BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031H12

Length=117
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                              54.7    5e-08   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                              54.7    4e-07   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                        54.7    4e-07   Ipomoea batatas [batate]
gb|ACJ73906.1|  CAT2                                                  50.8    5e-06   Solanum nigrum
gb|AHF27433.1|  catalase                                              51.2    6e-06   Cucurbita maxima [Boston marrow]
dbj|BAF91369.1|  catalase                                             51.2    7e-06   Capsicum annuum
gb|AHF27430.1|  catalase                                              50.8    8e-06   Cucurbita moschata [ayote]
ref|NP_001234827.1|  catalase isozyme 1                               50.8    9e-06   Solanum lycopersicum
ref|NP_001031072.3|  catalase 3                                       50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20283.1|  AT1G20620                                            48.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2             50.4    1e-05   Ricinus communis
emb|CAE82295.1|  catalase                                             50.1    2e-05   Homogyne alpina
ref|XP_002510677.1|  catalase, putative                               50.4    2e-05   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                        50.1    2e-05   Solanum melongena [aubergine]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                        50.1    2e-05
emb|CDY01364.1|  BnaA07g11370D                                        50.1    2e-05   
gb|AAD30292.1|AF139539_1  catalase 3                                  49.7    2e-05   Raphanus sativus
emb|CDY33636.1|  BnaC08g19360D                                        49.7    2e-05   Brassica napus [oilseed rape]
ref|XP_009149539.1|  PREDICTED: catalase-3                            49.7    2e-05   Brassica rapa
emb|CDY29519.1|  BnaA06g14510D                                        49.7    2e-05   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                       49.7    2e-05   Brassica rapa
ref|XP_009110221.1|  PREDICTED: catalase-3                            49.7    2e-05   Brassica rapa
ref|XP_010498496.1|  PREDICTED: catalase-3                            49.7    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY31488.1|  BnaC05g15970D                                        49.7    2e-05   Brassica napus [oilseed rape]
gb|AAF61733.1|AF243518_1  catalase 3                                  49.7    2e-05   Helianthus annuus
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like               47.0    2e-05   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1  49.3    3e-05   Capsicum annuum
gb|ABS72010.1|  putative catalase                                     46.6    3e-05   Olea europaea
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like               46.6    3e-05   
gb|ABY19573.1|  catalase                                              48.5    3e-05   Manihot esculenta [manioc]
ref|XP_010498497.1|  PREDICTED: catalase-1-like                       49.3    3e-05   Camelina sativa [gold-of-pleasure]
gb|AAX84671.1|  catalase CAT2                                         48.1    4e-05   Manihot esculenta [manioc]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                        48.9    4e-05   Vigna radiata var. radiata [golden gram]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                  48.9    4e-05   Arabis alpina [alpine rockcress]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g           48.9    4e-05   Phaseolus vulgaris [French bean]
gb|AGV54297.1|  peroxisomal catalase                                  48.9    4e-05   Phaseolus vulgaris [French bean]
gb|AAM97542.1|  catalase 3                                            48.9    4e-05   Capsicum annuum
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like               48.9    4e-05   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                    48.5    4e-05   Cucumis melo [Oriental melon]
gb|AFR42410.1|  catalase                                              46.2    5e-05   Eperua falcata
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like               48.5    5e-05   
gb|AFR42412.1|  catalase                                              46.2    5e-05   Eperua falcata
gb|ADM96039.1|  catalase                                              48.5    5e-05   Cucumis sativus [cucumbers]
dbj|BAH56915.1|  AT1G20620                                            48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20307.1|  AT1G20620                                            48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                          48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031073.1|  catalase 3                                       48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65021.1|  unknown                                               48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                          48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg           48.5    5e-05   Capsella rubella
emb|CDY31878.1|  BnaC07g15280D                                        48.5    6e-05   Brassica napus [oilseed rape]
gb|AAF79625.1|AC027665_26  F5M15.5                                    48.5    7e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46618.1|  unknown                                               45.4    7e-05   Lotus japonicus
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1    48.1    7e-05   
ref|XP_002890395.1|  F5M15.5                                          48.5    8e-05   
gb|KEH36312.1|  catalase heme-binding enzyme                          47.8    8e-05   Medicago truncatula
gb|ABR15776.1|  catalase                                              47.4    9e-05   Litchi
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg           47.8    9e-05   Citrus clementina [clementine]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2         47.8    1e-04   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3         47.8    1e-04   Sesamum indicum [beniseed]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4    47.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_009103333.1|  PREDICTED: catalase-1                            47.8    1e-04   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                        47.8    1e-04   
emb|CDY31877.1|  BnaC07g15270D                                        47.8    1e-04   Brassica napus [oilseed rape]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2    47.8    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1    47.8    1e-04   
ref|XP_010477308.1|  PREDICTED: catalase-1                            47.4    1e-04   Camelina sativa [gold-of-pleasure]
gb|AAF61734.1|AF243519_1  catalase 4                                  47.4    1e-04   Helianthus annuus
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                  47.4    1e-04   Arabis alpina [alpine rockcress]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                       47.4    1e-04   Camelina sativa [gold-of-pleasure]
emb|CAB56850.1|  catalase                                             47.4    1e-04   Prunus persica
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg           47.4    1e-04   Eutrema salsugineum [saltwater cress]
gb|AIA61608.1|  catalase                                              47.4    1e-04   Gynostemma pentaphyllum [jiaogulan]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                    47.4    1e-04   Populus euphratica
gb|AAR97905.1|  catalase                                              47.4    1e-04   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2             47.4    1e-04   Solanum tuberosum [potatoes]
emb|CAA85470.1|  catalase                                             47.4    1e-04   Solanum tuberosum [potatoes]
dbj|BAQ21275.1|  catalase                                             47.4    1e-04   Citrus tamurana
ref|NP_001274863.1|  catalase isozyme 1                               47.4    1e-04   Solanum tuberosum [potatoes]
gb|ABC01913.1|  catalase isozyme 1-like protein                       47.4    1e-04   Solanum tuberosum [potatoes]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1             47.4    1e-04   Solanum tuberosum [potatoes]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3             47.4    1e-04   Cucurbita pepo
emb|CAD42908.1|  catalase                                             47.4    1e-04   Prunus persica
gb|AFU90823.1|  catalase                                              47.0    1e-04   Populus x beijingensis
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg           47.4    1e-04   Prunus persica
gb|AFU90822.1|  catalase                                              47.4    1e-04   Populus tomentosa [Chinese white poplar]
gb|ACV30589.1|  catalase                                              45.1    2e-04   Carica papaya [mamon]
ref|XP_002301920.1|  catalase family protein                          47.4    2e-04   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                             47.4    2e-04   Populus deltoides
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                    47.0    2e-04   Nicotiana tomentosiformis
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                    47.0    2e-04   Nicotiana sylvestris
ref|XP_002306976.2|  catalase family protein                          47.0    2e-04   
gb|ACA50528.1|  putative catalase 2                                   47.0    2e-04   Brassica napus [oilseed rape]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                    47.0    2e-04   Prunus mume [ume]
emb|CAA10286.1|  catalase                                             44.7    2e-04   Cicer arietinum [garbanzo]
ref|XP_010692544.1|  PREDICTED: catalase-like                         47.0    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like               47.0    2e-04   Prunus mume [ume]
gb|ADZ45556.1|  catalase                                              47.0    2e-04   Vigna radiata [mung bean]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg           47.0    2e-04   Prunus persica
gb|ADZ45555.1|  catalase                                              47.0    2e-04   Vigna radiata [mung bean]
emb|CAD42909.1|  catalase                                             47.0    2e-04   Prunus persica
gb|AAA57551.1|  catalase                                              46.6    2e-04   Nicotiana sylvestris
gb|ABM47415.1|  catalase                                              46.6    2e-04   Prunus avium [gean]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                    46.6    2e-04   Cucumis melo [Oriental melon]
ref|NP_001237571.1|  catalase-4                                       46.6    2e-04   Glycine max [soybeans]
ref|NP_001289779.1|  catalase isozyme 1                               46.6    2e-04   Nelumbo nucifera [Indian lotus]
gb|ACJ76836.3|  catalase                                              46.6    2e-04   Dimocarpus longan [longan]
ref|NP_001048861.1|  Os03g0131200                                     46.6    2e-04   
gb|AFN85536.1|  catalase                                              43.9    2e-04   Olea europaea
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like               46.6    2e-04   Populus euphratica
dbj|BAA34205.1|  catalase                                             46.6    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like               46.6    2e-04   Eucalyptus grandis [rose gum]
gb|KJB57963.1|  hypothetical protein B456_009G187600                  46.6    2e-04   Gossypium raimondii
gb|AAB88173.1|  catalase                                              46.2    2e-04   Glycine max [soybeans]
emb|CDY31490.1|  BnaC05g15990D                                        46.6    2e-04   Brassica napus [oilseed rape]
emb|CDY29518.1|  BnaA06g14520D                                        46.6    3e-04   Brassica napus [oilseed rape]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                    46.6    3e-04   
gb|AAC49807.1|  catalase 3                                            46.6    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19965.1|AF207906_1  catalase 1                                  46.6    3e-04   Zantedeschia aethiopica [arum-lily]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                    46.6    3e-04   
dbj|BAA34714.1|  catalase                                             46.6    3e-04   Oryza sativa [red rice]
ref|NP_001291326.1|  catalase isozyme 1                               46.6    3e-04   Sesamum indicum [beniseed]
gb|AET97564.1|  catalase                                              46.6    3e-04   Ziziphus jujuba [Chinese jujube]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                    46.6    3e-04   Nicotiana sylvestris
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                    46.6    3e-04   Nicotiana tomentosiformis
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...  46.6    3e-04   Nicotiana tabacum [American tobacco]
gb|AAC17731.1|  catalase 1                                            46.2    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018034.1|  Catalase 2                                       46.2    3e-04   
gb|AAG43363.1|AF151368_1  catalase                                    46.2    3e-04   Hevea brasiliensis [jebe]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2             46.2    3e-04   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AEQ30070.1|  catalase                                              46.2    3e-04   Litchi chinensis [litchi]
gb|KJB14249.1|  hypothetical protein B456_002G115900                  45.8    3e-04   Gossypium raimondii
gb|ABY68162.1|  catalase                                              43.9    3e-04   Oryza brachyantha
ref|NP_001240021.1|  catalase                                         46.2    4e-04   Glycine max [soybeans]
gb|AAD30291.2|AF139538_1  catalase 2                                  46.2    4e-04   Raphanus sativus
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3             45.8    4e-04   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAR84578.1|  catalase 1a                                           45.8    4e-04   Lotus japonicus
gb|ABR25882.1|  catalase isozyme b                                    43.1    4e-04   Oryza sativa Indica Group [Indian rice]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                     45.8    4e-04   Cucumis sativus [cucumbers]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                    45.8    4e-04   Elaeis guineensis
gb|ABY68164.1|  catalase                                              43.5    4e-04   Leersia tisserantii
gb|ACJ22771.1|  catalase 1                                            45.8    5e-04   Jatropha curcas
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                 45.8    5e-04   Citrus sinensis [apfelsine]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like               45.8    5e-04   
gb|AAC19397.1|  leaf catalase                                         45.8    5e-04   Mesembryanthemum crystallinum
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg           45.4    5e-04   Citrus clementina [clementine]
emb|CBI29556.3|  unnamed protein product                              43.1    5e-04   Vitis vinifera
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1              45.4    5e-04   Citrus sinensis [apfelsine]
emb|CAA42026.1|  catalase                                             43.1    5e-04   Ricinus communis
gb|AJE26131.1|  catalase                                              45.4    6e-04   Salix matsudana [tortured willow]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313           45.4    6e-04   
gb|KHG21219.1|  Catalase isozyme 1                                    45.4    6e-04   Gossypium arboreum [tree cotton]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like               45.4    6e-04   Oryza brachyantha
gb|ABY21704.1|  catalase-1 precursor                                  45.4    6e-04   Panax ginseng [Asiatic ginseng]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171           45.4    6e-04   Selaginella moellendorffii
ref|NP_001268098.1|  catalase                                         45.4    6e-04   Vitis vinifera
gb|AFI48101.1|  catalase isozyme B                                    43.1    6e-04   Oryza rhizomatis
gb|AFI48054.1|  catalase isozyme B                                    43.1    6e-04   Oryza rufipogon [common wild rice]
gb|ABY68158.1|  catalase                                              43.1    6e-04   Oryza rufipogon [common wild rice]
gb|AFI48111.1|  catalase isozyme B                                    43.1    6e-04   Oryza australiensis
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1             45.4    6e-04   Ricinus communis
gb|AAD50974.1|AF170272_1  catalase CAT1                               45.4    6e-04   Manihot esculenta [manioc]
ref|XP_010105996.1|  Catalase isozyme 1                               45.1    6e-04   
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like               45.4    7e-04   Vitis vinifera
gb|ABY68159.1|  catalase                                              42.7    7e-04   Oryza punctata
gb|ADU56198.1|  catalase                                              45.4    7e-04   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1            45.4    7e-04   
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2            45.4    7e-04   Cicer arietinum [garbanzo]
ref|XP_009149540.1|  PREDICTED: catalase-1                            45.1    7e-04   Brassica rapa
gb|AAC48918.1|  salicylic acid binding catalase                       45.1    8e-04   Nicotiana tabacum [American tobacco]
ref|XP_010094556.1|  Catalase isozyme 1                               45.1    8e-04   Morus notabilis
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                    45.1    8e-04   Solanum lycopersicum
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like               45.1    8e-04   
gb|AAK67359.2|AF390210_1  catalase                                    45.1    8e-04   Suaeda salsa
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like               45.1    9e-04   Musa acuminata subsp. malaccensis [pisang utan]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2             45.1    9e-04   Cucurbita pepo
gb|AHF27432.1|  catalase                                              45.1    0.001   Cucurbita maxima [Boston marrow]
dbj|BAD94702.1|  catalase                                             42.4    0.001   Arabidopsis thaliana [mouse-ear cress]
gb|AHF27429.1|  catalase                                              44.7    0.001   Cucurbita moschata [ayote]
gb|AAZ29552.1|  catalase-C                                            45.1    0.001   Oryza sativa Indica Group [Indian rice]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                       44.7    0.001   Oryza brachyantha



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR I   VK+ SEPRVTHEIRS WIS
Sbjct  113  GDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  150



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR I   VK+ SEPRVTHEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  469



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR I   VK+ SEPRVTHEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  469



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V+S S+PRVTHEI S WIS
Sbjct  255  GERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWIS  292



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V++ S+PRVTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWIS  469



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V++ S+PRVTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWIS  469



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  317  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  354



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  85   GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  122



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V + SEPR+THEIRS W+S
Sbjct  432  GDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVS  469



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   VK  S+PRVTHE+RS WIS
Sbjct  432  GERYRSWEPDRQERFIIRMVKMLSDPRVTHELRSIWIS  469



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V + SEPR+THEIRS W+S
Sbjct  432  GDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVS  469


 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   S+PR+THE+R+ WIS
Sbjct  914  GERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWIS  951



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R+W P  QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R+W P  QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  496  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  533



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  483  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  520



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIRS WIS
Sbjct  440  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  477



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I    K  S+PRVTHE+RS WIS
Sbjct  432  GDRYRSWDPARQERFIVRMCKMLSDPRVTHELRSIWIS  469



>ref|XP_008365914.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=108

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   SEPRVTHEIRS WIS
Sbjct  48   GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  85



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V+S S+PR THEIRS WIS
Sbjct  432  GERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWIS  469



>gb|ABS72010.1| putative catalase, partial [Olea europaea]
Length=86

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  26   GERYRSWDPARQERFIRKWVDALSDPRVTHEIRSIWIS  63



>ref|XP_008348923.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=103

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   SEPRVTHEIRS WIS
Sbjct  43   GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  80



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V + S+PR+THEIRS W+S
Sbjct  201  GDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  238



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW    Q+R +   +++ SEPRVTHEIRS W+S
Sbjct  432  GDRYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V + S+PR+THEIRS W+S
Sbjct  210  GDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  247



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V + S+PRVTHEIRS WIS
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR I   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWIS  469



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V + S+PRVTHEIRS WIS
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   V + S+PRVTHEIRS WIS
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + SEPRVTHEIR+ W+S
Sbjct  432  GERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLS  469



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+PRVTHE+R+ WIS
Sbjct  423  GDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  460



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+PRVTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  469



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  ++PRVTHEIRS WIS
Sbjct  75   GERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWIS  112



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+PRVTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  469



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  ++PRVTHEIRS WIS
Sbjct  71   GERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWIS  108



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+PRVTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWIS  469



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  398  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  435



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ SEPRVTHEIRS WIS
Sbjct  432  GERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  469



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  471  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  508


 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ SEPRVTHEIRS WIS
Sbjct  953  GERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  990



>gb|AFK46618.1| unknown [Lotus japonicus]
Length=112

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PRVTHEIRS WIS
Sbjct  52   GERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSAWIS  89



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIR  WIS
Sbjct  452  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  489



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  WIS
Sbjct  439  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  476


 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ SEPRVTHEIRS WIS
Sbjct  921  GERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  958



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWIS  469



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I   V   S+PRVT EIRS W+S
Sbjct  231  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVS  268



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIR  WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I   V++ S+PR+THEIRS W+S
Sbjct  432  GDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I   V++ S+PR+THEIRS W+S
Sbjct  432  GDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIR  WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   +K+ SEPRVTHE RS WIS
Sbjct  432  GERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWIS  469



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   +K+ SEPRVTHE RS WIS
Sbjct  432  GERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWIS  469



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   +++ SEPRVTHEIRS W+S
Sbjct  432  GERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I    K  S+PRVTHE+RS WIS
Sbjct  432  GERYRSWDPARQERFIVRMCKMLSDPRVTHELRSIWIS  469



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWIS  469



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   +++ SEPRVTHEIRS W+S
Sbjct  432  GERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  363  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  400



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDSDRQERFVKRFVEALAEPRVTHEIRSIWIS  469



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWIS  469



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + SEPRVTHE+RS WIS
Sbjct  432  GERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWIS  469



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  469



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  469



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  431  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  468



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + S+PRVTHEIR  WIS
Sbjct  416  GERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWIS  453



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    QDR I   V+S S+PRVTHEIRS WIS
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V++ S+PRVT E+R+ WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIWIS  469



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  390  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  427



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  431  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  468



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWI  4
            G+R R++ P  Q+R I   VK+ SEPR+THEIRS WI
Sbjct  110  GERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWI  146



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + SEPRVTHE+RS WIS
Sbjct  432  GERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWIS  469



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R+W P  QDR     +++ S+PRVTHE+RS WIS
Sbjct  65   GERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  102



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G R RSW P  QDR +   VK+ S+PR+T+EIRS W+S
Sbjct  432  GVRYRSWDPARQDRFVGRFVKALSDPRLTYEIRSIWVS  469



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR     V + S+PRVTHEIRS WIS
Sbjct  432  GERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR     V + S+PRVTHEIRS WIS
Sbjct  432  GERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WIS
Sbjct  323  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  360



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRV+HEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWIS  469



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR     V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWIS  469



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   + + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWIS  469



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I   V   S+PRVT E+RS W+S
Sbjct  432  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVS  469



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   + + S+PR+THEIRS W+S
Sbjct  432  GERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469



>gb|AFN85536.1| catalase, partial [Olea europaea]
Length=60

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  111  DRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            +R RSW P  Q+R +   V + S+PRVTHEIRS WIS
Sbjct  1    ERYRSWDPARQERFVRKWVDALSDPRVTHEIRSIWIS  37



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWIS  469



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   + + S+PR+THEIRS W+S
Sbjct  432  GERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   +K+ +EPRVTHE RS WIS
Sbjct  432  GERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWIS  469



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WI+
Sbjct  432  GERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWIT  469



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR     V + S+PRVTHEIRS WIS
Sbjct  248  GERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  285



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V + +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWIS  469



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V + +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWIS  469



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   SEPRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SEPR+THEIR  W S
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTS  469



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G++ RSW P  Q+R I   + + S+PRVTHEIR+ WI+
Sbjct  432  GEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWIT  469



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   SEPRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   + + S+PR+THEIRS W+S
Sbjct  432  GERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V++ S+PR+THEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWIS  469



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   + + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWIS  469



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WIS
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WIS
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WIS
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V++ SEPRVTHEIRS WIS
Sbjct  432  GERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  469



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WI+
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIT  469



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   S+PR+THE+RS WIS
Sbjct  432  GERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWIS  469



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WIS
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R I   V   S+PRVT EIRS W+S
Sbjct  427  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVS  464



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R I   V + S+PRVTHEIRS WIS
Sbjct  284  GERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  321



>gb|ABY68162.1| catalase, partial [Oryza brachyantha]
 gb|AFI48120.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48121.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48122.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48123.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48124.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48125.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48126.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48127.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48128.1| catalase isozyme B, partial [Oryza brachyantha]
 gb|AFI48129.1| catalase isozyme B, partial [Oryza brachyantha]
Length=121

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR I   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWIS  117



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR     V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  469



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  QDR +   V+  SE R+THEIRS WIS
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWIS  469



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS W S
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFS  469



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWIS  469



>gb|ABR25882.1| catalase isozyme b [Oryza sativa Indica Group]
Length=65

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  5    GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  42



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WI+
Sbjct  432  GERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIT  469



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V++ S+PRVTHEI+S WIS
Sbjct  432  GERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWIS  469



>gb|ABY68164.1| catalase, partial [Leersia tisserantii]
Length=121

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR I   V + S+PRVTHE+R  WIS
Sbjct  80   GERYRSFDPARQDRFIQRAVDALSDPRVTHELRGIWIS  117



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + S+PR+THEIR  W+S
Sbjct  432  GERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVS  469



>gb|KDO85095.1| hypothetical protein CISIN_1g044386mg [Citrus sinensis]
Length=598

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   +K+  +PRVTHE+RS W+S
Sbjct  417  GERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  454



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEIRS WI+
Sbjct  432  GERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIT  469



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PR+THEIR+ WIS
Sbjct  432  GERYRSWDPARQERFICRWVDALSDPRITHEIRNIWIS  469



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   +K+  +PRVTHE+RS W+S
Sbjct  433  GERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  470



>emb|CBI29556.3| unnamed protein product [Vitis vinifera]
 emb|CBI37653.3| unnamed protein product [Vitis vinifera]
Length=112

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V++ S+PRVT+EIRS WIS
Sbjct  52   GERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  89



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   +K+  +PRVTHE+RS W+S
Sbjct  417  GERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  454



>emb|CAA42026.1| catalase [Ricinus communis]
 emb|CAA42215.1| catalase [Ricinus communis]
Length=90

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   SEPR+T E+R+ WIS
Sbjct  30   GERYRSWPPDRQERSLNRLVGGFSEPRITQELRTIWIS  67



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PR THEIRS WIS
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWIS  469



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G R RSW    Q+R I   V + S+PRVTHEIRS W+S
Sbjct  424  GARFRSWPADRQERFIARVVDALSDPRVTHEIRSIWLS  461



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   V + S+PRVTHEI S WI+
Sbjct  372  GERYRSWAPDRQERFINSWVDALSDPRVTHEICSIWIT  409



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR I   V + S+PR+THE+R  WIS
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWIS  469



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSFPPDRQERFIRRVVDALSDPRVTHEIRSIWIS  469



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G R RSW    Q+R I   V + S+PRVTHEIRS W+S
Sbjct  432  GARFRSWPAERQERFIARVVDALSDPRVTHEIRSIWLS  469



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V++ S+PRVT+EIRS WIS
Sbjct  432  GERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469



>gb|AFI48101.1| catalase isozyme B, partial [Oryza rhizomatis]
Length=121

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  117



>gb|AFI48054.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48055.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48056.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48064.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48065.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48066.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48067.1| catalase isozyme B, partial [Oryza rufipogon]
Length=121

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  117



>gb|ABY68158.1| catalase, partial [Oryza rufipogon]
 gb|AFI48042.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48043.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48044.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48045.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48046.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48047.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48048.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48049.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48050.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48051.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48052.1| catalase isozyme B, partial [Oryza nivara]
 gb|AFI48053.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48057.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48058.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48059.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48060.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48061.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48062.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48063.1| catalase isozyme B, partial [Oryza rufipogon]
 gb|AFI48069.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48070.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48071.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48072.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48073.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48074.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48075.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48076.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48077.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48078.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48079.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48080.1| catalase isozyme B, partial [Oryza barthii]
 gb|AFI48105.1| catalase isozyme B, partial [Oryza eichingeri]
 gb|AFI48112.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48113.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48114.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48115.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48116.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48117.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48118.1| catalase isozyme B, partial [Oryza australiensis]
 gb|AFI48119.1| catalase isozyme B, partial [Oryza australiensis]
Length=121

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  117



>gb|AFI48111.1| catalase isozyme B, partial [Oryza australiensis]
Length=121

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  117



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V   S+PR+THE+R+ WIS
Sbjct  432  GERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWIS  469



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + SEPR+T EIRS W+S
Sbjct  432  GERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVS  469



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  304  GERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWIS  341



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V++ S+PRVT+EIRS WIS
Sbjct  432  GERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469



>gb|ABY68159.1| catalase, partial [Oryza punctata]
 gb|AFI48081.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48082.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48083.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48084.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48085.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48086.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48087.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48088.1| catalase isozyme B, partial [Oryza punctata]
 gb|AFI48089.1| catalase isozyme B, partial [Oryza punctata]
Length=121

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR +   V + S+PR+THE+R  WIS
Sbjct  80   GERYRSFDPARQDRFLHRWVDALSDPRITHELRGIWIS  117



>gb|ADU56198.1| catalase [Musa acuminata AAA Group]
Length=492

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +    ++   P+V+HE+RS WIS
Sbjct  432  GERYRSWTPDRQDRFVRRWAEALGHPKVSHELRSIWIS  469



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R+W P  QDR     +++ S+PRVTHE+RS WIS
Sbjct  433  GERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  470



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R+W P  QDR     +++ S+PRVTHE+RS WIS
Sbjct  432  GERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  469



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW    Q+R +   V + +EPRVTHEIRS WIS
Sbjct  432  GERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWIS  469



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR +   V+  S+PRVT+EIRS WI 
Sbjct  429  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIC  466



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWIS  469



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+  RSW P  Q+R +   V + S+PR THEIRS WIS
Sbjct  432  GEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWIS  469



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS+ P  QDR I   V + S+PRVTHE RS WIS
Sbjct  487  GERYRSFDPARQDRFIQRVVDALSDPRVTHEHRSIWIS  524



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RS  P  Q+R I   V + S+PRVTHEIRS WIS
Sbjct  432  GERYRSMDPARQERFICRVVDALSDPRVTHEIRSIWIS  469



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R +   V + S+PRVTHEIR  WIS
Sbjct  432  GERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWIS  469



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+ +VTHE+R+ WIS
Sbjct  432  GDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWIS  469



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+ +VTHE+R+ WIS
Sbjct  401  GDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWIS  438



>dbj|BAD94702.1| catalase [Arabidopsis thaliana]
Length=108

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R R++ P  Q+R I   + + S+PR+THEIRS WIS
Sbjct  48   GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  85



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            GDR RSW P  Q+R +   V++ S+ +VTHE+R+ WIS
Sbjct  401  GDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWIS  438



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  QDR I   + + S PR+THEIRS W+S
Sbjct  440  GERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWLS  477



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  114  GDRXRSWXPXXQDRXIXXXVKSXSEPRVTHEIRSXWIS  1
            G+R RSW P  Q+R I   + + S+PR+THEIRS W+S
Sbjct  432  GERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLS  469



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565821549150