPLPP  707



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSD
Sbjct  559  EIKKHADAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSD  618

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+P  +LP   G+L+ + S
Sbjct  619  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELPFAILPAKAGTLVSVAS  675

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  676  KEAQPPASAPNPPLDAKDVIDPPLPPVANL  705



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD
Sbjct  453  DIKKFADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSD  512

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG  473
              VE+NS+V G      DGVIT FP T+  Y+RN+CLG
Sbjct  513  ATVEVNSFVVGGDV---DGVITDFPKTSASYKRNKCLG  547



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 89/130 (68%), Gaps = 13/130 (10%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA +V+I K SV P +DDSF+ G TNVV +LQ SK+ +YV+L  NEFVS       
Sbjct  529  DIKKFADAVVIIKPSVLPLSDDSFVTGKTNVVERLQKSKLLIYVELLQNEFVS-------  581

Query  589  DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  410
            D  VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ+++
Sbjct  582  DATVEINSYITGAGIN---GTITEFPFTASKYKRNRCLGTKETLPYMAPVIPRGLLQMVN  638

Query  409  PQYLPPAEAP  380
            P  L PA AP
Sbjct  639  P--LSPAPAP  646



>gb|AFW58562.1| hypothetical protein ZEAMMB73_533189 [Zea mays]
Length=260

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 91/146 (62%), Gaps = 4/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V +   SVFP    F V  TN+V  LQ + + VYV    NEF+SQ +DFFSD
Sbjct  78   DIKRFASAVSVDTGSVFPETHYFTVYETNLVQTLQTAGLSVYVYTLMNEFLSQPYDFFSD  137

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
               ++N+YV GA     DG+IT FPATA RY+ N C+      P +M P  PG L+Q +S
Sbjct  138  ATAQINAYVKGA---LVDGLITDFPATARRYKVNSCMNMGNSTPNFMAPARPGDLMQSIS  194

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPP  332
                PPA AP P LT SDV EPPLPP
Sbjct  195  KSAQPPALAPVPPLTGSDVAEPPLPP  220



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G T+VV ++  + + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKHADAVNLKRTSLVTVSQSFATGNTSVVEEMHKANISVYVSVLRNEYISIAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +  
Sbjct  626  PTVELATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  683  KEAQPPASAPNPPLDAKDVIDPPLPPVANV  712



>ref|XP_009126781.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Brassica rapa]
Length=738

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSD
Sbjct  549  EIKKHADAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSD  608

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S
Sbjct  609  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVAS  665

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  666  KEAQPPASAPNPPLDAKDVIDPPLPPVANL  695



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 92/152 (61%), Gaps = 8/152 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            ++K+FA +V++ +SS F     F++  T+++  LQ++ + VY Q+F NEFVSQ WDFF D
Sbjct  585  DVKEFAEAVVVDRSSFFAQSVHFIINQTSLLTDLQSAGLTVYAQVFRNEFVSQPWDFFGD  644

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLM-  413
              VE+N+Y   A +   DG+IT FP T  RY+RN C G   ++P YM  V  G L QL+ 
Sbjct  645  ETVEINNY---AQSLNVDGLITDFPKTVRRYKRNSCTGLGNDVPSYMGNVTVGGLAQLLK  701

Query  412  ---SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
               +PQ  PP+ AP P L    V  PP P VA
Sbjct  702  NQAAPQAQPPSVAPMPKLDAPSVQRPPFPTVA  733



>ref|XP_009126782.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X2 [Brassica rapa]
Length=756

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSD
Sbjct  567  EIKKHADAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S
Sbjct  627  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVAS  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  684  KEAQPPASAPNPPLDAKDVIDPPLPPVANL  713



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (62%), Gaps = 4/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + ++S+     SF    TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  562  EIKKYADAVNLKRTSLVSISHSFTTAKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSD  621

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGV+T FPATA+RY R  C    +  PY +LP  PG+LL + +
Sbjct  622  PTVELATFIAG---NGVDGVVTEFPATASRYLRTPCADLNKDQPYAILPAEPGALLSVAA  678

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
             +  PP  A  P L   DVV+PPLPPVA 
Sbjct  679  KEAQPPVGALNPPLEAKDVVDPPLPPVAN  707



>ref|XP_002437331.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
 gb|EER88698.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
Length=744

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 5/147 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            E+ KFAS+V I + SV     SFL+  T+V+ K+ A+ + VYV L  NEF++  +DF+++
Sbjct  557  EMAKFASAVSITRGSVVQAQGSFLLRFTDVIDKMHAANLSVYVGLLRNEFMNLGFDFWAN  616

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
            P VE+ +Y    S+   DG++T FPATA  Y R+ C  + K +   ++P  PGSLL+L  
Sbjct  617  PMVEIVTY----SSLMADGIVTEFPATAAEYFRSPCSDFSKNLTYTIMPAKPGSLLKLTD  672

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            P  LPPA+ P PVL  +DVV+PPLPPV
Sbjct  673  PSALPPAQGPAPVLKPADVVDPPLPPV  699



>dbj|BAD94535.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=378

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G TNVV ++  + + VYV +  NE+++ A+D+FSD
Sbjct  191  EIKKHADAVNLLRTSLITVSQSFATGKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSD  250

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P +EL +++ G      DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  251  PTIELATFIAGRG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPADAGALLTVAD  307

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +   PA  P P L   DV++PPLPPVAK+
Sbjct  308  KEAQLPAIPPNPPLDAKDVIDPPLPPVAKL  337



>emb|CDY32720.1| BnaA02g07820D [Brassica napus]
Length=752

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + +SS+     SF  G T +V  +    + VYV +  NE++S  +D+FSD
Sbjct  563  EIKKHADAVNVLRSSLVTISQSFATGKTKIVEAMHKGNISVYVSVLRNEYLSITFDYFSD  622

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMS  410
            P VEL +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S
Sbjct  623  PTVELATFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVAS  679

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  680  KEAQPPASAPNPPLDAKDVMDPPLPPVANL  709



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 96/149 (64%), Gaps = 12/149 (8%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  593
            +IK FA S++I K SV P  +    L   T+VV +L++S ++VYV+ FSNEF++Q +DFF
Sbjct  547  DIKSFAGSIVISKKSVVPYSEGIARLEKETDVVPRLRSSGLRVYVETFSNEFITQPYDFF  606

Query  592  SDPYVELNSYVFGASANP-FDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQL  416
            SDP VE++ +V G   +P  DG+IT FPAT +RY +N C    E       +  G L+ L
Sbjct  607  SDPTVEIDYFVRG---DPEVDGIITDFPATTSRYTKNPCYSKME------QIRTGELVSL  657

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPV  329
             + + L PAEAPYP L +S+V EPPLP V
Sbjct  658  ANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + ++S+     SF  G TNVV ++    + VYV +  NE++S A+D+FSD
Sbjct  566  EIKKYAEAVNLLRTSLVTVSQSFTTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P +EL +++ G+     DGVIT FPATA RY ++ C    +  PY +LP   G L+ +  
Sbjct  626  PTIELATFISGSGV---DGVITEFPATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +  PPA AP P L   DV++PPLPPVA +
Sbjct  683  KEAQPPASAPNPPLEAKDVIDPPLPPVANL  712



>ref|XP_008345038.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Malus domestica]
Length=339

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            IKKFA SV+I K+S+FP  ++F+ GVT+VV+KLQ +K+ VYV+LFSNEFVSQ WDFFSDP
Sbjct  239  IKKFADSVVINKASIFPEVEAFITGVTDVVSKLQDAKLPVYVELFSNEFVSQPWDFFSDP  298

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY  470
             VE+NS+V G +    DGVIT FP TA RY+    L Y
Sbjct  299  TVEINSFVSGVN---IDGVITDFPKTAARYKSKCVLVY  333



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 12/149 (8%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  593
            +IK FA S++I K SV P  +    L   T++V +L++S ++VYV+ FSNEF++Q +DFF
Sbjct  547  DIKSFAGSIVISKKSVVPYSEGIARLEKETDIVPRLRSSGLRVYVETFSNEFITQPYDFF  606

Query  592  SDPYVELNSYVFGASANP-FDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQL  416
            SDP VE++ +V G   +P  DG+IT FPAT +RY +N C    E       +  G L+ L
Sbjct  607  SDPTVEIDYFVRG---DPEVDGIITDFPATTSRYTKNPCYSKME------QIRTGELVSL  657

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPV  329
             + + L PAEAPYP L +S+V EPPLP V
Sbjct  658  ANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 95/149 (64%), Gaps = 12/149 (8%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPT---DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDF  596
            +IK  A S++I K SV+P+    D F+   T+VV +LQ++ ++V+V+ F NEF +Q +DF
Sbjct  576  DIKDVAGSIVISKKSVYPSYTSRDGFVKLKTDVVPRLQSNGLRVFVETFHNEFTTQQFDF  635

Query  595  FSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQL  416
            ++DP VE++S+V        DG+IT FPAT  RYR+N C    ++ P       G L+ L
Sbjct  636  YADPTVEIHSFVLDI---KIDGIITDFPATTTRYRKNHCYRKLDLVP------TGVLITL  686

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPV  329
             +  +L PAEAPYP L ++DV+EPPL  V
Sbjct  687  PNLVHLGPAEAPYPTLVDADVIEPPLTEV  715



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 6/150 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A  V++ + S+  TD+ F    TNV+ ++ A  + VYV +  NEFV+  +DF++D
Sbjct  569  EIKKYADGVVVARPSLISTDNGFAKAQTNVLQEMHAGNISVYVFVLRNEFVALPFDFYAD  628

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMS  410
            P VEL +YV   +A   DGVIT FP TA+RY R+ C+    EI   ++P  PG+LL+ + 
Sbjct  629  PMVELATYV---AALEVDGVITDFPGTASRYMRSPCVDLNGEIA--IIPAEPGALLKQVP  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            P  L PA  P P L  +DVV+PPLPPVA +
Sbjct  684  PMALSPANPPNPPLEVADVVDPPLPPVANV  713



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 94/146 (64%), Gaps = 4/146 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFAS+V +  SSVFP    F V  TN+V  LQ++ + VYV    NEF SQ +DFFSD
Sbjct  567  DIKKFASAVSVDTSSVFPETHYFTVYETNLVQTLQSAGLSVYVYTLMNEFPSQPYDFFSD  626

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS  410
               ++N+YV GA     DG+IT FPATA RY+ N C+      P +M PV PG L+Q +S
Sbjct  627  ATAQINAYVKGALV---DGLITDFPATARRYKVNSCMNMGNNTPNFMAPVHPGDLMQSIS  683

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPP  332
                PPA AP P LTESDV +PPLPP
Sbjct  684  RSAQPPALAPIPPLTESDVAQPPLPP  709



>ref|XP_002453429.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
 gb|EES06405.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
Length=295

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IKKFA +V I ++SV      F+   T+ V  LQA+ + V+V +  NEF++  +DFF+D
Sbjct  108  DIKKFADTVRINRNSVAQITGYFMTHFTDTVGSLQAANLTVFVGVLKNEFMNLGFDFFAD  167

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P +E+ +Y +   A   DG++T +PATA  Y R+ C   K    Y +LP  PG+L+ L +
Sbjct  168  PTIEVATYAYSVVA---DGIVTDYPATAASYFRSPCSDMKLNLSYSILPAQPGALVNLAA  224

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
            P  L PA AP P+L  +DVV+PPLPPV  +
Sbjct  225  PGMLAPAGAPAPLLQPTDVVDPPLPPVKAV  254



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA +V +   S++P  + FL+  TN VV  LQ++ + VYV L  NEFVSQ +DFFS
Sbjct  476  DIKKFADAVSVSAMSIYPAANKFLINQTNPVVKSLQSAGLPVYVYLLMNEFVSQPYDFFS  535

Query  589  DPYVELNSYVFG-ASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQL  416
            D   ++N+YV         DGVIT FP TA+RY+ N C    K+ P +M P   G L+  
Sbjct  536  DATAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMGKKTPLFMQPPQRGGLVGT  595

Query  415  MS-PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  596  ISDPSALPPAMSPMPVLTDSDVAEPPLPPV  625



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 92/150 (61%), Gaps = 5/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + + S+ PT D F    T VV ++ A+ + VYV +  NEFV+ A+D+F+D
Sbjct  561  EIKKYADAVTLPRFSIVPTSDGFTTATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFAD  620

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK--EIPPYMLPVGPGSLLQLM  413
            P +E+ +Y  G      DG+IT +PATA+RY RN C      E    ++P   GSLL+ +
Sbjct  621  PTIEIATYTSGIGV---DGIITEYPATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTV  677

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              +  PPA +P P L  +D+V+PPLP V K
Sbjct  678  PEETQPPASSPTPALDVADIVDPPLPAVTK  707



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFS  590
            +IKKFA +V +   S++P  + FL+  TN VV  LQ++ + VYV L  NEFVSQ +DFFS
Sbjct  566  DIKKFADAVSVSAMSIYPAANKFLINQTNPVVKSLQSAGLPVYVYLLMNEFVSQPYDFFS  625

Query  589  DPYVELNSYV-FGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQL  416
            D   ++N+YV         DGVIT FP TA+RY+ N C    K+ P +M P   G L+  
Sbjct  626  DATAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMGKKTPLFMQPPQRGGLVGT  685

Query  415  MS-PQYLPPAEAPYPVLTESDVVEPPLPPV  329
            +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  686  ISDPSALPPAMSPMPVLTDSDVAEPPLPPV  715



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 88/148 (59%), Gaps = 4/148 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKKFA  V + +SS     +SF V  T+VV   Q S + V+  +F NEF + A D FSD
Sbjct  563  EIKKFADIVNLPRSSSLVILNSFTVKYTDVVDTFQLSNISVFTSVFMNEFPTIAIDMFSD  622

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P VEL ++V G      DGV+T +PATA  Y R+ C+      PY + P  PG+LL L S
Sbjct  623  PIVELQTFVAGFG---IDGVVTDYPATARAYSRSPCIDLNANVPYTIFPAQPGALLALAS  679

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            P  LPP  AP P LT  DV++PPLPPV 
Sbjct  680  PDALPPVGAPAPSLTVGDVIDPPLPPVG  707



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 92/150 (61%), Gaps = 5/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + + S+ PT D F    T VV ++ A+ + VYV +  NEFV+ A+D+F+D
Sbjct  548  EIKKYADAVTLPRFSIVPTIDGFTTATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFAD  607

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK--EIPPYMLPVGPGSLLQLM  413
            P +E+ +Y  G      DG+IT +PATA+RY RN C      E    ++P   GSLL+ +
Sbjct  608  PTIEIATYTSGIGV---DGIITEYPATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTV  664

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
              +  PPA +P P L  +D+V+PPLP V K
Sbjct  665  PEETQPPASSPTPALDVADIVDPPLPAVTK  694



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK A +V + ++S+     SF  G TNVV ++  + + VYV +  NE+++ A+D+FSD
Sbjct  566  EIKKHADAVNLLRTSLITVSQSFATGKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSD  625

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMS  410
            P +EL +++ G      DGVIT FPATA RY R+ C    +  PY +LP   G+LL +  
Sbjct  626  PTIELATFIAGRGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPADAGALLTVAD  682

Query  409  PQYLPPAEAPYPVLTESDVVEPPLPPVAKI  320
             +   PA  P P L   DV++PPLPPVAK+
Sbjct  683  KEAQLPAIPPNPPLDAKDVIDPPLPPVAKL  712



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA +V++ ++SVF     F++G   +V  LQA+ + VY Q+F NE+V+  +DF  D
Sbjct  510  DIKAFAEAVVVDRTSVFALSYDFIMGQNRIVRDLQAAGLAVYAQVFRNEYVAHPFDFLGD  569

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQ-LM  413
            P VE+N YV         G+IT FP T  RY+ N C    K++P YM PV  GSL   L 
Sbjct  570  PTVEINYYV---QTFNLSGMITDFPKTVRRYKENTCTALGKDMPKYMRPVEAGSLADFLR  626

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            S Q  PP+ AP P L  S V EPPLP  A
Sbjct  627  SFQTQPPSVAPMPALNSSSVEEPPLPTAA  655



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = -1

Query  763  IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  584
            +KKFA +V++ + SVF     F +   ++V  LQ++ + VY Q+F NEFVSQ  DFF+D 
Sbjct  582  MKKFADAVVVDRKSVFTLSQDFAIRQNSLVKDLQSAGLAVYAQVFRNEFVSQPLDFFADE  641

Query  583  YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  407
             VE+N YV    +    G+IT FP T  RY++N C G   ++P YM  +  GSL QL+ P
Sbjct  642  TVEINYYV---QSFNLSGIITDFPKTVRRYKKNTCTGLGNDMPNYMQRIDVGSLYQLLQP  698

Query  406  -QYLPPAEAPYPVLTESDVVEPPLPPVA  326
             +  PP+  P P L  S V E PLPPVA
Sbjct  699  FKAQPPSVPPMPTLNASSVEEAPLPPVA  726



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            EIKK+A +V + + S+ PT + F  G T VV ++QA+ + VYV +  NEF++  +D+FSD
Sbjct  561  EIKKYADAVTLPRFSIVPTVNGFTTGTTKVVNEMQAANISVYVSVLRNEFITLPFDYFSD  620

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP---YMLPVGPGSLLQL  416
            P +E+ +Y  G      DG+IT +PATA+RY RN C     +P     ++P   GSLL+ 
Sbjct  621  PTIEIATYTSGIGV---DGIITEYPATASRYLRNPC-SSNSMPDSSYSIIPAEAGSLLKT  676

Query  415  MSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  323
            +  +  PPA  P P L  +DVV+PPLP V K
Sbjct  677  VPEETQPPASTPTPALDVADVVDPPLPAVTK  707



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA +V++ ++SVF     F++G   +V  LQA+ + VY Q+F NE+V+  +DF  D
Sbjct  542  DIKAFAEAVVVDRTSVFALSYDFIMGQNRIVRDLQAAGLAVYAQVFRNEYVAHPFDFLGD  601

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQ-LM  413
            P VE+N YV         G+IT FP T  RY+ N C    K++P YM PV  GSL   L 
Sbjct  602  PTVEINYYV---QTFNLSGMITDFPKTVRRYKENTCTALGKDMPKYMRPVEAGSLADFLR  658

Query  412  SPQYLPPAEAPYPVLTESDVVEPPLPPVA  326
            S Q  PP+ AP P L  S V EPPLP  A
Sbjct  659  SFQTQPPSVAPMPALNSSSVEEPPLPTAA  687



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (64%), Gaps = 9/146 (6%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK FA S++I + SVF  +  F+   T+V  +L +S ++VYV+  SNEFVS  +DF+SD
Sbjct  555  DIKSFAGSIVINRDSVFSGNAGFITLKTDVFPRLNSSGLRVYVETLSNEFVSYPFDFYSD  614

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  407
            P ++++++V     +   G+IT FPAT  RYR+N+C  Y ++  +      G L+   +P
Sbjct  615  PTMQIDTFVRDIKIH---GIITDFPATTARYRKNQC--YSKMNLFR----TGELITFGNP  665

Query  406  QYLPPAEAPYPVLTESDVVEPPLPPV  329
              +PPA APYP L ESDV EPPLP V
Sbjct  666  LLVPPAGAPYPSLVESDVTEPPLPEV  691



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = -1

Query  766  EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  587
            +IK+FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD
Sbjct  573  DIKRFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSD  632

Query  586  PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCL  476
              VE+NS+  GAS N   GVIT FP T++RY R++CL
Sbjct  633  ATVEINSFCAGASIN---GVITDFPKTSDRY-RSKCL  665



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890