BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031M14

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010452860.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    271   2e-84   
ref|XP_010491494.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    271   2e-84   Camelina sativa [gold-of-pleasure]
gb|AFK41633.1|  unknown                                                 259   8e-84   Medicago truncatula
ref|XP_011086756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    269   1e-83   Sesamum indicum [beniseed]
ref|XP_011086755.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    269   1e-83   Sesamum indicum [beniseed]
ref|XP_011071205.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    268   3e-83   Sesamum indicum [beniseed]
ref|XP_010251339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    260   5e-83   Nelumbo nucifera [Indian lotus]
gb|EYU42106.1|  hypothetical protein MIMGU_mgv1a005364mg                267   6e-83   Erythranthe guttata [common monkey flower]
ref|XP_009615859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    267   1e-82   Nicotiana tomentosiformis
ref|XP_002514955.1|  NADH-ubiquinone oxidoreductase flavoprotein,...    266   1e-82   Ricinus communis
ref|XP_010911159.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    266   3e-82   Elaeis guineensis
ref|XP_009609277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   4e-82   Nicotiana tomentosiformis
ref|NP_001275120.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    265   5e-82   Solanum tuberosum [potatoes]
ref|XP_009770074.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   5e-82   Nicotiana sylvestris
ref|XP_008799963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   5e-82   
ref|XP_004232268.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   6e-82   Solanum lycopersicum
gb|KDP26775.1|  hypothetical protein JCGZ_17933                         265   6e-82   Jatropha curcas
ref|NP_001148767.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      265   6e-82   Zea mays [maize]
ref|XP_008799962.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   6e-82   
ref|XP_010546277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_009785204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   6e-82   Nicotiana sylvestris
ref|XP_008799960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   9e-82   Phoenix dactylifera
ref|XP_008360129.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    264   9e-82   Malus domestica [apple tree]
ref|XP_008799961.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   1e-81   Phoenix dactylifera
ref|XP_003557368.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    265   2e-81   Brachypodium distachyon [annual false brome]
dbj|BAJ94094.1|  predicted protein                                      263   3e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011041538.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    263   3e-81   Populus euphratica
ref|XP_002315622.1|  hypothetical protein POPTR_0010s06750g             263   3e-81   Populus trichocarpa [western balsam poplar]
gb|EMT32185.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, m...    262   1e-80   
gb|EMS64088.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    261   1e-80   Triticum urartu
ref|XP_006438083.1|  hypothetical protein CICLE_v10033600mg             260   1e-80   
ref|XP_006484064.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    261   1e-80   Citrus sinensis [apfelsine]
ref|XP_009407142.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    261   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827286.1|  hypothetical protein AMTR_s00010p00264240          260   3e-80   Amborella trichopoda
ref|XP_007045030.1|  51 kDa subunit of complex I                        260   4e-80   Theobroma cacao [chocolate]
gb|AES60212.2|  NADH-ubiquinone oxidoreductase 51 kDa subunit           259   5e-80   Medicago truncatula
ref|XP_006838360.1|  hypothetical protein AMTR_s00002p00015430          259   1e-79   Amborella trichopoda
gb|ACU24391.1|  unknown                                                 253   2e-79   Glycine max [soybeans]
gb|EPS65614.1|  hypothetical protein M569_09162                         259   2e-79   Genlisea aurea
ref|XP_003589961.1|  NADH-quinone oxidoreductase subunit F              259   4e-79   
ref|XP_010682836.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    257   6e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004497859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    257   6e-79   Cicer arietinum [garbanzo]
ref|XP_007145867.1|  hypothetical protein PHAVU_007G274700g             256   8e-79   Phaseolus vulgaris [French bean]
ref|XP_004497858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    256   1e-78   
ref|XP_003535239.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    254   4e-78   Glycine max [soybeans]
gb|AHA84169.1|  NADH-quinone oxidoreductase subunit F                   254   7e-78   Phaseolus vulgaris [French bean]
ref|XP_009385396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    254   8e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006574505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    253   1e-77   Glycine max [soybeans]
ref|XP_001754412.1|  predicted protein                                  252   3e-77   
ref|XP_001778863.1|  predicted protein                                  251   9e-77   
ref|XP_002977599.1|  hypothetical protein SELMODRAFT_443575             251   1e-76   Selaginella moellendorffii
ref|XP_002975195.1|  hypothetical protein SELMODRAFT_150347             250   1e-76   
ref|XP_009131078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   1e-71   Brassica rapa
ref|XP_009122464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   1e-71   Brassica rapa
ref|XP_010547695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    238   1e-71   
ref|NP_196470.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        235   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65274.1|  NADH dehydrogenase                                      235   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399352.1|  hypothetical protein EUTSA_v10013394mg             233   1e-70   
ref|XP_002873369.1|  hypothetical protein ARALYDRAFT_487692             235   1e-70   
ref|NP_001141093.1|  uncharacterized protein LOC100273176               235   2e-70   Zea mays [maize]
gb|ACF84291.1|  unknown                                                 235   2e-70   Zea mays [maize]
ref|XP_006287433.1|  hypothetical protein CARUB_v10000637mg             236   4e-70   
ref|XP_006399353.1|  hypothetical protein EUTSA_v10013394mg             234   5e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010423066.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010459420.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004958515.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    233   1e-69   Setaria italica
ref|XP_005717522.1|  NADH dehydrogenase I (Complex I) flavoprotei...    233   1e-69   Chondrus crispus [carageen]
gb|ACL53142.1|  unknown                                                 233   2e-69   Zea mays [maize]
tpg|DAA41609.1|  TPA: NADH-ubiquinone oxidoreductase subunit, mRNA      231   2e-69   
ref|XP_009403957.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    232   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008222059.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    231   4e-69   Prunus mume [ume]
ref|XP_008340188.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    232   4e-69   
gb|KJB08870.1|  hypothetical protein B456_001G109800                    231   5e-69   Gossypium raimondii
gb|KJB50333.1|  hypothetical protein B456_008G164400                    231   6e-69   Gossypium raimondii
ref|XP_007222426.1|  hypothetical protein PRUPE_ppa004904mg             231   6e-69   Prunus persica
gb|ADN33976.1|  NADH-ubiquinone oxidoreductase flavoprotein             231   7e-69   Cucumis melo subsp. melo
gb|KJB50332.1|  hypothetical protein B456_008G164400                    231   7e-69   Gossypium raimondii
ref|XP_008340187.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    231   8e-69   
ref|XP_008443176.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   9e-69   Cucumis melo [Oriental melon]
ref|XP_004136606.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   9e-69   
ref|NP_001060455.1|  Os07g0645400                                       231   9e-69   
ref|XP_010248930.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   1e-68   Nelumbo nucifera [Indian lotus]
gb|EAZ04909.1|  hypothetical protein OsI_27090                          231   1e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010025340.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   1e-68   Eucalyptus grandis [rose gum]
gb|KGN59382.1|  hypothetical protein Csa_3G815460                       230   1e-68   Cucumis sativus [cucumbers]
ref|XP_010025338.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   1e-68   Eucalyptus grandis [rose gum]
ref|XP_010103203.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1     228   1e-68   
gb|EAZ40868.1|  hypothetical protein OsJ_25349                          231   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658044.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    230   2e-68   Oryza brachyantha
ref|XP_002503039.1|  predicted protein                                  228   3e-68   Micromonas commoda
ref|XP_003058710.1|  predicted protein                                  228   5e-68   Micromonas pusilla CCMP1545
ref|XP_004310055.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    228   6e-68   Fragaria vesca subsp. vesca
ref|XP_007514630.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      228   1e-67   Bathycoccus prasinos
ref|XP_005650585.1|  NADH-ubiquinone oxidoreductase                     225   8e-67   Coccomyxa subellipsoidea C-169
ref|XP_002266661.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    224   2e-66   Vitis vinifera
emb|CAN73193.1|  hypothetical protein VITISV_022287                     224   2e-66   Vitis vinifera
ref|XP_010644983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    225   2e-66   Vitis vinifera
ref|XP_011398745.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    222   1e-65   Auxenochlorella protothecoides
ref|XP_001702590.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit      222   1e-65   Chlamydomonas reinhardtii
ref|XP_002948368.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit      222   1e-65   Volvox carteri f. nagariensis
gb|AAQ63696.1|  NADH:ubiquinone oxidoreductase 51 kD subunit            222   2e-65   Chlamydomonas reinhardtii
ref|WP_020696100.1|  NADH dehydrogenase                                 219   3e-65   Reyranella massiliensis
ref|XP_009372324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    220   1e-64   Pyrus x bretschneideri [bai li]
gb|ACE96395.1|  esterase/lipase/thioesterase                            217   1e-64   Populus tremula [European aspen]
gb|ACE96394.1|  esterase/lipase/thioesterase                            217   1e-64   Populus tremula [European aspen]
gb|ACE96393.1|  esterase/lipase/thioesterase                            217   2e-64   Populus tremula [European aspen]
gb|ACE96365.1|  esterase/lipase/thioesterase                            217   2e-64   Populus tremula [European aspen]
gb|ACE96363.1|  esterase/lipase/thioesterase                            217   2e-64   Populus tremula [European aspen]
gb|ACE96369.1|  esterase/lipase/thioesterase                            217   2e-64   Populus tremula [European aspen]
ref|WP_022687672.1|  NADH dehydrogenase                                 218   2e-64   Sphingomonas phyllosphaerae
ref|XP_005702818.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1     219   3e-64   Galdieria sulphuraria
ref|WP_029624778.1|  NADH dehydrogenase                                 217   4e-64   Sphingomonas sp. KC8
emb|CDP13320.1|  unnamed protein product                                219   6e-64   Coffea canephora [robusta coffee]
ref|XP_001421384.1|  predicted protein                                  217   7e-64   Ostreococcus lucimarinus CCE9901
ref|WP_017184600.1|  NADH dehydrogenase                                 216   8e-64   Sphingobium
ref|WP_019053667.1|  NADH dehydrogenase                                 216   9e-64   Sphingobium
ref|WP_044331689.1|  NADH dehydrogenase                                 216   1e-63   
ref|WP_039331352.1|  NADH dehydrogenase                                 216   1e-63   Novosphingobium subterraneum
ref|WP_038660313.1|  NADH dehydrogenase                                 216   1e-63   Sphingomonas taxi
ref|WP_028970528.1|  NADH dehydrogenase                                 215   2e-63   Sphingomonas sp. URHD0057
ref|WP_022672411.1|  NADH dehydrogenase                                 215   3e-63   Sphingopyxis baekryungensis
ref|XP_003343487.1|  hypothetical protein SMAC_10529                    207   3e-63   
ref|WP_017671019.1|  NADH dehydrogenase                                 214   3e-63   Blastomonas sp. AAP53
ref|WP_006959713.1|  NADH-ubiquinone oxidoreductase chain F             215   3e-63   Sphingobium japonicum
ref|WP_037525772.1|  NADH dehydrogenase                                 214   4e-63   Sphingomonas wittichii
ref|WP_031393840.1|  MULTISPECIES: NADH dehydrogenase                   214   4e-63   Sphingomonas
ref|WP_034957798.1|  NADH dehydrogenase                                 214   4e-63   Erythrobacter longus
ref|WP_007015102.1|  MULTISPECIES: NADH dehydrogenase                   214   4e-63   Novosphingobium
ref|WP_034904668.1|  NADH dehydrogenase                                 214   4e-63   Erythrobacter litoralis
ref|WP_028966979.1|  NADH dehydrogenase                                 214   4e-63   Sphingomonas phyllosphaerae
ref|WP_021239945.1|  MULTISPECIES: NADH dehydrogenase                   214   5e-63   Sphingomonadaceae
ref|WP_037473959.1|  NADH dehydrogenase                                 214   5e-63   Sphingobium sp. ba1
ref|WP_043153511.1|  NADH dehydrogenase                                 214   5e-63   Sphingobium sp. Ant17
ref|WP_039284131.1|  NADH dehydrogenase                                 214   5e-63   Novosphingobium malaysiense
ref|WP_007404054.1|  MULTISPECIES: NADH dehydrogenase                   214   5e-63   Sphingomonas
ref|WP_042483195.1|  NADH dehydrogenase                                 214   6e-63   Sphingomonas
ref|WP_034954154.1|  NADH dehydrogenase                                 214   6e-63   
ref|WP_028055980.1|  NADH dehydrogenase                                 214   7e-63   Sphingobium sp. YL23
ref|WP_007164315.1|  NADH dehydrogenase                                 214   7e-63   Erythrobacter sp. NAP1
ref|WP_027135324.1|  NADH dehydrogenase                                 214   7e-63   Geminicoccus roseus
ref|WP_010413354.1|  NADH dehydrogenase                                 214   7e-63   Citromicrobium sp. JLT1363
ref|WP_027442082.1|  NADH dehydrogenase                                 214   7e-63   Porphyrobacter cryptus
ref|WP_042084460.1|  NADH dehydrogenase                                 213   9e-63   alpha proteobacterium Q-1
gb|ACE96388.1|  esterase/lipase/thioesterase                            213   9e-63   Populus tremula [European aspen]
ref|WP_022688780.1|  NADH dehydrogenase                                 213   1e-62   Sphingomonas-like bacterium B12
ref|WP_029008457.1|  NADH dehydrogenase                                 213   1e-62   Azospirillum halopraeferens
ref|WP_021234978.1|  NADH dehydrogenase                                 213   1e-62   Novosphingobium lindaniclasticum
ref|WP_029992709.1|  NADH dehydrogenase                                 213   1e-62   Sphingomonas sp. YL-JM2C
ref|WP_012049188.1|  NADH dehydrogenase                                 213   1e-62   Sphingomonas wittichii
ref|WP_016747801.1|  MULTISPECIES: NADH dehydrogenase                   213   1e-62   Sphingomonas wittichii
ref|WP_007680671.1|  NADH dehydrogenase                                 213   1e-62   Novosphingobium sp. AP12
ref|WP_030538560.1|  NADH dehydrogenase                                 213   1e-62   Sphingobium sp. DC-2
ref|WP_037454031.1|  NADH dehydrogenase                                 213   1e-62   Sphingobium chlorophenolicum
ref|WP_022676297.1|  NADH dehydrogenase                                 213   2e-62   Novosphingobium sp. B-7
ref|WP_021247126.1|  NADH dehydrogenase                                 213   2e-62   Sphingobium baderi
ref|WP_008994010.1|  NADH dehydrogenase                                 213   2e-62   Novosphingobium sp. Rr 2-17
emb|CCQ73872.1|  NADH-quinone oxidoreductase chain F (NADH dehydr...    212   2e-62   Magnetospira sp. QH-2
ref|WP_029940891.1|  NADH dehydrogenase                                 212   2e-62   Sphingomonas astaxanthinifaciens
ref|WP_008065930.1|  NADH dehydrogenase                                 212   3e-62   Novosphingobium nitrogenifigens
ref|WP_017665628.1|  NADH dehydrogenase                                 212   3e-62   Porphyrobacter sp. AAP82
ref|WP_037530715.1|  NADH dehydrogenase                                 212   3e-62   Sphingomonas sp. RIT328
ref|WP_029724233.1|  NADH dehydrogenase                                 212   3e-62   
ref|WP_033924534.1|  NADH dehydrogenase                                 212   3e-62   Sphingomonas sp. 35-24ZXX
ref|WP_043948889.1|  NADH dehydrogenase                                 212   4e-62   Candidatus Phaeomarinobacter ectocarpi
gb|KIY99198.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1          213   4e-62   Monoraphidium neglectum
ref|WP_023837697.1|  NADH dehydrogenase                                 212   4e-62   
ref|WP_029728655.1|  MULTISPECIES: NADH dehydrogenase                   212   4e-62   Sphingomonas sp. UNC305MFCol5.2
ref|WP_036800582.1|  NADH dehydrogenase                                 212   4e-62   Porphyrobacter sp. HL-46
ref|WP_036522913.1|  NADH dehydrogenase                                 212   4e-62   Novosphingobium resinovorum
ref|WP_008833057.1|  NADH dehydrogenase                                 212   4e-62   Sphingomonas sp. LH128
ref|WP_037463278.1|  NADH dehydrogenase                                 212   4e-62   Sphingobium herbicidovorans
ref|WP_011445938.1|  NADH dehydrogenase                                 211   5e-62   Novosphingobium
ref|WP_021688865.1|  NADH-quinone oxidoreductase subunit F              211   5e-62   Novosphingobium tardaugens
ref|WP_039094424.1|  NADH dehydrogenase                                 211   5e-62   Porphyrobacter mercurialis
ref|WP_043059758.1|  NADH dehydrogenase                                 211   6e-62   Sphingomonas
ref|WP_024310282.1|  NADH dehydrogenase                                 211   6e-62   Sphingomonas
ref|WP_029014788.1|  NADH dehydrogenase                                 211   6e-62   Niveispirillum irakense
ref|WP_043975210.1|  NADH dehydrogenase                                 211   8e-62   Novosphingobium sp. P6W
ref|WP_012974708.1|  NADH dehydrogenase                                 211   1e-61   Azospirillum lipoferum
ref|XP_002676765.1|  predicted protein                                  212   1e-61   Naegleria gruberi strain NEG-M
ref|WP_006832206.1|  NADH dehydrogenase                                 210   1e-61   Erythrobacter sp. SD-21
ref|WP_039393244.1|  NADH dehydrogenase                                 210   1e-61   Novosphingobium sp. MBES04
ref|WP_019833724.1|  NADH dehydrogenase                                 210   1e-61   Sphingomonas sp. PR090111-T3T-6A
ref|WP_010237552.1|  NADH dehydrogenase                                 210   1e-61   Citromicrobium
ref|WP_011414258.1|  NADH dehydrogenase                                 210   1e-61   Erythrobacter litoralis
ref|WP_040963884.1|  NADH dehydrogenase                                 210   2e-61   Erythrobacter vulgaris
ref|WP_013847133.1|  NADH dehydrogenase                                 210   2e-61   Sphingobium chlorophenolicum
ref|WP_019367956.1|  NADH dehydrogenase                                 210   2e-61   Sphingomonas
ref|WP_013039722.1|  NADH dehydrogenase                                 210   2e-61   Sphingobium japonicum
gb|KDD75042.1|  respiratory-chain NADH dehydrogenase                    211   2e-61   Helicosporidium sp. ATCC 50920
ref|WP_021316173.1|  NADH dehydrogenase                                 210   2e-61   Sphingobium ummariense
ref|WP_014248414.1|  NADH dehydrogenase                                 210   2e-61   Azospirillum
ref|WP_009821726.1|  NADH dehydrogenase                                 210   2e-61   Sphingomonadaceae
ref|WP_028639475.1|  NADH dehydrogenase                                 209   2e-61   Novosphingobium acidiphilum
ref|WP_024020170.1|  NADH dehydrogenase                                 210   2e-61   Sphingobium sp. C100
ref|WP_028464840.1|  NADH dehydrogenase                                 209   3e-61   Nisaea denitrificans
ref|WP_010545146.1|  NADH dehydrogenase                                 209   3e-61   Sphingomonas elodea
ref|WP_027299907.1|  NADH dehydrogenase                                 209   4e-61   Rhodospirillales bacterium URHD0088
ref|WP_020818896.1|  MULTISPECIES: NADH dehydrogenase                   209   4e-61   Sphingobium
ref|WP_027841388.1|  NADH dehydrogenase                                 209   4e-61   
ref|WP_021225746.1|  NADH dehydrogenase                                 209   4e-61   Sphingobium lactosutens
ref|WP_019516619.1|  NADH dehydrogenase                                 209   4e-61   Sphingomonas sp. Mn802worker
ref|WP_033919941.1|  NADH dehydrogenase                                 209   6e-61   Sphingomonas sp. 37zxx
ref|WP_007684860.1|  MULTISPECIES: NADH dehydrogenase                   209   6e-61   Sphingomonadaceae
ref|WP_025549538.1|  MULTISPECIES: NADH dehydrogenase                   209   6e-61   Sphingobium
ref|WP_034161255.1|  NADH dehydrogenase                                 209   6e-61   Sphingomonas sp. ERG5
ref|WP_037507532.1|  NADH dehydrogenase                                 209   6e-61   Sphingobium yanoikuyae
ref|WP_004211735.1|  MULTISPECIES: NADH dehydrogenase                   209   6e-61   Sphingomonadaceae
ref|WP_017501783.1|  NADH dehydrogenase                                 209   7e-61   Sphingobium yanoikuyae
ref|WP_008599588.1|  NADH-ubiquinone oxidoreductase chain F             208   7e-61   Pacificimonas flava
ref|NP_001032653.1|  uncharacterized protein LOC641566                  209   7e-61   Danio rerio [leopard danio]
ref|WP_007670157.1|  NADH dehydrogenase                                 208   8e-61   alpha proteobacterium BAL199
ref|XP_003083193.1|  PREDICTED P0503D09.102 gene product [Oryza s...    210   8e-61   Ostreococcus tauri
ref|WP_018687649.1|  MULTISPECIES: NADH dehydrogenase                   208   8e-61   Ahrensia
ref|WP_033073248.1|  NADH dehydrogenase                                 208   9e-61   Sphingopyxis sp. MWB1
ref|WP_019643599.1|  NADH dehydrogenase                                 208   1e-60   Novispirillum itersonii
ref|WP_012112155.1|  NADH dehydrogenase                                 208   1e-60   Parvibaculum lavamentivorans
ref|WP_010402597.1|  NADH dehydrogenase                                 208   1e-60   Sphingomonas echinoides
ref|WP_037501935.1|  NADH dehydrogenase                                 208   1e-60   Sphingomonas jaspsi
ref|WP_029794038.1|  NADH dehydrogenase                                 208   1e-60   
ref|WP_037553867.1|  NADH dehydrogenase                                 207   1e-60   Sphingopyxis sp. LC363
ref|WP_039573805.1|  NADH dehydrogenase                                 207   1e-60   Sphingopyxis fribergensis
ref|WP_037510824.1|  NADH dehydrogenase                                 207   1e-60   Sphingopyxis sp. LC81
ref|WP_014240125.1|  NADH dehydrogenase                                 207   2e-60   Azospirillum
gb|EFA77854.1|  ubiquinone oxidoreductase                               209   2e-60   Heterostelium album PN500
ref|WP_010163520.1|  NADH dehydrogenase                                 207   2e-60   Sphingomonas sp. PAMC 26617
ref|WP_037447264.1|  NADH dehydrogenase                                 207   2e-60   Skermanella stibiiresistens
ref|WP_010216648.1|  NADH dehydrogenase                                 207   2e-60   Sphingomonas sp. PAMC 26621
ref|WP_010187238.1|  NADH dehydrogenase                                 207   2e-60   Sphingomonas sp. PAMC 26605
ref|WP_008836442.1|  NADH dehydrogenase I subunit F                     202   2e-60   Mesorhizobium alhagi
ref|WP_008943642.1|  NADH dehydrogenase                                 207   2e-60   Oceanibaculum indicum
ref|WP_025294485.1|  NADH dehydrogenase                                 207   3e-60   Sphingomonas sanxanigenens
ref|WP_026942073.1|  NADH dehydrogenase                                 207   3e-60   
ref|XP_004334975.1|  NADH oxidoreductase (quinone), F subunit           208   3e-60   Acanthamoeba castellanii str. Neff
ref|WP_014076634.1|  NADH dehydrogenase                                 207   3e-60   Sphingobium sp. SYK-6
dbj|GAM25560.1|  hypothetical protein SAMD00019534_087350               208   3e-60   Acytostelium subglobosum LB1
ref|WP_038463727.1|  NADH dehydrogenase                                 206   3e-60   Candidatus Paracaedibacter acanthamoebae
ref|WP_011541601.1|  NADH dehydrogenase                                 207   3e-60   Sphingopyxis alaskensis
ref|WP_015467644.1|  NADH-ubiquinone oxidoreductase chain F             206   4e-60   Micavibrio aeruginosavorus
ref|WP_003051586.1|  NADH dehydrogenase I subunit F                     206   4e-60   Sphingopyxis
ref|WP_014102910.1|  NADH dehydrogenase                                 206   5e-60   Micavibrio aeruginosavorus
ref|WP_021776285.1|  Ribosome-recycling factor Ribosome-releasing...    206   5e-60   Candidatus Micropelagos thuwalensis
ref|WP_007065967.1|  NADH dehydrogenase                                 206   5e-60   Fulvimarina pelagi
ref|WP_009450020.1|  NADH dehydrogenase                                 206   6e-60   Nitratireductor indicus
ref|WP_012566435.1|  NADH dehydrogenase                                 206   7e-60   Rhodospirillum centenum
gb|EER39748.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           201   8e-60   Histoplasma capsulatum H143
ref|WP_011389435.1|  NADH dehydrogenase                                 206   8e-60   Rhodospirillum rubrum
ref|WP_008594076.1|  NADH dehydrogenase                                 206   9e-60   Nitratireductor pacificus
ref|WP_008125212.1|  NADH dehydrogenase                                 205   1e-59   Phyllobacterium sp. YR531
ref|WP_029639590.1|  NADH dehydrogenase                                 205   1e-59   alpha proteobacterium Mf 1.05b.01
ref|XP_004366877.1|  ubiquinone oxidoreductase                          206   1e-59   Cavenderia fasciculata
ref|WP_044426144.1|  NADH dehydrogenase                                 204   2e-59   Skermanella aerolata
gb|EZF34518.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    203   2e-59   Trichophyton interdigitale H6
ref|WP_040849821.1|  NADH dehydrogenase                                 204   3e-59   Nitrospirillum amazonense
ref|WP_013045019.1|  NADH dehydrogenase                                 204   3e-59   Candidatus Puniceispirillum marinum
dbj|GAA82965.1|  mitochondrial proton-pumping NADH:ubiquinone red...    206   3e-59   Aspergillus kawachii IFO 4308
gb|AGG11582.1|  hypothetical protein                                    205   3e-59   Paratrypanosoma confusum
ref|WP_019995315.1|  NADH dehydrogenase                                 204   4e-59   Aureimonas ureilytica
ref|WP_025030253.1|  NADH dehydrogenase                                 204   4e-59   Nitratireductor aquibiodomus
ref|WP_017668562.1|  NADH dehydrogenase                                 204   5e-59   Sandarakinorhabdus sp. AAP62
ref|XP_006677383.1|  hypothetical protein BATDEDRAFT_31463              204   5e-59   Batrachochytrium dendrobatidis JAM81
ref|WP_025899021.1|  NADH dehydrogenase                                 203   5e-59   Sneathiella glossodoripedis
ref|XP_010294266.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    196   5e-59   Phaethon lepturus
ref|WP_028794902.1|  NADH dehydrogenase                                 203   6e-59   Thalassobaculum
gb|EKG13364.1|  NADH:ubiquinone oxidoreductase 51kDa subunit cons...    205   6e-59   Macrophomina phaseolina MS6
gb|ACD86941.1|  mitochondrial NADH dehydrogenase                        196   6e-59   Caenorhabditis brenneri
ref|WP_039190117.1|  NADH dehydrogenase                                 203   6e-59   Aureimonas altamirensis
ref|WP_013951501.1|  NADH dehydrogenase                                 203   7e-59   Candidatus Midichloria mitochondrii
ref|WP_008517430.1|  NADH dehydrogenase                                 203   7e-59   alpha proteobacterium IMCC14465
ref|XP_004992882.1|  NADH dehydrogenase flavoprotein 1                  204   9e-59   Salpingoeca rosetta
gb|EQL35664.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    205   1e-58   Blastomyces dermatitidis ATCC 26199
ref|WP_037991319.1|  NADH dehydrogenase                                 202   1e-58   Thalassospira
ref|WP_013421202.1|  NADH dehydrogenase                                 202   1e-58   Rhodomicrobium vannielii
ref|WP_007089411.1|  NADH dehydrogenase                                 202   1e-58   Thalassospira
ref|WP_037236592.1|  NADH dehydrogenase                                 202   1e-58   Rhodomicrobium udaipurense
ref|XP_002626317.1|  NADH oxidoreductase F subunit                      205   1e-58   Blastomyces gilchristii SLH14081
ref|WP_039710902.1|  NADH dehydrogenase                                 202   1e-58   
ref|XP_001746110.1|  hypothetical protein                               203   1e-58   Monosiga brevicollis MX1
ref|XP_003293586.1|  ubiquinone oxidoreductase                          204   1e-58   Dictyostelium purpureum
ref|XP_005846008.1|  NADH:ubiquinone oxidoreductase 51 kD subunit       202   1e-58   
ref|WP_025286704.1|  NADH dehydrogenase                                 202   1e-58   
ref|WP_025318936.1|  NADH dehydrogenase                                 202   1e-58   
ref|WP_022697743.1|  NADH dehydrogenase                                 202   1e-58   
ref|XP_001820209.1|  NADH-ubiquinone oxidoreductase subunit             204   1e-58   
ref|WP_011632004.1|  NADH dehydrogenase                                 202   2e-58   
ref|XP_001544556.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    202   2e-58   
emb|CDH52430.1|  nadh dehydrogenase                                     203   2e-58   
emb|CDS08258.1|  Putative NADH dehydrogenase                            203   2e-58   
ref|WP_024585839.1|  NADH dehydrogenase                                 202   2e-58   
emb|CCO31229.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         195   2e-58   
ref|WP_028033464.1|  NADH dehydrogenase                                 202   2e-58   
ref|WP_038603941.1|  NADH dehydrogenase                                 201   3e-58   
gb|EXX75592.1|  hypothetical protein RirG_040580                        203   3e-58   
ref|WP_010298333.1|  NADH dehydrogenase                                 201   3e-58   
ref|WP_044564086.1|  NADH dehydrogenase                                 201   3e-58   
gb|ESA23531.1|  hypothetical protein GLOINDRAFT_90893                   203   4e-58   
ref|WP_009603664.1|  NADH dehydrogenase                                 201   4e-58   
ref|WP_015827573.1|  NADH dehydrogenase                                 201   4e-58   
ref|WP_031447625.1|  NADH dehydrogenase                                 201   4e-58   
ref|WP_014745489.1|  NADH dehydrogenase                                 201   5e-58   
ref|WP_009209803.1|  NADH dehydrogenase                                 201   5e-58   
gb|EGD97924.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           203   5e-58   
ref|WP_036481140.1|  NADH dehydrogenase                                 201   5e-58   
ref|XP_003232357.1|  NADH-ubiquinone oxidoreductase subunit             203   5e-58   
gb|EWG41860.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    199   6e-58   
ref|WP_022679122.1|  NADH dehydrogenase                                 201   6e-58   
ref|XP_003011447.1|  hypothetical protein ARB_02297                     203   6e-58   
ref|WP_011643299.1|  NADH dehydrogenase                                 201   6e-58   
ref|XP_001401928.1|  NADH-ubiquinone oxidoreductase subunit             202   6e-58   
gb|EZF34517.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    203   6e-58   
gb|EWY95413.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    199   6e-58   
gb|EZF26364.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    203   7e-58   
ref|WP_017930621.1|  NADH dehydrogenase                                 201   7e-58   
ref|WP_032112088.1|  NADH dehydrogenase                                 201   7e-58   
ref|XP_009080329.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    196   7e-58   
ref|WP_011580367.1|  NADH dehydrogenase                                 201   7e-58   
ref|XP_003170860.1|  NADH-ubiquinone oxidoreductase subunit             203   8e-58   
ref|WP_014415955.1|  NADH dehydrogenase                                 200   8e-58   
ref|XP_009984411.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    196   9e-58   
ref|WP_020185828.1|  NADH dehydrogenase                                 200   9e-58   
dbj|BAQ17516.1|  NADH-ubiquinone oxidoreductase chain F                 200   9e-58   
ref|XP_002584388.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      202   1e-57   
dbj|GAN02266.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, m...    201   1e-57   
gb|EGC43211.1|  NADH-ubiquinone oxidoreductase                          202   1e-57   
ref|WP_018996882.1|  NADH dehydrogenase                                 200   1e-57   
ref|XP_003020846.1|  hypothetical protein TRV_05072                     204   1e-57   
sp|Q92406.1|NDUV1_ASPNG  RecName: Full=NADH-ubiquinone oxidoreduc...    201   1e-57   
gb|EEH08161.1|  NADH-ubiquinone oxidoreductase                          202   1e-57   
ref|XP_003065710.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    202   1e-57   
ref|XP_001247741.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    202   1e-57   
gb|EFW21501.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           202   1e-57   
gb|KIX02114.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    202   1e-57   
gb|KIE04594.1|  NADH-quinone oxidoreductase subunit F                   198   1e-57   
ref|XP_007873661.1|  hypothetical protein PNEG_01698                    201   1e-57   
emb|CAM76334.1|  NADH-quinone oxidoreductase, F subunit                 199   1e-57   
ref|WP_024079563.1|  NADH-quinone oxidoreductase chain 1                199   2e-57   
ref|WP_006274418.1|  NADH dehydrogenase                                 200   2e-57   
gb|KFH71991.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    201   2e-57   
gb|ESQ89562.1|  NADH dehydrogenase                                      200   2e-57   
ref|WP_023448667.1|  NADH dehydrogenase                                 199   2e-57   
emb|CCX31452.1|  Similar to NADH-ubiquinone oxidoreductase 51 kDa...    201   2e-57   
ref|WP_024351151.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_031236817.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_003630522.1|  NADH dehydrogenase                                 200   2e-57   
ref|WP_019088399.1|  NADH dehydrogenase                                 200   2e-57   
ref|XP_002844435.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      202   2e-57   
gb|ELQ42182.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           207   2e-57   
ref|WP_027044898.1|  NADH dehydrogenase                                 199   2e-57   
gb|ELQ68779.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit           207   2e-57   
dbj|GAL98026.1|  NADH dehydrogenase                                     199   2e-57   
ref|WP_009867771.1|  COG1894: NADH:ubiquinone oxidoreductase, NAD...    199   2e-57   
ref|WP_006116563.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_019014342.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_035380843.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_003625278.1|  NADH-quinone oxidoreductase chain F                199   2e-57   
dbj|GAK44564.1|  NADH dehydrogenase I subunit F                         199   2e-57   
ref|WP_006559074.1|  NADH dehydrogenase                                 199   2e-57   
gb|EPS33450.1|  hypothetical protein PDE_08412                          201   2e-57   
ref|WP_038540086.1|  NADH dehydrogenase                                 199   2e-57   
ref|WP_027058091.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_023670819.1|  MULTISPECIES: NADH dehydrogenase                   199   3e-57   
ref|WP_020944128.1|  NADH dehydrogenase I subunit F                     200   3e-57   
ref|WP_027029566.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_023685198.1|  NADH dehydrogenase                                 199   3e-57   
ref|XP_007782152.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    201   3e-57   
gb|EPB92081.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    200   3e-57   
ref|WP_040969945.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_023757138.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_013531094.1|  MULTISPECIES: NADH dehydrogenase                   199   3e-57   
ref|WP_040999127.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_023812385.1|  MULTISPECIES: NADH dehydrogenase                   199   3e-57   
ref|WP_012591908.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_027168998.1|  NADH dehydrogenase                                 199   3e-57   
ref|WP_019961878.1|  NADH dehydrogenase                                 199   3e-57   
ref|XP_001587658.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    201   3e-57   
gb|KFV85242.1|  hypothetical protein N308_15779                         195   3e-57   
ref|WP_029057164.1|  NADH dehydrogenase                                 199   3e-57   
gb|KFR07518.1|  hypothetical protein Y956_16042                         195   3e-57   
ref|XP_009680887.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    195   4e-57   
ref|WP_027051249.1|  NADH dehydrogenase                                 199   4e-57   
gb|EQK99628.1|  NADH:ubiquinone oxidoreductase, 51kDa subunit           197   4e-57   
ref|WP_006335677.1|  NADH-quinone oxidoreductase chain F (NADH de...    199   4e-57   
ref|WP_006203247.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_027145292.1|  NADH dehydrogenase                                 199   4e-57   
gb|ABY55763.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1          191   4e-57   
ref|WP_040982034.1|  MULTISPECIES: NADH dehydrogenase                   199   4e-57   
gb|EFX78613.1|  hypothetical protein DAPPUDRAFT_53209                   199   4e-57   
ref|WP_015317342.1|  MULTISPECIES: NADH dehydrogenase                   199   4e-57   
ref|WP_035363262.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_013894812.1|  MULTISPECIES: NADH dehydrogenase                   199   4e-57   
ref|WP_023676626.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_027025974.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_023798856.1|  NADH dehydrogenase                                 199   4e-57   
gb|EWG41859.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    200   4e-57   
ref|WP_019858939.1|  MULTISPECIES: NADH dehydrogenase                   199   4e-57   
ref|WP_027156088.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_023720744.1|  NADH dehydrogenase                                 199   4e-57   
ref|WP_027232473.1|  NADH dehydrogenase                                 198   5e-57   
ref|XP_009472244.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    195   5e-57   
ref|WP_010910107.1|  NADH dehydrogenase                                 198   5e-57   
ref|WP_041007653.1|  NADH dehydrogenase                                 198   5e-57   
gb|EGU81374.1|  hypothetical protein FOXB_08103                         200   5e-57   
ref|XP_005534915.1|  NADH dehydrogenase I flavoprotein 51kDa subunit    200   5e-57   
gb|KFV66988.1|  hypothetical protein N307_09225                         195   5e-57   
gb|KIL58483.1|  hypothetical protein M378DRAFT_27540                    200   5e-57   
ref|WP_008876526.1|  NADH-quinone oxidoreductase chain F (NADH de...    198   5e-57   
gb|KGO38080.1|  NADH ubiquinone oxidoreductase, F subunit               200   5e-57   
emb|CCG83651.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, m...    199   5e-57   
ref|WP_039458234.1|  NADH dehydrogenase                                 198   6e-57   
ref|XP_001271969.1|  NADH-ubiquinone oxidoreductase, subunit F, p...    199   6e-57   
ref|WP_040620688.1|  NADH dehydrogenase                                 198   6e-57   
ref|WP_022699589.1|  NADH dehydrogenase                                 198   6e-57   
ref|WP_023463911.1|  NADH dehydrogenase                                 198   7e-57   
gb|EJW10821.1|  NADH-ubiquinone oxidoreductase chain F                  198   7e-57   
ref|WP_042787500.1|  NADH dehydrogenase                                 198   7e-57   
ref|XP_002842347.1|  hypothetical protein                               199   7e-57   
ref|WP_020178872.1|  NADH dehydrogenase                                 198   7e-57   
ref|WP_010686013.1|  NADH dehydrogenase I subunit F                     198   7e-57   
ref|WP_015930658.1|  NADH dehydrogenase                                 198   7e-57   
ref|XP_007730378.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    199   7e-57   
ref|XP_751723.1|  NADH-ubiquinone oxidoreductase, subunit F             199   7e-57   
ref|WP_022695504.1|  NADH dehydrogenase                                 198   8e-57   
dbj|GAD94458.1|  NADH-ubiquinone oxidoreductase, subunit F, putative    199   8e-57   
ref|WP_012319032.1|  MULTISPECIES: NADH dehydrogenase                   198   8e-57   
ref|XP_007752495.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    199   8e-57   
ref|XP_005426586.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    193   8e-57   
ref|WP_023750162.1|  NADH dehydrogenase                                 198   8e-57   
ref|WP_043353978.1|  MULTISPECIES: NADH dehydrogenase                   198   8e-57   
gb|KFO80506.1|  hypothetical protein N303_05673                         195   8e-57   
ref|WP_033070002.1|  NADH dehydrogenase                                 197   9e-57   
ref|XP_010222588.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    196   9e-57   
ref|WP_026261660.1|  NADH dehydrogenase                                 197   9e-57   
ref|WP_023829418.1|  NADH dehydrogenase                                 197   9e-57   
ref|XP_001213151.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    199   9e-57   
ref|WP_013079351.1|  NADH dehydrogenase                                 198   9e-57   
emb|CDS13291.1|  Putative NADH-ubiquinone oxidoreductase 51 kDasu...    198   9e-57   
ref|WP_022732395.1|  NADH dehydrogenase                                 197   9e-57   
ref|WP_036513605.1|  NADH dehydrogenase                                 197   9e-57   
ref|WP_029589226.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_026380108.1|  NADH dehydrogenase                                 197   1e-56   
emb|CCT64601.1|  probable NADH2 dehydrogenase (ubiquinone) flavop...    200   1e-56   
ref|XP_005972082.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    197   1e-56   
ref|WP_004615174.1|  NADH dehydrogenase subunit F                       197   1e-56   
ref|WP_044826898.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_035583430.1|  NADH dehydrogenase                                 197   1e-56   
ref|XP_663233.1|  NUBM_ASPNG NADH-ubiquinone oxidoreductase 51 kD...    199   1e-56   
gb|KGL83893.1|  hypothetical protein N309_15458                         194   1e-56   
ref|XP_006694503.1|  NADH:ubiquinone oxidoreductase 51 kDa subuni...    199   1e-56   
ref|WP_034765095.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_035082740.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_008891226.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_040485526.1|  NADH dehydrogenase                                 197   1e-56   
emb|CEG66995.1|  Putative NADH-ubiquinone oxidoreductase 51 kDa s...    198   1e-56   
ref|XP_003046817.1|  predicted protein                                  199   1e-56   
gb|KGO78410.1|  NADH ubiquinone oxidoreductase, F subunit               199   1e-56   
gb|EKV04743.1|  hypothetical protein PDIG_87350                         199   1e-56   
gb|ESR25117.1|  NADH-ubiquinone oxidoreductase chain F                  197   1e-56   
ref|WP_035074811.1|  NADH dehydrogenase                                 197   1e-56   
ref|XP_002435466.1|  NADH:ubiquinone oxidoreductase, NDUFV1/51kDa...    198   1e-56   
ref|WP_003598192.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_029352056.1|  NADH dehydrogenase                                 197   1e-56   
gb|AAF08194.2|AF146339_1  NADH:ubiquinone oxidoreductase 51 kDa s...    196   1e-56   
ref|XP_001906038.1|  hypothetical protein                               199   1e-56   
ref|WP_029913311.1|  NADH dehydrogenase                                 197   1e-56   
ref|WP_043550660.1|  NADH dehydrogenase                                 197   2e-56   
ref|XP_001017144.1|  NADH-quinone oxidoreductase, F subunit famil...    198   2e-56   
ref|WP_012452941.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_025300443.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_017486717.1|  NADH dehydrogenase                                 197   2e-56   
ref|XP_002341788.1|  NADH-ubiquinone oxidoreductase, subunit F, p...    198   2e-56   
ref|XP_005968363.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    197   2e-56   
ref|XP_002151246.1|  NADH-ubiquinone oxidoreductase, subunit F, p...    199   2e-56   
ref|XP_002564700.1|  Pc22g06720                                         198   2e-56   
ref|WP_034744107.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_009800980.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_035539956.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_036259810.1|  NADH dehydrogenase                                 197   2e-56   
ref|XP_001266908.1|  NADH-ubiquinone oxidoreductase, subunit F, p...    198   2e-56   
gb|ABN11995.1|  putative NADH dehydrogenase (ubiquinone) flavopro...    192   2e-56   
ref|WP_020398874.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_018698223.1|  NADH dehydrogenase                                 197   2e-56   
gb|KIW24941.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    198   2e-56   
ref|WP_013480270.1|  NADH dehydrogenase                                 197   2e-56   
ref|WP_009340780.1|  NADH dehydrogenase                                 197   2e-56   
ref|XP_002795180.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      198   2e-56   
gb|EEH20908.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...    198   3e-56   
ref|WP_009540295.1|  NADH-ubiquinone oxidoreductase chain F             196   3e-56   
ref|XP_001549682.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      198   3e-56   
emb|CDI99272.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1         197   3e-56   
ref|XP_010757543.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...    198   3e-56   
ref|WP_022722602.1|  NADH dehydrogenase                                 197   3e-56   
ref|WP_041319081.1|  NADH dehydrogenase                                 196   3e-56   
ref|XP_009898255.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    197   3e-56   
gb|AHB49570.1|  NADH dehydrogenase                                      196   3e-56   
ref|WP_034471202.1|  NADH dehydrogenase                                 196   3e-56   
ref|XP_007867136.1|  NADH-ubiquinone oxidoreductase                     198   3e-56   
gb|EHL00399.1|  putative NADH-ubiquinone oxidoreductase 51 kDa su...    194   3e-56   
ref|WP_018080119.1|  NADH dehydrogenase                                 196   3e-56   
ref|WP_027835258.1|  NADH dehydrogenase                                 196   3e-56   
gb|KIL93351.1|  nadh-ubiquinone oxidoreductase 51 kda mitochondrial     197   3e-56   



>ref|XP_010452860.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERADRELLQAAA
Sbjct  472  RIRERADRELLQAAA  486



>ref|XP_010491494.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERADRELLQAAA
Sbjct  472  RIRERADRELLQAAA  486



>gb|AFK41633.1| unknown [Medicago truncatula]
Length=165

 Score =   259 bits (661),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  31   KHVCDDVLMDYDALKAVGSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  90

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  91   TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  150

Query  346  RIRERADRELLQAAA  302
            RI+E A RELLQA  
Sbjct  151  RIKENAQRELLQATG  165



>ref|XP_011086756.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=487

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERAD+EL QAAA
Sbjct  472  RIRERADQELQQAAA  486



>ref|XP_011086755.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=488

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  353  KHICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  412

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  413  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  472

Query  346  RIRERADRELLQAAA  302
            RIRERAD+EL QAAA
Sbjct  473  RIRERADQELQQAAA  487



>ref|XP_011071205.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Sesamum indicum]
Length=486

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RIRERADREL QAAA
Sbjct  471  RIRERADRELQQAAA  485



>ref|XP_010251339.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like, 
partial [Nelumbo nucifera]
Length=252

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            +H+C+DVLMD+DALKAVQ+GLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  117  RHICDDVLMDYDALKAVQTGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  176

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  177  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  236

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+ AA
Sbjct  237  RIRERAEKELLEVAA  251



>gb|EYU42106.1| hypothetical protein MIMGU_mgv1a005364mg [Erythranthe guttata]
Length=487

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KDICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERADREL QAAA
Sbjct  472  RIRERADRELQQAAA  486



>ref|XP_009615859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=487

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE ADREL QAAA
Sbjct  472  RIREHADRELQQAAA  486



>ref|XP_002514955.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
 gb|EEF47509.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
Length=486

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TPWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RI+ERA+RELL+AAA
Sbjct  472  RIKERAERELLEAAA  486



>ref|XP_010911159.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Elaeis guineensis]
Length=523

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  388  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  447

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  448  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  507

Query  346  RIRERADRELLQAAA  302
            RIR+RAD+ELL+AAA
Sbjct  508  RIRDRADKELLEAAA  522



>ref|XP_009609277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
 ref|XP_009609278.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=487

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE A+REL QAAA
Sbjct  472  RIREHAERELQQAAA  486



>ref|NP_001275120.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Solanum tuberosum]
 emb|CAA58823.1| NADH dehydrogenase [Solanum tuberosum]
Length=487

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE A+REL QAAA
Sbjct  472  RIREHAERELQQAAA  486



>ref|XP_009770074.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009770075.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=486

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RIRE A+REL QAAA
Sbjct  471  RIREHAERELQQAAA  485



>ref|XP_008799963.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X4 [Phoenix dactylifera]
Length=488

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  353  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  412

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  413  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  472

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+AAA
Sbjct  473  RIRERAEKELLEAAA  487



>ref|XP_004232268.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Solanum lycopersicum]
Length=487

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE A+REL QAAA
Sbjct  472  RIREHAERELQQAAA  486



>gb|KDP26775.1| hypothetical protein JCGZ_17933 [Jatropha curcas]
Length=486

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RI+ERA+RELL+AAA
Sbjct  472  RIKERAERELLEAAA  486



>ref|NP_001148767.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACG32826.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
Length=504

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVG+AKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELE+
Sbjct  430  TPWLWMIMERLKVGDAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELEK  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>ref|XP_008799962.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X3 [Phoenix dactylifera]
Length=502

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  367  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  426

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  427  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  486

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+AAA
Sbjct  487  RIRERAEKELLEAAA  501



>ref|XP_010546277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=487

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RI ERA+RELL  AA
Sbjct  472  RIMERAERELLVEAA  486



>ref|XP_009785204.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana sylvestris]
Length=487

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE ADREL  AAA
Sbjct  472  RIREHADRELQHAAA  486



>ref|XP_008799960.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=531

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  396  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  455

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  456  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  515

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+AAA
Sbjct  516  RIRERAEKELLEAAA  530



>ref|XP_008360129.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Malus domestica]
Length=486

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+AAA
Sbjct  472  RIRERAEKELLEAAA  486



>ref|XP_008799961.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=523

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  388  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  447

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  448  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  507

Query  346  RIRERADRELLQAAA  302
            RIRERA++ELL+AAA
Sbjct  508  RIRERAEKELLEAAA  522



>ref|XP_003557368.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brachypodium distachyon]
Length=535

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAV+VMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  400  KHICDDVLMDYDALKAVQSGLGTAAVMVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  459

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  460  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  519

Query  346  RIRERADRELLQAAA  302
            RIR+RADRELL AA+
Sbjct  520  RIRDRADRELLTAAS  534



>dbj|BAJ94094.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAV+VMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVMVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIR+RADRELL AA+
Sbjct  490  RIRDRADRELLMAAS  504



>ref|XP_011041538.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
 ref|XP_011016388.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
Length=485

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RI+ERA+RELL+AAA
Sbjct  471  RIKERAERELLEAAA  485



>ref|XP_002315622.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
 gb|EEF01793.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
Length=485

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RI+ERA+RELL+AAA
Sbjct  471  RIKERAERELLEAAA  485



>gb|EMT32185.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, mitochondrial 
[Aegilops tauschii]
Length=500

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAV+VMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  365  KHICDDVLMDYDALKAVQSGLGTAAVMVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  424

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  425  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  484

Query  346  RIRERADRELLQAAA  302
            RIR+RAD ELL AA+
Sbjct  485  RIRDRADSELLMAAS  499



>gb|EMS64088.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Triticum urartu]
Length=500

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAV+VMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  365  KHICDDVLMDYDALKAVQSGLGTAAVMVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  424

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  425  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  484

Query  346  RIRERADRELLQAAA  302
            RIR+RAD ELL AA+
Sbjct  485  RIRDRADSELLMAAS  499



>ref|XP_006438083.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
 gb|ESR51323.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
Length=454

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  320  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  379

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  380  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  439

Query  346  RIRERADRELLQAAA  302
            RI+E A+RELL+A A
Sbjct  440  RIKEHAERELLEATA  454



>ref|XP_006484064.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Citrus sinensis]
 gb|KDO81963.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81964.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81965.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81966.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
Length=486

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RI+E A+RELL+A A
Sbjct  472  RIKEHAERELLEATA  486



>ref|XP_009407142.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  360  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  419

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  420  TGWLWMIMERLKVGNAMLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  479

Query  346  RIRERADRELLQAAA  302
            RIRERA ++LL+AAA
Sbjct  480  RIRERAQKQLLEAAA  494



>ref|XP_006827286.1| hypothetical protein AMTR_s00010p00264240 [Amborella trichopoda]
 gb|ERM94523.1| hypothetical protein AMTR_s00010p00264240 [Amborella trichopoda]
Length=487

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  349  KNICDDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  408

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  409  TGWLWMMMERLKVGNAKLEEIDMLQEITKQIEGHTICALGDAAAWPVQGLIRHFRPELER  468

Query  346  RIRERADRELLQAAA  302
            RIR RA+RELL++A+
Sbjct  469  RIRSRAERELLESAS  483



>ref|XP_007045030.1| 51 kDa subunit of complex I [Theobroma cacao]
 gb|EOY00862.1| 51 kDa subunit of complex I [Theobroma cacao]
Length=486

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+K+GNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKIGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELL+A+A
Sbjct  472  RIREHAERELLEASA  486



>gb|AES60212.2| NADH-ubiquinone oxidoreductase 51 kDa subunit [Medicago truncatula]
Length=483

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  349  KHVCDDVLMDYDALKAVGSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  408

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  409  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  468

Query  346  RIRERADRELLQAAA  302
            RI+E A RELLQA  
Sbjct  469  RIKENAQRELLQATG  483



>ref|XP_006838360.1| hypothetical protein AMTR_s00002p00015430 [Amborella trichopoda]
 gb|ERN00929.1| hypothetical protein AMTR_s00002p00015430 [Amborella trichopoda]
Length=485

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+D+LMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  349  KDICDDLLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  408

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  409  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  468

Query  346  RIRERADRELLQAAA  302
            RI++RA RELL++AA
Sbjct  469  RIKDRAQRELLESAA  483



>gb|ACU24391.1| unknown [Glycine max]
Length=315

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+D+ MD+DALKAV +GLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  181  KHVCDDIFMDYDALKAVGTGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  240

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLI+HFRPELER
Sbjct  241  TGWLWTIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIKHFRPELER  300

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELLQA  
Sbjct  301  RIREHAERELLQATG  315



>gb|EPS65614.1| hypothetical protein M569_09162 [Genlisea aurea]
Length=512

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CEDVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  377  KSVCEDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  436

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGL+RHFRPELER
Sbjct  437  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLVRHFRPELER  496

Query  346  RIRERADRELLQAAA  302
            RIRE ADREL  AAA
Sbjct  497  RIREHADRELELAAA  511



>ref|XP_003589961.1| NADH-quinone oxidoreductase subunit F [Medicago truncatula]
Length=568

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  356  KHVCDDVLMDYDALKAVGSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  415

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  416  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  475

Query  346  RIRERADRELLQAAAN*LTVLL  281
            RI+E A RELLQA    +TVL+
Sbjct  476  RIKENAQRELLQATGV-VTVLM  496



>ref|XP_010682836.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  353  KHLCDDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  412

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  413  TGWLWMIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  472

Query  346  RIRERADRELLQA  308
            RI++ A +ELL+A
Sbjct  473  RIKDHAAKELLEA  485



>ref|XP_004497859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=483

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DV+MD+DALKAV +GLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  349  KNICDDVMMDYDALKAVNTGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  408

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  409  TGWLWMIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  468

Query  346  RIRERADRELLQAAA  302
            RIRE A RELLQA+ 
Sbjct  469  RIRENAQRELLQASG  483



>ref|XP_007145867.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
 gb|ESW17861.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
Length=482

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  348  KSICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  407

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLI+HFRPELER
Sbjct  408  TGWLWTIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIKHFRPELER  467

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELLQA  
Sbjct  468  RIRENAERELLQATG  482



>ref|XP_004497858.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=492

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DV+MD+DALKAV +GLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  358  KNICDDVMMDYDALKAVNTGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  417

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  418  TGWLWMIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  477

Query  346  RIRERADRELLQAAA  302
            RIRE A RELLQA+ 
Sbjct  478  RIRENAQRELLQASG  492



>ref|XP_003535239.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform 1 [Glycine max]
 gb|KHN10057.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+D+LMD+DALKAV +GLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  348  KHVCDDILMDYDALKAVGTGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  407

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLI+HFRPELER
Sbjct  408  TGWLWTIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIKHFRPELER  467

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELLQA  
Sbjct  468  RIREHAERELLQATG  482



>gb|AHA84169.1| NADH-quinone oxidoreductase subunit F [Phaseolus vulgaris]
Length=482

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  348  KSICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  407

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQG I+HFRPELER
Sbjct  408  TGWLWTIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGFIKHFRPELER  467

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELLQA  
Sbjct  468  RIRENAERELLQATG  482



>ref|XP_009385396.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  360  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  419

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL M+ME++KVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  420  TGWLRMIMEKLKVGNAMLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  479

Query  346  RIRERADRELLQAAA  302
            RI+ERA +ELL+AAA
Sbjct  480  RIKERAQKELLEAAA  494



>ref|XP_006574505.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Glycine max]
 gb|KHN00283.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+D+ MD+DALKAV +GLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  348  KHVCDDIFMDYDALKAVGTGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  407

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERMKVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLI+HFRPELER
Sbjct  408  TGWLWTIMERMKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIKHFRPELER  467

Query  346  RIRERADRELLQAAA  302
            RIRE A+RELLQA  
Sbjct  468  RIREHAERELLQATG  482



>ref|XP_001754412.1| predicted protein [Physcomitrella patens]
 gb|EDQ80862.1| predicted protein [Physcomitrella patens]
Length=462

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMDFDALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  325  KHICDDVLMDFDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  384

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            +PWLW +MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  385  SPWLWTMMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  444

Query  346  RIRERADRE  320
            RI ERA RE
Sbjct  445  RILERAARE  453



>ref|XP_001778863.1| predicted protein [Physcomitrella patens]
 gb|EDQ56313.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  326  KNICDDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  385

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            +PWLW +MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  386  SPWLWTMMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  445

Query  346  RIRERADRE  320
            RI ERA +E
Sbjct  446  RILERAAKE  454



>ref|XP_002977599.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
 gb|EFJ21603.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
Length=483

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  347  KKICDDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  406

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW LMERMKVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  407  TGWLWTLMERMKVGNAYLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  466

Query  346  RIRERADRELLQAAAN  299
            RI ERA RE    AA 
Sbjct  467  RILERAKREKQAVAAT  482



>ref|XP_002975195.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
 gb|EFJ23980.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
Length=460

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  324  KKICDDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  383

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW LMERMKVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  384  TGWLWTLMERMKVGNAYLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  443

Query  346  RIRERADRELLQAAAN  299
            RI ERA RE    AA 
Sbjct  444  RILERAKREKEAVAAT  459



>ref|XP_009131078.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Brassica rapa]
Length=487

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  353  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  412

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  413  TGWLWMIMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  472

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  473  RIRERAERELLQAAA  487



>ref|XP_009122464.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brassica rapa]
Length=486

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  472  RIRERAERELLQAAA  486



>ref|XP_010547695.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tarenaya hassleriana]
Length=486

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  472  RIRERAERELLQAAA  486



>ref|NP_196470.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Arabidopsis thaliana]
 sp|Q9FNN5.1|NDUV1_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10002.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAM12970.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAP31964.1| At5g08530 [Arabidopsis thaliana]
 gb|AED91315.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Arabidopsis thaliana]
Length=486

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  472  RIRERAERELLQAAA  486



>gb|AAM65274.1| NADH dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  472  RIRERAERELLQAAA  486



>ref|XP_006399352.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
 gb|ESQ40805.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
Length=407

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  273  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  332

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  333  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  392

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQ AA
Sbjct  393  RIRERAERELLQVAA  407



>ref|XP_002873369.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49628.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  472  RIRERAERELLQAAA  486



>ref|NP_001141093.1| uncharacterized protein LOC100273176 [Zea mays]
 gb|ACF85385.1| unknown [Zea mays]
Length=504

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVG+AKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TPWLWMIMERLKVGDAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>gb|ACF84291.1| unknown [Zea mays]
 gb|ACG32615.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACR36181.1| unknown [Zea mays]
 tpg|DAA63904.1| TPA: NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=504

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVG+AKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TPWLWMIMERLKVGDAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>ref|XP_006287433.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
 gb|EOA20331.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
Length=546

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  412  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  471

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPE+ER
Sbjct  472  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPEMER  531

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQAAA
Sbjct  532  RIRERAERELLQAAA  546



>ref|XP_006399353.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
 gb|ESQ40806.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
Length=486

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQ AA
Sbjct  472  RIRERAERELLQVAA  486



>ref|XP_010423066.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Camelina sativa]
Length=486

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQ AA
Sbjct  472  RIRERAERELLQVAA  486



>ref|XP_010459420.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KNVCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELLQ AA
Sbjct  472  RIRERAERELLQVAA  486



>ref|XP_004958515.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Setaria italica]
Length=504

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DV+MD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVMMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TPWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>ref|XP_005717522.1| NADH dehydrogenase I (Complex I) flavoprotein 51kDa subunit [Chondrus 
crispus]
 emb|CDF37651.1| NADH dehydrogenase I (Complex I) flavoprotein 51kDa subunit [Chondrus 
crispus]
Length=495

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            +H+CEDV MDFD+LKAV SGLGTAAVIVMDKSTD++ AIARLSYFYKHESCGQCTPCREG
Sbjct  360  RHVCEDVFMDFDSLKAVGSGLGTAAVIVMDKSTDVIAAIARLSYFYKHESCGQCTPCREG  419

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWMLMERMK G+AK+EEIDML E+TKQIEGHTICALGDAAAWPVQG+IRHFRPE ER
Sbjct  420  TGWLWMLMERMKAGDAKVEEIDMLWEITKQIEGHTICALGDAAAWPVQGVIRHFRPEFER  479

Query  346  RIRE  335
            RI E
Sbjct  480  RIAE  483



>gb|ACL53142.1| unknown [Zea mays]
 tpg|DAA41608.1| TPA: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase subunit 
[Zea mays]
Length=504

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVG+AKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TPWLWMIMERLKVGDAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>tpg|DAA41609.1| TPA: NADH-ubiquinone oxidoreductase subunit, mRNA [Zea mays]
Length=468

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  334  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  393

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            TPWLWM+MER+KVG+AKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  394  TPWLWMIMERLKVGDAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  453

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  454  RIRERAERELLAASA  468



>ref|XP_009403957.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=509

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DV+MD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  374  KHICDDVMMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  433

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  434  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  493

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  494  RIRERAERELLEAAA  508



>ref|XP_008222059.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Prunus mume]
Length=486

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  472  RIRERAERELLEAAA  486



>ref|XP_008340188.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X2 [Malus domestica]
Length=502

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  471  RIRERAERELLEAAA  485



>gb|KJB08870.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08871.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08872.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08873.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
Length=486

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+A+A
Sbjct  472  RIRERAERELLEASA  486



>gb|KJB50333.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=493

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  359  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  418

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  419  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  478

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+A+A
Sbjct  479  RIRERAERELLEASA  493



>ref|XP_007222426.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
 gb|EMJ23625.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
Length=486

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  472  RIRERAERELLEAAA  486



>gb|ADN33976.1| NADH-ubiquinone oxidoreductase flavoprotein [Cucumis melo subsp. 
melo]
Length=480

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  346  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  405

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI++FRPELER
Sbjct  406  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIKNFRPELER  465

Query  346  RIRERADRELLQAAA  302
            RIRERA+REL+QAAA
Sbjct  466  RIRERAERELIQAAA  480



>gb|KJB50332.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=486

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+A+A
Sbjct  472  RIRERAERELLEASA  486



>ref|XP_008340187.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X1 [Malus domestica]
Length=510

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  351  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  410

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  411  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  470

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  471  RIRERAERELLEAAA  485



>ref|XP_008443176.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
 ref|XP_008443177.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
Length=486

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI++FRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIKNFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+REL+QAAA
Sbjct  472  RIRERAERELIQAAA  486



>ref|XP_004136606.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163967.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Cucumis sativus]
Length=480

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  346  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  405

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI++FRPELER
Sbjct  406  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIKNFRPELER  465

Query  346  RIRERADRELLQAAA  302
            RIRERA+REL+QAAA
Sbjct  466  RIRERAERELIQAAA  480



>ref|NP_001060455.1| Os07g0645400 [Oryza sativa Japonica Group]
 dbj|BAC16718.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF22369.1| Os07g0645400 [Oryza sativa Japonica Group]
Length=504

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>ref|XP_010248930.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
 ref|XP_010248931.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
Length=487

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+V+AIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVNAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLWMIMERLKVGNAKLEEIDMLQEITKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  472  RIRERAERELLEAAA  486



>gb|EAZ04909.1| hypothetical protein OsI_27090 [Oryza sativa Indica Group]
Length=529

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  395  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  454

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  455  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  514

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  515  RIRERAERELLAASA  529



>ref|XP_010025340.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=483

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  349  KNICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  408

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  409  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  468

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  469  RIRERAERELLEAAA  483



>gb|KGN59382.1| hypothetical protein Csa_3G815460 [Cucumis sativus]
Length=486

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI++FRPELER
Sbjct  412  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIKNFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+REL+QAAA
Sbjct  472  RIRERAERELIQAAA  486



>ref|XP_010025338.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW61975.1| hypothetical protein EUGRSUZ_H04659 [Eucalyptus grandis]
Length=484

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  350  KNICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  409

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  410  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  469

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  470  RIRERAERELLEAAA  484



>ref|XP_010103203.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Morus notabilis]
 gb|EXB94989.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Morus notabilis]
Length=408

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  273  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  332

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNA LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  333  TGWLWMIMERLKVGNANLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  392

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL++AA
Sbjct  393  RIRERAERELLESAA  407



>gb|EAZ40868.1| hypothetical protein OsJ_25349 [Oryza sativa Japonica Group]
Length=514

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  380  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  439

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  440  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  499

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  500  RIRERAERELLAASA  514



>ref|XP_006658044.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Oryza brachyantha]
Length=504

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MER+K+GNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  430  TGWLWMIMERLKIGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  489

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL A+A
Sbjct  490  RIRERAERELLAASA  504



>ref|XP_002503039.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64297.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CE+VLMDFD+LK+ QSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  309  KSVCEEVLMDFDSLKSAQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  368

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +MERMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELE 
Sbjct  369  TGWLYAIMERMKKGDARLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELEA  428

Query  346  RIRERADRELLQA  308
            RI  +   E + A
Sbjct  429  RINAQPTSEQIAA  441



>ref|XP_003058710.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57165.1| predicted protein [Micromonas pusilla CCMP1545]
Length=468

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CE+VLMDFD+LK+ QSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  336  KKICEEVLMDFDSLKSAQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  395

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +MERMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELE 
Sbjct  396  TGWLYNVMERMKKGDARLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELEA  455

Query  346  RIRERADRELLQA  308
            RI  +   E + A
Sbjct  456  RINAQPSAEQIAA  468



>ref|XP_004310055.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KDICNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMK GNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPE+ER
Sbjct  412  TGWLWMIMERMKTGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPEMER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+A A
Sbjct  472  RIRERAERELLEATA  486



>ref|XP_007514630.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
 emb|CCO14870.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
Length=512

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CE+VLMDFD+LKA QSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  380  KKVCEEVLMDFDSLKAAQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  439

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +MERMK G+AKLEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELE 
Sbjct  440  TGWLYNVMERMKKGDAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQGLIRHFRPELEA  499

Query  346  RI  341
            RI
Sbjct  500  RI  501



>ref|XP_005650585.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
 gb|EIE26041.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
Length=467

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFDALK  QSGLGTAAVIVMDKSTDI+DAIARLSYFYKHESCGQCTPCREG
Sbjct  337  KRICDDVLMDFDALKEAQSGLGTAAVIVMDKSTDIIDAIARLSYFYKHESCGQCTPCREG  396

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
             PWL+ +M RMK G+A+LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPE+E 
Sbjct  397  APWLYDIMTRMKKGDARLEEIDMLWEVTKQIEGHTICALGDAAAWPVQGLIRHFRPEMEE  456

Query  346  RI  341
            RI
Sbjct  457  RI  458



>ref|XP_002266661.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Vitis vinifera]
Length=487

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  352  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  411

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL M+MER+KVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  412  TGWLLMMMERLKVGNANLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  471

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+ AA
Sbjct  472  RIRERAERELLEVAA  486



>emb|CAN73193.1| hypothetical protein VITISV_022287 [Vitis vinifera]
Length=489

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  354  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  413

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL M+MER+KVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  414  TGWLLMMMERLKVGNANLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  473

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+ AA
Sbjct  474  RIRERAERELLEVAA  488



>ref|XP_010644983.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Vitis vinifera]
Length=511

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  376  KHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  435

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL M+MER+KVGNA LEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  436  TGWLLMMMERLKVGNANLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  495

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+ AA
Sbjct  496  RIRERAERELLEVAA  510



>ref|XP_011398745.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25849.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
Length=462

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH CEDVLMDFDALK  QSGLGTAAVIVM+KSTD+++AIARLSYFYKHESCGQCTPCREG
Sbjct  329  KHACEDVLMDFDALKERQSGLGTAAVIVMNKSTDVIEAIARLSYFYKHESCGQCTPCREG  388

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M RMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRP +E+
Sbjct  389  TSWLYDVMTRMKAGDARLEEIDMLWELTKQIEGHTICALGDAAAWPVQGLIRHFRPLMEQ  448

Query  346  RIRERADRELLQAAA  302
            RI E+A  EL + AA
Sbjct  449  RI-EQAAEELQRIAA  462



>ref|XP_001702590.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP06369.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
Length=484

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDALK  QSGLGTAAVIVMDKSTD++DAIARLSYFYKHESCGQCTPCREG
Sbjct  350  KKICDGVLMDFDALKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESCGQCTPCREG  409

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M RMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFR E+E 
Sbjct  410  TGWLYDIMTRMKKGDARLEEIDMLWEITKQIEGHTICALGDAAAWPVQGLIRHFRGEMEE  469

Query  346  RIRERADRELLQAAA  302
            RI+    ++ L A A
Sbjct  470  RIKSAGGKKKLAATA  484



>ref|XP_002948368.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
 gb|EFJ50775.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
Length=489

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDALK  QSGLGTAAVIVMDKSTD++DAIARLSYFYKHESCGQCTPCREG
Sbjct  355  KKLCDTVLMDFDALKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESCGQCTPCREG  414

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M RMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFR E+E 
Sbjct  415  TGWLYDIMTRMKKGDARLEEIDMLWEITKQIEGHTICALGDAAAWPVQGLIRHFRHEMED  474

Query  346  RIRERADRELLQAAA  302
            RI+    RE + A A
Sbjct  475  RIKNAGAREKIAATA  489



>gb|AAQ63696.1| NADH:ubiquinone oxidoreductase 51 kD subunit [Chlamydomonas reinhardtii]
Length=484

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDALK  QSGLGTAAVIVMDKSTD++DAIARLSYFYKHESCGQCTPCREG
Sbjct  350  KKICDGVLMDFDALKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESCGQCTPCREG  409

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M RMK G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFR E+E 
Sbjct  410  TGWLYDIMTRMKKGDARLEEIDMLWEITKQIEGHTICALGDAAAWPVQGLIRHFRGEMEE  469

Query  346  RIRERADRELLQAAA  302
            RI+    ++ L A A
Sbjct  470  RIKSAGGKKKLAATA  484



>ref|WP_020696100.1| NADH dehydrogenase [Reyranella massiliensis]
Length=427

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+  +SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLRDQKSGLGTAAVIVMDKSTDIVKAIARLSYFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  GNA+LEEID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ER
Sbjct  356  TGWMWRVMERMVTGNARLEEIDALEDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMER  415

Query  346  RIRERADR  323
            RIR R ++
Sbjct  416  RIRARTEK  423



>ref|XP_009372324.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Pyrus x bretschneideri]
Length=487

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCT   E 
Sbjct  353  KDLCNDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTSVMEA  412

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLWM+MERMKVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  413  TGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  472

Query  346  RIRERADRELLQAAA  302
            RIRERA+RELL+AAA
Sbjct  473  RIRERAERELLEAAA  487



>gb|ACE96395.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96396.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96397.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96398.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  286  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  345

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  346  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  396



>gb|ACE96394.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96399.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  286  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  345

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  346  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  396



>gb|ACE96393.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96400.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  286  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  345

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  346  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  396



>gb|ACE96365.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96366.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  298  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  358  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  408



>gb|ACE96363.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96364.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96367.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96368.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96370.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96371.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96373.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96374.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96375.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96376.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96377.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96378.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96379.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96380.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96381.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96382.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96383.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96384.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96385.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96386.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96389.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96391.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  298  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  358  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  408



>gb|ACE96369.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96372.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96387.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96390.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96392.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  298  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAAWPVQGLI
Sbjct  358  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLI  408



>ref|WP_022687672.1| NADH dehydrogenase [Sphingomonas phyllosphaerae]
Length=434

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTD+V AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDVVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A++ EIDML +VTKQ+EGH+ICALGDAAAWPVQGLIRHFRPELERRIRER
Sbjct  363  RVMERLRTGDAEIGEIDMLQQVTKQVEGHSICALGDAAAWPVQGLIRHFRPELERRIRER  422

Query  331  -ADRELLQAAA  302
              D   +Q AA
Sbjct  423  GGDTAPMQEAA  433



>ref|XP_005702818.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Galdieria sulphuraria]
 gb|EME26298.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Galdieria sulphuraria]
Length=491

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DV+MDFDALK VQSGLGTAAVIVMDKSTDIV AIARLS FYKHESCGQCTPCREG
Sbjct  345  KSICDDVMMDFDALKEVQSGLGTAAVIVMDKSTDIVHAIARLSKFYKHESCGQCTPCREG  404

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERM+ G A  EEIDML+EVT+QIEGHTICALGDAAAWPVQGLIRHFR ELER
Sbjct  405  TGWLWNIMERMRRGEAAKEEIDMLNEVTRQIEGHTICALGDAAAWPVQGLIRHFRGELER  464

Query  346  RI  341
            RI
Sbjct  465  RI  466



>ref|WP_029624778.1| NADH dehydrogenase [Sphingomonas sp. KC8]
Length=438

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ GNA L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E+
Sbjct  368  RVMERLREGNADLSEIDMLHDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRILEK  427

Query  331  ADRELLQAAA  302
                 L  AA
Sbjct  428  QGSATLAVAA  437



>emb|CDP13320.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+CEDVLMDFDALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  370  KHICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  429

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQG  380
            T WLWM+MER+KVGNAKLEE+DML EVTKQIEGHTICALGDAAAWPVQG
Sbjct  430  TGWLWMIMERLKVGNAKLEEVDMLQEVTKQIEGHTICALGDAAAWPVQG  478



>ref|XP_001421384.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99677.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=449

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CEDVLMDFD+LK  QSGLGTAAVIVMDKSTD++DAIARLSYFYKHESCGQCTPCREG
Sbjct  315  KNVCEDVLMDFDSLKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESCGQCTPCREG  374

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M+RM  G+A+LEEID L E+TKQIEGHTICALGDAAAWP+QG+IRHFRP LE 
Sbjct  375  TSWLYNIMQRMVKGDARLEEIDTLQELTKQIEGHTICALGDAAAWPIQGVIRHFRPLLEE  434

Query  346  RIRE  335
            RI +
Sbjct  435  RISQ  438



>ref|WP_017184600.1| NADH dehydrogenase [Sphingobium xenophagum]
Length=443

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  315  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  374

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  375  RVMERLRTGDADLSEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINER  434

Query  331  A  329
             
Sbjct  435  G  435



>ref|WP_019053667.1| NADH dehydrogenase [Sphingobium xenophagum]
Length=443

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  315  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  374

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  375  RVMERLRTGDADLSEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINER  434

Query  331  A  329
             
Sbjct  435  G  435



>ref|WP_044331689.1| NADH dehydrogenase [Sphingomonas sp. WHSC-8]
 gb|AJP71870.1| NADH dehydrogenase [Sphingomonas sp. WHSC-8]
Length=432

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI ER
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRINER  421

Query  331  ADRELLQAAA  302
                 +Q AA
Sbjct  422  GGNAPMQEAA  431



>ref|WP_039331352.1| NADH dehydrogenase [Novosphingobium subterraneum]
 gb|KHS49177.1| NADH dehydrogenase I subunit F [Novosphingobium subterraneum]
Length=432

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML  VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E 
Sbjct  363  RVMERLRTGDADVEEIDMLFNVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIAEN  422

Query  331  ADRELLQAA  305
            A  EL +AA
Sbjct  423  ARPELSEAA  431



>ref|WP_038660313.1| NADH dehydrogenase [Sphingomonas taxi]
 gb|AIT05874.1| NADH dehydrogenase [Sphingomonas taxi]
Length=434

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID LH+VTKQ+EGHTICALGDAAAWP+QGLI+HFRPELERRI ER
Sbjct  362  RVMERLRTGDADIAEIDTLHQVTKQVEGHTICALGDAAAWPIQGLIKHFRPELERRINER  421

Query  331  ADREL--LQAAA  302
            +  +L  +Q AA
Sbjct  422  SGGDLTPMQEAA  433



>ref|WP_028970528.1| NADH dehydrogenase [Sphingomonas sp. URHD0057]
Length=436

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  307  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  366

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A++ +ID L +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPELERRI ER
Sbjct  367  RMMERLREGDAEVADIDKLLDVTKQVEGHTICALGDAAAWPIQGLVRHFRPELERRIAER  426

Query  331  ADRELLQAA  305
            A R +L+AA
Sbjct  427  AGRTMLEAA  435



>ref|WP_022672411.1| NADH dehydrogenase [Sphingopyxis baekryungensis]
Length=436

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMD+STDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  306  DAPMDFDGLKAVGSGLGTAAVIVMDRSTDIVQAISRISYFYKHESCGQCTPCREGTGWMW  365

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +ME+++ G+A++ +IDMLH+VTKQIEGHTICALGDAAAWP+QGLI+HFRPE+ERRI ER
Sbjct  366  RVMEKLRTGDAEISDIDMLHQVTKQIEGHTICALGDAAAWPIQGLIKHFRPEIERRIHER  425

Query  331  -ADRELLQAA  305
              D  +++AA
Sbjct  426  NGDTPMMEAA  435



>ref|XP_003343487.1| hypothetical protein SMAC_10529 [Sordaria macrospora k-hell]
Length=175

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTD+V AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  43   DAPMDFDGLKAVGSGLGTAAVIVMDKSTDVVRAISRLSYFYKHESCGQCTPCREGTGWMW  102

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EIDML +VTKQ+EGHTICALGDAAAWP+QGLI++FRPE+ERRI E+
Sbjct  103  RVMERLRTGDADISEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKNFRPEIERRINEK  162



>ref|WP_017671019.1| NADH dehydrogenase [Blastomonas sp. AAP53]
Length=432

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKEVGSGLGTAAVIVMDKSTDIVQAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L+EVTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  363  RVMERMRTGDADISEIDTLYEVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRIVEK  422

Query  331  ADRELLQAA  305
                L++AA
Sbjct  423  QGGGLMEAA  431



>ref|WP_006959713.1| NADH-ubiquinone oxidoreductase chain F [Sphingobium japonicum]
 emb|CCW18680.1| NADH-ubiquinone oxidoreductase chain F [Sphingobium japonicum 
BiD32]
Length=447

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  317  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  376

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE-  335
             +MER++ G+A L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI + 
Sbjct  377  RVMERLRTGDADLSEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINDN  436

Query  334  RADRELLQAA  305
            +    +++AA
Sbjct  437  KGGAPMMEAA  446



>ref|WP_037525772.1| NADH dehydrogenase [Sphingomonas wittichii]
Length=432

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A + EIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERLRTGEADISEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIGER  421

Query  331  ADRELLQAAA  302
                 L  AA
Sbjct  422  NGSAPLMEAA  431



>ref|WP_031393840.1| MULTISPECIES: NADH dehydrogenase [Sphingomonas]
 gb|KHA65579.1| NADH dehydrogenase [Sphingomonas sp. Ant20]
Length=433

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAA+IVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCAMDFDGLKAVGSGLGTAAIIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A+L EIDML +VTKQ+EGH+ICALGDAAAWP+QGLI+HFRPE+ERRIRER
Sbjct  362  RVMERMRTGDAELSEIDMLQQVTKQVEGHSICALGDAAAWPIQGLIKHFRPEMERRIRER  421

Query  331  A  329
             
Sbjct  422  G  422



>ref|WP_034957798.1| NADH dehydrogenase [Erythrobacter longus]
 gb|KEO91529.1| NADH dehydrogenase [Erythrobacter longus]
Length=430

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  MDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLWMLM  503
            MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W +M
Sbjct  305  MDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMWRMM  364

Query  502  ERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
            ER++ G+A++EEIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  365  ERLRTGDAEIEEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIEE  420



>ref|WP_007015102.1| MULTISPECIES: NADH dehydrogenase [Novosphingobium]
 emb|CCA93512.1| NADH dehydrogenase I subunit F [Novosphingobium sp. PP1Y]
 gb|EHJ58965.1| NADH dehydrogenase I subunit F [Novosphingobium pentaromativorans 
US6-1]
 gb|AIT78839.1| NADH dehydrogenase [Novosphingobium pentaromativorans US6-1]
Length=433

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E 
Sbjct  368  RVMERLRTGDAAVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAEN  427



>ref|WP_034904668.1| NADH dehydrogenase [Erythrobacter litoralis]
 gb|KEO92422.1| NADH dehydrogenase [Erythrobacter litoralis]
Length=430

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RVMERLRTGDAAIEEIDMLHDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAE  420



>ref|WP_028966979.1| NADH dehydrogenase [Sphingomonas phyllosphaerae]
Length=434

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTD+V AIARLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDVVRAIARLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A++ EIDML +VTKQ+EGH+ICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  363  RVMERLRTGDAEIGEIDMLQQVTKQVEGHSICALGDAAAWPIQGLIRHFRPELERRINER  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_021239945.1| MULTISPECIES: NADH dehydrogenase [Sphingomonadaceae]
 gb|EQA99265.1| NADH dehydrogenase [Sphingobium quisquiliarum P25]
 gb|EZP70811.1| NADH-quinone oxidoreductase chain F [Sphingomonas paucimobilis]
Length=438

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A + EIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRTGEADIGEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_037473959.1| NADH dehydrogenase [Sphingobium sp. ba1]
 gb|KFL45931.1| NADH dehydrogenase I chain F [Sphingobium sp. ba1]
Length=448

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  320  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  379

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A+L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI ER
Sbjct  380  RVMERLRTGEAELSEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRINER  439

Query  331  A  329
             
Sbjct  440  G  440



>ref|WP_043153511.1| NADH dehydrogenase [Sphingobium sp. Ant17]
 gb|EXS68908.1| NADH dehydrogenase [Sphingobium sp. Ant17]
Length=447

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  319  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  378

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A+L EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI ER
Sbjct  379  RVMERLRTGEAELSEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRINER  438

Query  331  A  329
             
Sbjct  439  G  439



>ref|WP_039284131.1| NADH dehydrogenase [Novosphingobium malaysiense]
 gb|KHK91604.1| NADH dehydrogenase [Novosphingobium malaysiense]
Length=435

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  307  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  366

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  367  RVMERLRTGEAHVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIEER  426

Query  331  ADRELLQAA  305
                L QAA
Sbjct  427  LG-SLQQAA  434



>ref|WP_007404054.1| MULTISPECIES: NADH dehydrogenase [Sphingomonas]
 gb|EGI56173.1| NADH oxidoreductase (quinone), F subunit [Sphingomonas sp. S17]
 dbj|GAN15045.1| NADH-quinone oxidoreductase subunit F [Sphingomonas paucimobilis 
NBRC 13935]
Length=436

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRIRER
Sbjct  362  RVMERMRTGDADVSEIDTLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRIRER  421



>ref|WP_042483195.1| NADH dehydrogenase [Sphingomonas parapaucimobilis]
 dbj|GAL99639.1| NADH-quinone oxidoreductase subunit F [Sphingomonas parapaucimobilis 
NBRC 15100]
Length=436

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRIRER
Sbjct  362  RVMERMRTGDADVSEIDTLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRIRER  421



>ref|WP_034954154.1| NADH dehydrogenase [Erythrobacter sp. JL475]
 gb|KEO87284.1| NADH dehydrogenase [Erythrobacter sp. JL475]
Length=431

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTA VIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKELGSGLGTAGVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  363  RVMERLRTGDAAIEEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIHE  421



>ref|WP_028055980.1| NADH dehydrogenase [Sphingobium sp. YL23]
Length=438

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A + EIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRSGEADIGEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_007164315.1| NADH dehydrogenase [Erythrobacter sp. NAP1]
 gb|EAQ30285.1| NADH-ubiquinone dehydrogenase chain F 1 [Erythrobacter sp. NAP1]
Length=430

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            +  MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  NAPMDFDGLKDLGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RVMERLRTGDAAIEEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIEE  420



>ref|WP_027135324.1| NADH dehydrogenase [Geminicoccus roseus]
Length=427

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K  C+ +LMDFD+L+AV SGLGTA VIVMDKSTD+V AIARLS FY HESCGQCTPCREG
Sbjct  295  KDTCDSILMDFDSLRAVTSGLGTAGVIVMDKSTDVVKAIARLSKFYMHESCGQCTPCREG  354

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERM  G  +LE+ID+L +VTK+IEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  355  TGWLWRMMERMVKGECRLEDIDLLQDVTKEIEGHTICALGDAAAWPVQGLIRHFRPELER  414

Query  346  RIRERADRELLQA  308
            RIRE+ +   L A
Sbjct  415  RIREQGEARRLAA  427



>ref|WP_010413354.1| NADH dehydrogenase [Citromicrobium sp. JLT1363]
Length=431

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +M+R++ G+A ++EIDMLH VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  363  RVMKRLETGDADIDEIDMLHTVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRITER  422

Query  331  AD  326
            AD
Sbjct  423  AD  424



>ref|WP_027442082.1| NADH dehydrogenase [Porphyrobacter cryptus]
Length=430

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            +  MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  NAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  362  RMMERLRTGDAAIEEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIHER  421

Query  331  A  329
            +
Sbjct  422  S  422



>ref|WP_042084460.1| NADH dehydrogenase [alpha proteobacterium Q-1]
 dbj|GAK32924.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[alpha proteobacterium Q-1]
Length=431

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+LK VQSGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREG
Sbjct  297  KSICDTVLMDFDSLKEVQSGLGTAAVIVMDKSTDIVKAIARLSYFYKHESCGQCTPCREG  356

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+ +G A+ EEIDML +V+KQ+EGHTICALGDAAAWP+QGL+RHFR E+ER
Sbjct  357  TGWMWRVMERLVLGKAEKEEIDMLLDVSKQVEGHTICALGDAAAWPIQGLMRHFRDEVER  416

Query  346  RIRERADRELLQAA  305
            RI     R++ +AA
Sbjct  417  RIDVYHGRQVTEAA  430



>gb|ACE96388.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+DVLMD+DALKAV SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  298  KHICDDVLMDYDALKAVTSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLI  374
            T WLWM+MER+KVGNAKLEEIDML EVTKQIEGHTICALGDAAA PVQGLI
Sbjct  358  TGWLWMIMERLKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAARPVQGLI  408



>ref|WP_022688780.1| NADH dehydrogenase [Sphingomonas-like bacterium B12]
Length=433

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRI  341
             +MER++ GNA++EEIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI
Sbjct  362  RVMERLREGNAEVEEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRI  418



>ref|WP_029008457.1| NADH dehydrogenase [Azospirillum halopraeferens]
Length=430

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+  +SGLGTAAVIVMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLRDARSGLGTAAVIVMDKSTDIVKAIARLSQFYAHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL  +M+RM  GNA++EEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPE+ER
Sbjct  356  TGWLNRVMQRMVKGNARVEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPEMER  415

Query  346  RIRE  335
            RI E
Sbjct  416  RILE  419



>ref|WP_021234978.1| NADH dehydrogenase [Novosphingobium lindaniclasticum]
 gb|EQB12009.1| NADH dehydrogenase [Novosphingobium lindaniclasticum LE124]
Length=433

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRI  341
             +MER++ GNA++EEIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPELERRI
Sbjct  368  RVMERLRTGNAEVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPELERRI  424



>ref|WP_029992709.1| NADH dehydrogenase [Sphingomonas sp. YL-JM2C]
Length=432

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A+++EID L +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERRIRER
Sbjct  362  RVMERLRTGEARIDEIDTLLDVTKQVEGHTICALGDAAAWPIQGLLRHFRPEVERRIRER  421

Query  331  ADRELLQAAA  302
             +   +  AA
Sbjct  422  GNDGAMMEAA  431



>ref|WP_012049188.1| NADH dehydrogenase [Sphingomonas wittichii]
 gb|ABQ69339.1| NADH-quinone oxidoreductase, F subunit [Sphingomonas wittichii 
RW1]
Length=432

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A+++EID L +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERRIRER
Sbjct  362  RVMERLRTGEARIDEIDTLLDVTKQVEGHTICALGDAAAWPIQGLLRHFRPEVERRIRER  421

Query  331  A-DRELLQAA  305
              D  +++AA
Sbjct  422  GNDGAMMEAA  431



>ref|WP_016747801.1| MULTISPECIES: NADH dehydrogenase [Sphingomonas]
Length=432

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A+++EID L +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERRIRER
Sbjct  362  RVMERLRTGEARIDEIDTLLDVTKQVEGHTICALGDAAAWPIQGLLRHFRPEVERRIRER  421

Query  331  A-DRELLQAA  305
              D  +++AA
Sbjct  422  GNDGAMMEAA  431



>ref|WP_007680671.1| NADH dehydrogenase [Novosphingobium sp. AP12]
 gb|EJL32411.1| NADH-quinone oxidoreductase, F subunit [Novosphingobium sp. AP12]
Length=436

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 2/130 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI  R
Sbjct  368  RVMERLRTGDAHVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIEAR  427

Query  331  ADRELLQAAA  302
                 LQ AA
Sbjct  428  TGS--LQEAA  435



>ref|WP_030538560.1| NADH dehydrogenase [Sphingobium sp. DC-2]
Length=438

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE-  335
             +MER++ G A + EIDMLHEVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRTGEADIGEIDMLHEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  334  RADRELLQAA  305
            +    +++AA
Sbjct  428  KGGAPVMEAA  437



>ref|WP_037454031.1| NADH dehydrogenase [Sphingobium chlorophenolicum]
 gb|KEQ52488.1| NADH-quinone oxidoreductase chain F [Sphingobium chlorophenolicum]
Length=438

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRSGDADISEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_022676297.1| NADH dehydrogenase [Novosphingobium sp. B-7]
Length=430

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLRALGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML  VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI  R
Sbjct  363  RVMERLRTGDADVEEIDMLFNVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAAR  422

Query  331  AD  326
            AD
Sbjct  423  AD  424



>ref|WP_021247126.1| NADH dehydrogenase [Sphingobium baderi]
 gb|EQA96955.1| NADH dehydrogenase [Sphingobium baderi LL03]
Length=436

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A+  EIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  368  RVMERLRTGDAEQSEIDMLFEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINER  427

Query  331  A  329
             
Sbjct  428  G  428



>ref|WP_008994010.1| NADH dehydrogenase [Novosphingobium sp. Rr 2-17]
 gb|EIZ80264.1| NADH dehydrogenase I subunit F [Novosphingobium sp. Rr 2-17]
Length=436

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A ++EIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPELERRI ER
Sbjct  368  RMMERLRTGDAHIDEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPELERRIVER  427



>emb|CCQ73872.1| NADH-quinone oxidoreductase chain F (NADH dehydrogenase I, chain 
F) (NDH-1, chain F) [Magnetospira sp. QH-2]
Length=424

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD L+ V SGLGTAAVIVMDKSTDIV AI RLS FY HESCGQCTPCREG
Sbjct  295  KSVCDTVLMDFDGLREVGSGLGTAAVIVMDKSTDIVRAITRLSRFYSHESCGQCTPCREG  354

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER++ GNA ++EID+L EVT+Q+EGHTICALGDAAAWP+QGLIRHFRPELER
Sbjct  355  TGWMWRVMERLQTGNATIDEIDLLEEVTRQVEGHTICALGDAAAWPIQGLIRHFRPELER  414

Query  346  RIRER  332
            RI+E 
Sbjct  415  RIKEN  419



>ref|WP_029940891.1| NADH dehydrogenase [Sphingomonas astaxanthinifaciens]
Length=436

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  307  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  366

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A  + ID LH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  367  RIMERLREGDASPDMIDRLHDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAER  426

Query  331  ADRELLQAA  305
               +L +AA
Sbjct  427  NGGQLAEAA  435



>ref|WP_008065930.1| NADH dehydrogenase [Novosphingobium nitrogenifigens]
 gb|EGD58920.1| NADH dehydrogenase I subunit F [Novosphingobium nitrogenifigens 
DSM 19370]
Length=430

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML  VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  363  RVMERLRTGDASVEEIDMLFNVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAER  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_017665628.1| NADH dehydrogenase [Porphyrobacter sp. AAP82]
Length=434

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            +  MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  NAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E 
Sbjct  362  RMMERLRTGDAAIEEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRINEH  421

Query  331  ADR  323
              R
Sbjct  422  NAR  424



>ref|WP_037530715.1| NADH dehydrogenase [Sphingomonas sp. RIT328]
 gb|EZP57547.1| NADH oxidoreductase (Quinone), F subunit [Sphingomonas sp. RIT328]
Length=434

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERLRTGDADIAEIDTLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIIER  421

Query  331  ADREL--LQAAA  302
            +  +L  +Q AA
Sbjct  422  SGGDLAPMQEAA  433



>ref|WP_029724233.1| NADH dehydrogenase [Sphingomonas sp. JGI 0001003-D23]
Length=434

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+ V SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCAMDFDGLRGVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRINER  421

Query  331  A  329
            +
Sbjct  422  S  422



>ref|WP_033924534.1| NADH dehydrogenase [Sphingomonas sp. 35-24ZXX]
Length=433

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKEVGSGLGTAAVIVMDKSTDIVQAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L+EVTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  363  RVMERMRTGDADISEIDTLYEVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRIVEK  422

Query  331  ADRELLQAAA  302
                 L  AA
Sbjct  423  QGSVSLMEAA  432



>ref|WP_043948889.1| NADH dehydrogenase [Candidatus Phaeomarinobacter ectocarpi]
 emb|CDO60973.1| NADH-ubiquinone oxidoreductase chain F [Candidatus Phaeomarinobacter 
ectocarpi]
Length=434

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDALK VQSGLGTAAVIVMDKSTDI+ AIARLSYFYKHESCGQCTPCREG
Sbjct  296  KDICDTVLMDFDALKDVQSGLGTAAVIVMDKSTDIIKAIARLSYFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  G A+++EID L +VTKQ+EGHTICALGDAAAWPVQG+IRHFRPE E 
Sbjct  356  TGWMWRVMERMAKGEAEVDEIDTLLKVTKQVEGHTICALGDAAAWPVQGVIRHFRPEFEA  415

Query  346  RIRER  332
            RI  R
Sbjct  416  RIAAR  420



>gb|KIY99198.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Monoraphidium 
neglectum]
Length=462

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMD+DALK  QSGLGTAAVIVMDKSTD++DAIARLSYFYKHESCGQCTPCREG
Sbjct  330  KKICDTVLMDYDALKEAQSGLGTAAVIVMDKSTDVIDAIARLSYFYKHESCGQCTPCREG  389

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL+ +M RM  G+A+LEEIDML E+TKQIEGHTICALGDAAAWPVQGLIRH RPE+E 
Sbjct  390  TGWLYDIMTRMVKGDARLEEIDMLWEITKQIEGHTICALGDAAAWPVQGLIRHMRPEMED  449

Query  346  RIRERADRELLQAA  305
            RI+  A +E + AA
Sbjct  450  RIK-FAHQERIAAA  462



>ref|WP_023837697.1| NADH dehydrogenase [Blastomonas sp. CACIA14H2]
 gb|ESZ87475.1| NADH dehydrogenase [Blastomonas sp. CACIA14H2]
Length=433

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKDVGSGLGTAAVIVMDKSTDIVQAISRISYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A L EID L+EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E+
Sbjct  363  RVMERMRTGDADLSEIDTLYEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRIIEK  422

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  423  QGTGSMMEAA  432



>ref|WP_029728655.1| MULTISPECIES: NADH dehydrogenase [Sphingomonas]
Length=434

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+ V SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCAMDFDGLRGVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRINER  421

Query  331  A  329
            +
Sbjct  422  S  422



>ref|WP_036800582.1| NADH dehydrogenase [Porphyrobacter sp. HL-46]
Length=430

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            +  MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  NAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RMMERLRTGDAAIEEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRINE  420



>ref|WP_036522913.1| NADH dehydrogenase [Novosphingobium resinovorum]
 gb|EZP84847.1| NADH dehydrogenase I subunit F [Novosphingobium resinovorum]
Length=436

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI  R
Sbjct  368  RVMERLRTGDAHVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIEAR  427



>ref|WP_008833057.1| NADH dehydrogenase [Sphingomonas sp. LH128]
 gb|EJU09555.1| NADH dehydrogenase I subunit F [Sphingomonas sp. LH128]
Length=436

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI  R
Sbjct  368  RVMERLRTGDAHVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIEAR  427



>ref|WP_037463278.1| NADH dehydrogenase [Sphingobium herbicidovorans]
 gb|KFG91079.1| NADH-quinone oxidoreductase chain F [Sphingobium herbicidovorans 
NBRC 16415]
Length=438

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE-  335
             +MER++ G A + EIDMLH+VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRSGEADIGEIDMLHQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  334  RADRELLQAA  305
            +    +++AA
Sbjct  428  KGGAPVMEAA  437



>ref|WP_011445938.1| NADH dehydrogenase [Novosphingobium aromaticivorans]
 gb|ABD26732.1| NADH dehydrogenase subunit F [Novosphingobium aromaticivorans 
DSM 12444]
Length=428

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML  VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  363  RVMERLRTGDADVEEIDMLFNVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAEN  422

Query  331  A  329
            A
Sbjct  423  A  423



>ref|WP_021688865.1| NADH-quinone oxidoreductase subunit F [Novosphingobium tardaugens]
 dbj|GAD47958.1| NADH-quinone oxidoreductase subunit F [Novosphingobium tardaugens 
NBRC 16725]
Length=427

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKEVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RMMERLRTGDAAVEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAE  420



>ref|WP_039094424.1| NADH dehydrogenase [Kirrobacter mercurialis]
 gb|KHL25767.1| NADH dehydrogenase [Kirrobacter mercurialis]
Length=430

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLKALGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A++ EIDML+EVTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI ++
Sbjct  362  RVMERLRTGDAEVSEIDMLYEVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIGDK  421

Query  331  A  329
            A
Sbjct  422  A  422



>ref|WP_043059758.1| NADH dehydrogenase [Sphingomonas taxi]
 gb|KIU29411.1| NADH dehydrogenase [Sphingomonas taxi]
Length=434

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI  R
Sbjct  362  RVMERLRTGDADIAEIDTLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRINSR  421

Query  331  ADREL--LQAAA  302
               +L  +Q AA
Sbjct  422  NGGDLAPMQEAA  433



>ref|WP_024310282.1| NADH dehydrogenase [Sphingomonas melonis]
Length=434

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI  R
Sbjct  362  RVMERLRTGDADIAEIDTLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRINSR  421

Query  331  ADREL--LQAAA  302
               +L  +Q AA
Sbjct  422  NGGDLAPMQEAA  433



>ref|WP_029014788.1| NADH dehydrogenase [Niveispirillum irakense]
Length=432

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+ V+SGLGTAAVIVMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  295  KEICDTVLMDFDSLREVRSGLGTAAVIVMDKSTDIVRAIARLSKFYMHESCGQCTPCREG  354

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+  GNA++EEIDML +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ER
Sbjct  355  TGWMWRVMERLVKGNARVEEIDMLLDVTKQVEGHTICALGDAAAWPIQGLMRHFRPEVER  414

Query  346  RI---RERADRELLQAA  305
            RI   R  A+R +  AA
Sbjct  415  RILEYRTHAERGVRVAA  431



>ref|WP_043975210.1| NADH dehydrogenase [Novosphingobium sp. P6W]
 gb|KIS32010.1| NADH dehydrogenase [Novosphingobium sp. P6W]
Length=436

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 2/130 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKAVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A ++EIDML +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI  R
Sbjct  368  RVMERLRTGDAHVDEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIEAR  427

Query  331  ADRELLQAAA  302
                 LQ AA
Sbjct  428  TGS--LQEAA  435



>ref|WP_012974708.1| NADH dehydrogenase [Azospirillum lipoferum]
 dbj|BAI72781.1| NADH dehydrogenase I chain F [Azospirillum sp. B510]
Length=429

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+ VQSGLGTAAVIVMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLREVQSGLGTAAVIVMDKSTDIVKAIARLSSFYAHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+  +M+RM  GNA+LEEIDML +VTKQ+EGHTICALGDAAAWP+QGL RHFRPE+ER
Sbjct  356  TGWMSRVMQRMVTGNARLEEIDMLLQVTKQVEGHTICALGDAAAWPIQGLFRHFRPEVER  415

Query  346  RIRERADRELLQA  308
            RI+   +   L A
Sbjct  416  RIQAYRNSAPLAA  428



>ref|XP_002676765.1| predicted protein [Naegleria gruberi]
 gb|EFC44021.1| predicted protein [Naegleria gruberi]
Length=480

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +CE VLMDFDAL+ VQSGLGTAAV+VMDKSTDIVDAIARLS FY HESCGQCTPCREG
Sbjct  341  KEICETVLMDFDALREVQSGLGTAAVMVMDKSTDIVDAIARLSKFYAHESCGQCTPCREG  400

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL  +M+RM  GNA++EEID L EV++QIEGHTICALGDAAAWPVQGLIRHFR E+E 
Sbjct  401  TGWLLNMMDRMVKGNAEIEEIDTLEEVSRQIEGHTICALGDAAAWPVQGLIRHFRGEMED  460

Query  346  RIRERADRELLQAAAN  299
            RI++  + E  + A N
Sbjct  461  RIKKYKNAEKAKRARN  476



>ref|WP_006832206.1| NADH dehydrogenase [Erythrobacter sp. SD-21]
 gb|EDL50384.1| NADH-ubiquinone dehydrogenase chain F 1 [Erythrobacter sp. SD-21]
Length=430

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTA VIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKDLGSGLGTAGVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RMMERLRTGDAAIEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIEE  420



>ref|WP_039393244.1| NADH dehydrogenase [Novosphingobium sp. MBES04]
 dbj|GAM06524.1| NADH dehydrogenase I subunit F [Novosphingobium sp. MBES04]
Length=433

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MD+D LKAV SGLGTAA+IVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  308  DCPMDYDGLKAVGSGLGTAAIIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E 
Sbjct  368  RVMERLRTGDASVEEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAEN  427



>ref|WP_019833724.1| NADH dehydrogenase [Sphingomonas sp. PR090111-T3T-6A]
Length=432

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ GNA + EIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI  +
Sbjct  362  RVMERLREGNADVSEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAAK  421

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  422  RGEAPVAVAA  431



>ref|WP_010237552.1| NADH dehydrogenase [Citromicrobium bathyomarinum]
Length=431

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +M+R++ G+A ++EIDMLH VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  363  RVMKRLETGDADIDEIDMLHTVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAER  422

Query  331  AD  326
             +
Sbjct  423  GE  424



>ref|WP_011414258.1| NADH dehydrogenase [Erythrobacter litoralis]
 gb|ABC63422.1| NADH-ubiquinone dehydrogenase chain F 1 [Erythrobacter litoralis 
HTCC2594]
Length=430

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  682  MDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLWMLM  503
            MDFD LK V SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W +M
Sbjct  305  MDFDGLKDVGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMWRMM  364

Query  502  ERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
            ER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  365  ERLRTGDAAIEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIEE  420



>ref|WP_040963884.1| NADH dehydrogenase [Erythrobacter vulgaris]
Length=430

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTA VIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKDLGSGLGTAGVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER++ G+A +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI E
Sbjct  362  RMMERLRTGDAAIEEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIEE  420



>ref|WP_013847133.1| NADH dehydrogenase [Sphingobium chlorophenolicum]
 gb|AEG48871.1| NADH-quinone oxidoreductase, F subunit [Sphingobium chlorophenolicum 
L-1]
Length=438

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRSGDADISEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_019367956.1| NADH dehydrogenase [Sphingomonas sp. ATCC 31555]
Length=434

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERLRTGDADISEIDTLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINER  421

Query  331  ADR--ELLQAAA  302
                 E +Q AA
Sbjct  422  KSGGIETMQEAA  433



>ref|WP_013039722.1| NADH dehydrogenase [Sphingobium japonicum]
 dbj|BAI96161.1| NADH dehydrogenase I chain F [Sphingobium japonicum UT26S]
Length=438

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>gb|KDD75042.1| respiratory-chain NADH dehydrogenase [Helicosporidium sp. ATCC 
50920]
Length=458

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  697  CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPW  518
            C +VLMDFDALK  QSGLGTAAVIVMDKSTD++ AIARLSYFYKHESCGQCTPCREGT W
Sbjct  329  CGEVLMDFDALKERQSGLGTAAVIVMDKSTDVIAAIARLSYFYKHESCGQCTPCREGTTW  388

Query  517  LWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIR  338
            L+ +M RMK G+A++EEIDML E+TKQIEGHTICALGDAAAWPVQGLIRHFRP +E+RI 
Sbjct  389  LYDIMSRMKKGDARVEEIDMLWELTKQIEGHTICALGDAAAWPVQGLIRHFRPVMEQRIE  448

Query  337  ERAD  326
            + A+
Sbjct  449  QAAE  452



>ref|WP_021316173.1| NADH dehydrogenase [Sphingobium ummariense]
 gb|EQB34139.1| NADH dehydrogenase [Sphingobium ummariense RL-3]
Length=445

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  317  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  376

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A + EIDML EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  377  RVMERLRSGEADISEIDMLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIIER  436

Query  331  A  329
             
Sbjct  437  G  437



>ref|WP_014248414.1| NADH dehydrogenase [Azospirillum lipoferum]
 emb|CBS87425.1| NADH-quinone oxidoreductase, subunit F [Azospirillum lipoferum 
4B]
Length=429

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+ VQSGLGTAAVIVMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLREVQSGLGTAAVIVMDKSTDIVKAIARLSSFYAHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+  +M+RM  GNA++EEIDML +VTKQ+EGHTICALGDAAAWP+QGL RHFRPE+ER
Sbjct  356  TGWMSRVMQRMVTGNARMEEIDMLLQVTKQVEGHTICALGDAAAWPIQGLFRHFRPEVER  415

Query  346  RIRERADRELLQA  308
            RI+   +   L A
Sbjct  416  RIQAYRNSAPLAA  428



>ref|WP_009821726.1| NADH dehydrogenase [Sphingomonas sp. SKA58]
 gb|EAT09246.1| NADH-quinone oxidoreductase, F subunit [Sphingomonas sp. SKA58]
Length=445

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  317  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  376

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  377  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAER  436

Query  331  A  329
             
Sbjct  437  G  437



>ref|WP_028639475.1| NADH dehydrogenase [Novosphingobium acidiphilum]
Length=430

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAIARLSYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  363  RVMERLRTGDADVSEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAEN  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_024020170.1| NADH dehydrogenase [Sphingobium sp. C100]
 gb|ETI63420.1| NADH dehydrogenase [Sphingobium sp. C100]
Length=447

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  317  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  376

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  377  RVMERLRTGDADQSEIDMLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  436

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  437  KGSAPVMEAA  446



>ref|WP_028464840.1| NADH dehydrogenase [Nisaea denitrificans]
Length=431

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD+L+ V +GLGTAAVIVM+K TDIV AIARLSYFYKHESCGQCTPCREG
Sbjct  296  KSVCDDVLMDFDSLREVGAGLGTAAVIVMNKQTDIVRAIARLSYFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W++ +M+R+  G A++EEID L+EVTKQIEGHTICALGDAAAWP+QGL+RHFRPE+ER
Sbjct  356  TGWMYRVMDRLCRGEAEVEEIDALYEVTKQIEGHTICALGDAAAWPIQGLLRHFRPEVER  415

Query  346  RIRER-ADRELLQAA  305
            RI  R A + +L+AA
Sbjct  416  RIEARKAGQPVLEAA  430



>ref|WP_010545146.1| NADH dehydrogenase [Sphingomonas elodea]
Length=434

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  362  RVMERLRTGDADISEIDTLQQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRITER  421

Query  331  ADR--ELLQAAA  302
                 E +Q AA
Sbjct  422  KSGGIETMQEAA  433



>ref|WP_027299907.1| NADH dehydrogenase [Rhodospirillales bacterium URHD0088]
Length=429

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDAL+ V+SGLGTAAVIVMDKSTDI+ AIARL+ FYKHESCGQCTPCREG
Sbjct  295  KSICDTVLMDFDALRDVKSGLGTAAVIVMDKSTDIIKAIARLAKFYKHESCGQCTPCREG  354

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  GNA +EEIDML  V+ +IEGHTICALGDAAAWP+QGLIRHFRPE+E+
Sbjct  355  TGWMWRVMERMVKGNASVEEIDMLLNVSFEIEGHTICALGDAAAWPIQGLIRHFRPEMEQ  414

Query  346  RIRERADRELLQAAA  302
            RI++  D  +   AA
Sbjct  415  RIKDYRDAAVRSRAA  429



>ref|WP_020818896.1| MULTISPECIES: NADH dehydrogenase [Sphingobium]
 gb|EPR16464.1| NADH dehydrogenase [Sphingobium chinhatense IP26]
 gb|EQA98888.1| NADH dehydrogenase [Sphingobium sp. HDIP04]
 gb|KER35654.1| NADH dehydrogenase [Sphingobium lucknowense F2]
Length=438

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRTGDADQGEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_027841388.1| NADH dehydrogenase [Mastigocoleus testarum]
Length=433

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDALK VQSGLGTAAVIVMDKSTD++ AIARLSYFYKHESCGQCTPCREG
Sbjct  296  KDICDTVLMDFDALKEVQSGLGTAAVIVMDKSTDVIKAIARLSYFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  G A++EEID L +VTKQ+EGHTICALGDAAAWP+QG+IRHFR E E 
Sbjct  356  TGWMWRVMERMAKGEAEVEEIDTLLKVTKQVEGHTICALGDAAAWPIQGVIRHFRHEFED  415

Query  346  RIRERADRE  320
            RI  R  R+
Sbjct  416  RIAARKARQ  424



>ref|WP_021225746.1| NADH dehydrogenase [Sphingobium lactosutens]
 gb|EQB15614.1| NADH dehydrogenase [Sphingobium lactosutens DS20]
Length=445

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  317  DAPMDFDGLKALGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  376

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI ER
Sbjct  377  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIAER  436

Query  331  A  329
             
Sbjct  437  G  437



>ref|WP_019516619.1| NADH dehydrogenase [Sphingomonas sp. Mn802worker]
Length=437

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  303  DCPMDFDGLKGVGSGLGTAAVIVMDKSTDVVRAISRISYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A++ EIDML +VTKQ+EGH+ICALGDAAAWP+QGLI+HFRPELERRI ER
Sbjct  363  RVMERLRTGDAEIGEIDMLQQVTKQVEGHSICALGDAAAWPIQGLIKHFRPELERRINER  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_033919941.1| NADH dehydrogenase [Sphingomonas sp. 37zxx]
Length=434

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKELGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI ER
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRITER  421

Query  331  ADRE  320
               E
Sbjct  422  QGGE  425



>ref|WP_007684860.1| MULTISPECIES: NADH dehydrogenase [Sphingomonadaceae]
 gb|EIM68120.1| NADH dehydrogenase I subunit F [Sphingobium indicum B90A]
 gb|KEY98163.1| NADH dehydrogenase [Sphingomonas sp. BHC-A]
Length=438

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRSGDADQGEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_025549538.1| MULTISPECIES: NADH dehydrogenase [Sphingobium]
 gb|AJR26532.1| NADH dehydrogenase [Sphingobium sp. YBL2]
Length=438

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  308  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  367

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  368  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  427

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  428  KGSAPVMEAA  437



>ref|WP_034161255.1| NADH dehydrogenase [Sphingomonas sp. ERG5]
Length=434

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRIIEK  421



>ref|WP_037507532.1| NADH dehydrogenase [Sphingobium yanoikuyae]
 gb|KFD28895.1| NADH dehydrogenase [Sphingobium yanoikuyae]
Length=444

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  314  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  373

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  374  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  433

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  434  KGSAPVMEAA  443



>ref|WP_004211735.1| MULTISPECIES: NADH dehydrogenase [Sphingobium]
 gb|EJK78823.1| NADH-quinone oxidoreductase, F subunit [Sphingobium sp. AP49]
 gb|EKU73500.1| NADH-quinone oxidoreductase subunit F 1 [Sphingobium yanoikuyae 
ATCC 51230]
Length=444

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  314  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  373

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  374  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  433

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  434  KGSAPVMEAA  443



>ref|WP_017501783.1| NADH dehydrogenase [Sphingobium yanoikuyae]
 gb|KEZ17627.1| NADH-quinone oxidoreductase chain F [Sphingobium yanoikuyae]
Length=448

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  318  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  377

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A   EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E 
Sbjct  378  RVMERLRTGDADQSEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEN  437

Query  331  ADRELLQAAA  302
                 +  AA
Sbjct  438  KGSAPVMEAA  447



>ref|WP_008599588.1| NADH-ubiquinone oxidoreductase chain F [alpha proteobacterium 
JLT2015]
 gb|EMD84271.1| NADH-ubiquinone oxidoreductase chain F [alpha proteobacterium 
JLT2015]
Length=433

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+ ++SGLGTAA+IVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  305  DCPMDFDGLRDLKSGLGTAAIIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  364

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER+  G A++EEIDMLH+VTK++EGHTICALGDAAAWP+QGLIRHFRPELERRI  R
Sbjct  365  RVMERLVTGQAEVEEIDMLHDVTKEVEGHTICALGDAAAWPIQGLIRHFRPELERRIAAR  424

Query  331  ADRELLQAA  305
             +  +L+AA
Sbjct  425  KN-AMLEAA  432



>ref|NP_001032653.1| uncharacterized protein LOC641566 [Danio rerio]
Length=479

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K++CE+VLMDFD+L A QSGLGTAAVIVM+K TD+V AIARLS FYKHESCGQCTPCREG
Sbjct  342  KNLCEEVLMDFDSLLAAQSGLGTAAVIVMNKQTDVVKAIARLSEFYKHESCGQCTPCREG  401

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL  +M R   GNA+ EEIDM+ E+TKQIEGHTICALGDAAAWPVQGLIRHFRPELER
Sbjct  402  TGWLTKMMYRFVDGNARPEEIDMIWELTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  461

Query  346  RIRERADR  323
            R++E A++
Sbjct  462  RMQEYAEK  469



>ref|WP_007670157.1| NADH dehydrogenase [alpha proteobacterium BAL199]
 gb|EDP66350.1| NADH dehydrogenase subunit D [alpha proteobacterium BAL199]
Length=434

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD+L+ V+SGLGTAAVIVM++STDIV AIARLS FYKHESCGQCTPCREG
Sbjct  296  KSICDDVLMDFDSLREVRSGLGTAAVIVMNQSTDIVKAIARLSAFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  G A ++EID+L EV++QIEGHTICALGDAAAWPVQGLIRHFRPE+ER
Sbjct  356  TGWMWRVMERMVRGEADVDEIDVLEEVSRQIEGHTICALGDAAAWPVQGLIRHFRPEMER  415

Query  346  RI  341
            RI
Sbjct  416  RI  417



>ref|XP_003083193.1| PREDICTED P0503D09.102 gene product [Oryza sativa (ISS) [Ostreococcus 
tauri]
 emb|CAL57468.1| NADH ubiquinone oxidoreductase, F subunit, iron sulphur binding 
[Ostreococcus tauri]
Length=491

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFDALK V SGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREG
Sbjct  359  KDVCDDVLMDFDALKGVGSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREG  418

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W++ +M+R+  G+A+LEE++ML E+TKQIEGHTICALGDAAAWPVQGL+++F P +  
Sbjct  419  TSWIYNIMKRLVKGDARLEEVEMLQEITKQIEGHTICALGDAAAWPVQGLLKNFSPLIRE  478

Query  346  RIRERADRELLQA  308
            RI   +D + + A
Sbjct  479  RITASSDAKKIAA  491



>ref|WP_018687649.1| MULTISPECIES: NADH dehydrogenase [Ahrensia]
Length=434

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD+L+A+QSGLGTAAVIVMDKSTDIV AIARL+YFYKHESCGQCTPCREGT W+W
Sbjct  300  DCPMDFDSLRALQSGLGTAAVIVMDKSTDIVKAIARLAYFYKHESCGQCTPCREGTGWMW  359

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MERM  GNA+  EIDML +VTKQIEGHTICALGDAAAWP+QGLIRH+RPE+ERRI E
Sbjct  360  RVMERMVAGNAQKREIDMLLDVTKQIEGHTICALGDAAAWPIQGLIRHYRPEIERRIDE  418



>ref|WP_033073248.1| NADH dehydrogenase [Sphingopyxis sp. MWB1]
Length=430

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  303  DAPMDFDGLKELGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGQCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A +EEID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRIRE 
Sbjct  363  RVMERLRSGDADIEEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIREN  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_019643599.1| NADH dehydrogenase [Novispirillum itersonii]
Length=425

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD+L+AVQSGLGTAAVIVMDKSTD+V AI RL+ FY HESCGQCTPCREG
Sbjct  296  KSICDDVLMDFDSLRAVQSGLGTAAVIVMDKSTDLVRAITRLAKFYMHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            + W+W +MERM  G A +EEIDML +V+KQIEGHTICALGDAAAWP+QGLIRHFRP++E 
Sbjct  356  SGWMWRVMERMSQGRASVEEIDMLFDVSKQIEGHTICALGDAAAWPIQGLIRHFRPQIEE  415

Query  346  RIRERA  329
            R+  RA
Sbjct  416  RLGRRA  421



>ref|WP_012112155.1| NADH dehydrogenase [Parvibaculum lavamentivorans]
 gb|ABS64827.1| NADH-quinone oxidoreductase, F subunit [Parvibaculum lavamentivorans 
DS-1]
Length=429

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD+LK VQSGLGTAAVIVMDKSTD++ AIARLS FYKHESCGQCTPCREG
Sbjct  296  KSVCDDVLMDFDSLKNVQSGLGTAAVIVMDKSTDVIKAIARLSAFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+  G+A+++EIDML +VTK++EGHTICALGDAAAWPVQGLIRHFR  +E 
Sbjct  356  TGWMWRVMERLVAGDAEVQEIDMLLDVTKRVEGHTICALGDAAAWPVQGLIRHFRGTIEE  415

Query  346  RIRERADRELLQAAA  302
            RI  +  R   QAAA
Sbjct  416  RIASK--RGAAQAAA  428



>ref|WP_010402597.1| NADH dehydrogenase [Sphingomonas echinoides]
Length=434

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLKKVGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRITEK  421



>ref|WP_037501935.1| NADH dehydrogenase [Sphingomonas jaspsi]
Length=434

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  307  DAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  366

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
              MER++ G+A++  ID L++VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRI ER
Sbjct  367  RTMERLREGDAEVATIDQLYDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIAER  426



>ref|WP_029794038.1| NADH dehydrogenase [alpha proteobacterium JGI 0001002-C12]
Length=435

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+ + SGLGTAAVIVMDKSTDIV AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  305  DAPMDFDGLRELGSGLGTAAVIVMDKSTDIVRAISRISYFYKHESCGQCTPCREGTGWMW  364

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G A   EID+L EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI+ER
Sbjct  365  RVMERLRTGEADYHEIDLLQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIKER  424



>ref|WP_037553867.1| NADH dehydrogenase [Sphingopyxis sp. LC363]
 gb|KGB58729.1| NADH-quinone oxidoreductase, F subunit precursor [Sphingopyxis 
sp. LC363]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRIRE 
Sbjct  362  RVMERLRTGDADISEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIREN  421

Query  331  A  329
             
Sbjct  422  G  422



>ref|WP_039573805.1| NADH dehydrogenase [Sphingopyxis sp. Kp5.2]
 gb|AJA08615.1| NADH-quinone oxidoreductase subunit F 1 [Sphingopyxis sp. Kp5.2]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRIRE 
Sbjct  362  RVMERLRTGDADISEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIREN  421

Query  331  A  329
             
Sbjct  422  G  422



>ref|WP_037510824.1| NADH dehydrogenase [Sphingopyxis sp. LC81]
 gb|KGB57163.1| NADH-quinone oxidoreductase, F subunit precursor [Sphingopyxis 
sp. LC81]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKAVGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRIRE 
Sbjct  362  RVMERLRTGDADISEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIKHFRPEIERRIREN  421

Query  331  A  329
             
Sbjct  422  G  422



>ref|WP_014240125.1| NADH dehydrogenase [Azospirillum brasilense]
 emb|CCC97862.1| NADH-quinone oxidoreductase, subunit F [Azospirillum brasilense 
Sp245]
 gb|EZQ08884.1| NADH dehydrogenase [Azospirillum brasilense]
 gb|AIB12015.1| NADH dehydrogenase [Azospirillum brasilense]
Length=430

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+L+ V+SGLGTAAVIVMDKSTD+V AIARLS FY HESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLRDVRSGLGTAAVIVMDKSTDVVKAIARLSQFYAHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+  +M+RM  GNA++EEIDML EVTKQIEGHTICALGDAAAWP+QGL RHFRPE+ER
Sbjct  356  TGWMNRIMQRMVTGNARVEEIDMLLEVTKQIEGHTICALGDAAAWPIQGLFRHFRPEVER  415

Query  346  RI  341
            RI
Sbjct  416  RI  417



>gb|EFA77854.1| ubiquinone oxidoreductase [Polysphondylium pallidum PN500]
Length=481

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD L+ V+SGLGTAAVIVMDKSTDI+ AIARLS FYKHESCGQC+PCREG
Sbjct  348  KDICDDVLMDFDDLRRVRSGLGTAAVIVMDKSTDIIAAIARLSKFYKHESCGQCSPCREG  407

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW + ER+  G+AKL+E+DML E+++QIEGHTICALGDAAAWPVQGLIRH+RPE+E+
Sbjct  408  TGWLWDITERLVTGDAKLDEVDMLEEISRQIEGHTICALGDAAAWPVQGLIRHYRPEIEQ  467

Query  346  RIRE  335
            RI++
Sbjct  468  RIQD  471



>ref|WP_010163520.1| NADH dehydrogenase [Sphingomonas sp. PAMC 26617]
Length=434

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLKKVGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRITEK  421



>ref|WP_037447264.1| NADH dehydrogenase [Skermanella stibiiresistens]
 gb|EWY42117.1| NADH dehydrogenase [Skermanella stibiiresistens SB22]
Length=429

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            + +C+ VLMDFD+L+ V+SGLGTA +IVMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  296  RSICDTVLMDFDSLREVRSGLGTAGIIVMDKSTDIVKAIARLSKFYMHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW +MERM  G A+++EIDML +VTK+IEGHTICALGDAAAWPVQGLIRHFRPE+ER
Sbjct  356  TGWLWRVMERMAQGKARIDEIDMLFDVTKEIEGHTICALGDAAAWPVQGLIRHFRPEMER  415

Query  346  RI  341
            RI
Sbjct  416  RI  417



>ref|WP_010216648.1| NADH dehydrogenase [Sphingomonas sp. PAMC 26621]
Length=434

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLKKVGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRITEK  421



>ref|WP_010187238.1| NADH dehydrogenase [Sphingomonas sp. PAMC 26605]
Length=434

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK V SGLGTAA+IVMDKSTDIV AI+RLSYFYKHESCGQCTPCREGT W+W
Sbjct  302  DCPMDFDGLKKVGSGLGTAAIIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM+ G+A + EID L++VTKQ+EGHTICALGDAAAWP+QGLI+HFRPE+ERRI E+
Sbjct  362  RVMERMRTGDADISEIDTLYQVTKQVEGHTICALGDAAAWPIQGLIKHFRPEMERRITEK  421



>ref|WP_008836442.1| NADH dehydrogenase I subunit F, partial [Mesorhizobium alhagi]
 gb|EHK56622.1| NADH dehydrogenase I subunit F, partial [Mesorhizobium alhagi 
CCNWXJ12-2]
Length=244

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFDAL+ ++SGLGTAAVIVMDKSTDI  AIARLSYFYKHESCGQCTPCREGT W+W
Sbjct  110  DAPMDFDALRDLKSGLGTAAVIVMDKSTDIAKAIARLSYFYKHESCGQCTPCREGTGWMW  169

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER+  G A+  EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI E
Sbjct  170  RVMERLVRGEAQKREIDMLLDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIDE  228



>ref|WP_008943642.1| NADH dehydrogenase [Oceanibaculum indicum]
 gb|EKE77725.1| NADH dehydrogenase I subunit F [Oceanibaculum indicum P24]
Length=430

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  697  CEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPW  518
            C+++ MDFD L+  +SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREGT W
Sbjct  299  CDELFMDFDTLREKRSGLGTAAVIVMDKSTDIVKAIARLSYFYKHESCGQCTPCREGTGW  358

Query  517  LWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIR  338
            +W +MERM  G A + EIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI 
Sbjct  359  MWRVMERMVRGEADIGEIDMLEDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMERRIH  418

Query  337  ER  332
             R
Sbjct  419  AR  420



>ref|WP_025294485.1| NADH dehydrogenase [Sphingomonas sanxanigenens]
 gb|AHE56367.1| NADH dehydrogenase [Sphingomonas sanxanigenens DSM 19645 = NX02]
Length=432

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKA+ SGLGTAAVIVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKALGSGLGTAAVIVMDKSTDVVRAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE-  335
             +MER++ G+A   EID L EVTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI + 
Sbjct  362  RVMERLRTGDADASEIDTLFEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRIADK  421

Query  334  RADRELLQAA  305
            R    +++AA
Sbjct  422  RGPAPMMEAA  431



>ref|WP_026942073.1| NADH dehydrogenase [Hellea balneolensis]
Length=435

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDAL+  QSGLGTAAVIVMDKSTD++ AIARLSYFYKHESCGQCTPCREG
Sbjct  299  KEICDTVLMDFDALREHQSGLGTAAVIVMDKSTDVIKAIARLSYFYKHESCGQCTPCREG  358

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  G A+  EIDML EV+KQ+EGHTICALGDAAAWP+QGLIRHFR E+E 
Sbjct  359  TGWMWRVMERMVKGEAETSEIDMLLEVSKQVEGHTICALGDAAAWPIQGLIRHFRHEIEE  418

Query  346  RI-RERADRELLQAAA  302
            RI   RA++ +   AA
Sbjct  419  RIDNYRANKPVFVQAA  434



>ref|XP_004334975.1| NADH oxidoreductase (quinone), F subunit [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12962.1| NADH oxidoreductase (quinone), F subunit [Acanthamoeba castellanii 
str. Neff]
Length=469

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C++VLMDFDAL+ V SGLGTAAVIVMDKSTD++ AIARLS FY++ESCGQCTPCREG
Sbjct  312  KSICDNVLMDFDALRDVTSGLGTAAVIVMDKSTDVIAAIARLSKFYRNESCGQCTPCREG  371

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            +PWLW +MERM  G+AK++EIDML+E++ QIEGHTICALGDAAAWPVQG+IRHFR E+E+
Sbjct  372  SPWLWNVMERMVTGDAKIDEIDMLYELSTQIEGHTICALGDAAAWPVQGVIRHFRGEMEQ  431

Query  346  RIRE  335
            RI +
Sbjct  432  RIHD  435



>ref|WP_014076634.1| NADH dehydrogenase [Sphingobium sp. SYK-6]
 dbj|BAK66989.1| NADH-quinone oxidoreductase chain F [Sphingobium sp. SYK-6]
Length=451

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+A+ SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREGT W+W
Sbjct  320  DAPMDFDGLRALGSGLGTAAVIVMDKSTDIVRAIARLSYFYKHESCGQCTPCREGTGWMW  379

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRI  341
             +MER+  G+A++EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+ERRI
Sbjct  380  RVMERLVRGDAEVEEIDMLFQVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRI  436



>dbj|GAM25560.1| hypothetical protein SAMD00019534_087350, partial [Acytostelium 
subglobosum LB1]
Length=492

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+DVLMDFD L+ V+SGLGTAAVIVM+K TDI+ AIARLS FYKHESCGQC+PCREG
Sbjct  359  KSICDDVLMDFDDLRRVRSGLGTAAVIVMNKQTDIIAAIARLSKFYKHESCGQCSPCREG  418

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WLW + ER+  G+AKL+EIDML E+++QIEGHTICALGDAAAWPVQGLIRHFRPE+E+
Sbjct  419  TGWLWDITERLVTGDAKLDEIDMLEEISRQIEGHTICALGDAAAWPVQGLIRHFRPEIEQ  478

Query  346  RIRERAD  326
            RI++  D
Sbjct  479  RIQQYQD  485



>ref|WP_038463727.1| NADH dehydrogenase [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK95970.1| NADH dehydrogenase [Candidatus Paracaedibacter acanthamoebae]
Length=425

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFDAL+ V+SGLGTAAVIVMDKSTD++ AIARLS FY HESCGQCTPCREG
Sbjct  295  KDICDTVLMDFDALREVKSGLGTAAVIVMDKSTDVIKAIARLSKFYMHESCGQCTPCREG  354

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+  G A++ +ID L E+++QIEGHTICALGDAAAWPVQGLIRHFRPELE 
Sbjct  355  TGWMWRMMERLVKGQAEISDIDKLEEISRQIEGHTICALGDAAAWPVQGLIRHFRPELEE  414

Query  346  RIRERADRE  320
            RIR  A R 
Sbjct  415  RIRAYAKRN  423



>ref|WP_011541601.1| NADH dehydrogenase [Sphingopyxis alaskensis]
 gb|ABF53019.1| NADH-quinone oxidoreductase, F subunit [Sphingopyxis alaskensis 
RB2256]
Length=430

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LKAV SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCG CTPCREGT W+W
Sbjct  303  DCPMDFDGLKAVGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGHCTPCREGTGWMW  362

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRIRE 
Sbjct  363  RVMERLRTGDADISEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIREN  422

Query  331  A  329
             
Sbjct  423  G  423



>ref|WP_015467644.1| NADH-ubiquinone oxidoreductase chain F [Micavibrio aeruginosavorus]
 gb|AGH98108.1| NADH-ubiquinone oxidoreductase chain F [Micavibrio aeruginosavorus 
EPB]
Length=430

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            + +C+ V+MDFD+L+A  SGLGTA VIVMDKSTDIV AIARLS FYKHESCGQCTPCREG
Sbjct  298  REVCDTVVMDFDSLRAAGSGLGTAGVIVMDKSTDIVYAIARLSEFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +M RM  GNA +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+E+
Sbjct  358  TGWMWRVMTRMVKGNATVEEIDMLWDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMEK  417

Query  346  RIRE  335
            RI E
Sbjct  418  RIME  421



>ref|WP_003051586.1| NADH dehydrogenase I subunit F [Sphingopyxis sp. MC1]
 gb|ENY80093.1| NADH dehydrogenase I subunit F [Sphingopyxis sp. MC1]
Length=429

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK + SGLGTAA IVMDKSTD+V AI+R+SYFYKHESCGQCTPCREGT W+W
Sbjct  302  DAPMDFDGLKELGSGLGTAAAIVMDKSTDVVQAISRISYFYKHESCGQCTPCREGTGWMW  361

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MER++ G+A + EID L +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPELERRIRE 
Sbjct  362  RVMERLRTGDADISEIDTLFDVTKQVEGHTICALGDAAAWPIQGLIRHFRPELERRIREN  421

Query  331  A  329
             
Sbjct  422  G  422



>ref|WP_014102910.1| NADH dehydrogenase [Micavibrio aeruginosavorus]
 gb|AEP09687.1| NADH oxidoreductase, F subunit [Micavibrio aeruginosavorus ARL-13]
Length=430

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            + +C+ V+MDFD+L+A  SGLGTA VIVMDKSTDIV AIARLS FYKHESCGQCTPCREG
Sbjct  298  RDVCDTVVMDFDSLRAAGSGLGTAGVIVMDKSTDIVYAIARLSEFYKHESCGQCTPCREG  357

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +M RM  GNA +EEIDML +VTKQ+EGHTICALGDAAAWP+QGLIRHFRPE+E+
Sbjct  358  TGWMWRVMTRMVKGNATVEEIDMLWDVTKQVEGHTICALGDAAAWPIQGLIRHFRPEMEK  417

Query  346  RIRE  335
            RI E
Sbjct  418  RIME  421



>ref|WP_021776285.1| Ribosome-recycling factor Ribosome-releasing factor protein [alpha 
proteobacterium RS24]
 gb|ERL47266.1| Ribosome-recycling factor Ribosome-releasing factor protein [alpha 
proteobacterium RS24]
Length=427

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+LK VQSGLGTAAVIVMDKSTD+V AIAR+S+FYKHESCGQCTPCREG
Sbjct  296  KEICDTVLMDFDSLKEVQSGLGTAAVIVMDKSTDLVKAIARISHFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+  G AK +EID L +VTKQIEGHTICALGDAAAWP+QGL RHFRPE+E 
Sbjct  356  TGWMWRVMERIAKGQAKPQEIDTLLQVTKQIEGHTICALGDAAAWPIQGLFRHFRPEIEA  415

Query  346  RIRERADRE  320
            R+   + +E
Sbjct  416  RLSGHSSQE  424



>ref|WP_007065967.1| NADH dehydrogenase [Fulvimarina pelagi]
 gb|EAU40381.1| NADH-ubiquinone oxidoreductase chain F protein [Fulvimarina pelagi 
HTCC2506]
Length=434

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 5/134 (4%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD LK +++ LGTAAVIVMDKSTDIV AIAR+SYFYKHESCGQCTPCREGT W+W
Sbjct  300  DAPMDFDGLKDIKTSLGTAAVIVMDKSTDIVKAIARISYFYKHESCGQCTPCREGTGWMW  359

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRER  332
             +MERM VGNAK  EIDML +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERRI E 
Sbjct  360  RVMERMVVGNAKKSEIDMLLQVTKQVEGHTICALGDAAAWPIQGLMRHFRPEIERRIDEF  419

Query  331  A-----DRELLQAA  305
            +     DR  L AA
Sbjct  420  SRNADLDRPHLVAA  433



>ref|WP_009450020.1| NADH dehydrogenase [Nitratireductor indicus]
 gb|EKF42686.1| NADH dehydrogenase I subunit F [Nitratireductor indicus C115]
Length=434

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD+L+A++SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREGT W+W
Sbjct  300  DTPMDFDSLRALRSGLGTAAVIVMDKSTDIVKAIARLSYFYKHESCGQCTPCREGTGWMW  359

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MER+ VG A+  EIDML +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERRI E
Sbjct  360  RVMERLVVGQAQKHEIDMLLDVTKQVEGHTICALGDAAAWPIQGLVRHFRPEIERRIDE  418



>ref|WP_012566435.1| NADH dehydrogenase [Rhodospirillum centenum]
 gb|ACI98647.1| NADH-quinone oxidoreductase chain F [Rhodospirillum centenum 
SW]
Length=433

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 116/137 (85%), Gaps = 3/137 (2%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            +  C+ VLMDFD+L+ V+SGLGTAAVIVMD+STD+V AIARLS FY HESCGQCTPCREG
Sbjct  296  RETCDTVLMDFDSLREVRSGLGTAAVIVMDRSTDVVKAIARLSKFYMHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MERM  G A++EEIDML +V+K+IEGHTICALGDAAAWP+QGLIR+FRPE+ER
Sbjct  356  TGWMWRVMERMVKGQARIEEIDMLLDVSKEIEGHTICALGDAAAWPIQGLIRNFRPEMER  415

Query  346  RI---RERADRELLQAA  305
            RI   R RA+R    AA
Sbjct  416  RILEYRTRAERGTRAAA  432



>gb|EER39748.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Histoplasma capsulatum 
H143]
Length=282

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            KH+C+D LMDFDALK  QSGLGTAAVIVMDKSTD+V AI+RLS FYKHESCGQCTPCREG
Sbjct  129  KHICDDQLMDFDALKDAQSGLGTAAVIVMDKSTDVVAAISRLSAFYKHESCGQCTPCREG  188

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            + W   +M+R + G A+  EIDML E+TKQ+EGHTICALG+A AWP+QGLIRHFRPELE 
Sbjct  189  SKWTMQMMQRFERGQAREREIDMLQELTKQVEGHTICALGEAFAWPIQGLIRHFRPELEA  248

Query  346  RIRE  335
            RIR+
Sbjct  249  RIRK  252



>ref|WP_011389435.1| NADH dehydrogenase [Rhodospirillum rubrum]
 ref|YP_426647.1| NADH dehydrogenase I subunit F [Rhodospirillum rubrum ATCC 11170]
 gb|ABC22360.1| NADH-quinone oxidoreductase, F subunit [Rhodospirillum rubrum 
ATCC 11170]
 gb|AEO48077.1| NADH dehydrogenase I subunit F [Rhodospirillum rubrum F11]
Length=429

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            + +C+DVLMDFD+LKAV+SGLGTAAV+VMDKSTDIV AIARLS FY HESCGQCTPCREG
Sbjct  296  RELCDDVLMDFDSLKAVKSGLGTAAVMVMDKSTDIVRAIARLSAFYTHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T WL  +M R+  G+A +EEID+L +VT+QIEGHTICALGDAAAWP+QGLIRHFRPE+ER
Sbjct  356  TGWLSRVMTRLVNGDAAIEEIDVLEQVTRQIEGHTICALGDAAAWPIQGLIRHFRPEIER  415

Query  346  RIRER  332
            RI E+
Sbjct  416  RIIEK  420



>ref|WP_008594076.1| NADH dehydrogenase [Nitratireductor pacificus]
 gb|EKF20203.1| NADH dehydrogenase I subunit F [Nitratireductor pacificus pht-3B]
Length=434

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  703  HMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGT  524
            H   D  MDFDAL+ ++SGLGTAAVIVMDKSTDIV AIARLSYFYKHESCGQCTPCREGT
Sbjct  296  HEIIDTPMDFDALRELKSGLGTAAVIVMDKSTDIVKAIARLSYFYKHESCGQCTPCREGT  355

Query  523  PWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERR  344
             W+W +MER+ VG A+  EIDML +VTKQ+EGHTICALGDAAAWP+QGL+RHFRPE+ERR
Sbjct  356  GWMWRVMERLVVGQAQKHEIDMLLDVTKQVEGHTICALGDAAAWPIQGLVRHFRPEIERR  415

Query  343  IRE  335
            I E
Sbjct  416  IDE  418



>ref|WP_008125212.1| NADH dehydrogenase [Phyllobacterium sp. YR531]
 gb|EJN03539.1| NADH-quinone oxidoreductase, F subunit [Phyllobacterium sp. YR531]
Length=434

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  691  DVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLW  512
            D  MDFD L+AV+S  GTAAVIVMDKSTDIV AIARLSYF+KHESCGQCTPCREGT W+W
Sbjct  300  DCPMDFDGLRAVKSSFGTAAVIVMDKSTDIVRAIARLSYFFKHESCGQCTPCREGTGWMW  359

Query  511  MLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELERRIRE  335
             +MERM  GNA+  EIDML +VTKQIEGHTICALGDAAAWPVQGLIRHFRPE+ERRI E
Sbjct  360  RVMERMVTGNAQKREIDMLLDVTKQIEGHTICALGDAAAWPVQGLIRHFRPEIERRIDE  418



>ref|WP_029639590.1| NADH dehydrogenase [alpha proteobacterium Mf 1.05b.01]
Length=431

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  706  KHMCEDVLMDFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREG  527
            K +C+ VLMDFD+LK VQSGLGTAAVIVMDKSTD++ AIARLS FYKHESCGQCTPCREG
Sbjct  296  KSICDTVLMDFDSLKDVQSGLGTAAVIVMDKSTDVIKAIARLSAFYKHESCGQCTPCREG  355

Query  526  TPWLWMLMERMKVGNAKLEEIDMLHEVTKQIEGHTICALGDAAAWPVQGLIRHFRPELER  347
            T W+W +MER+  G A++EEI+ML +VTK++EGHTICALGDAAAWPVQGLIRHFRP +E 
Sbjct  356  TGWMWRVMERLVTGEAEVEEIEMLLDVTKRVEGHTICALGDAAAWPVQGLIRHFRPVIEE  415

Query  346  RIRER  332
            RI  R
Sbjct  416  RIATR  420



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365