BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031H09

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD02268.1|  aspartate aminotransferase                             360   2e-122   Nicotiana tabacum [American tobacco]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    366   2e-121   Nicotiana sylvestris
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    366   2e-121   Solanum tuberosum [potatoes]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    364   1e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        364   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    363   3e-120   Solanum lycopersicum
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     362   5e-120   Solanum tuberosum [potatoes]
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        362   7e-120   
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         361   2e-119   Jatropha curcas
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    361   3e-119   Populus euphratica
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    361   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    360   4e-119   Populus euphratica
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    359   7e-119   
emb|CDP18792.1|  unnamed protein product                                362   1e-118   Coffea canephora [robusta coffee]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             357   6e-118   Citrus clementina [clementine]
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   355   7e-118   Citrus sinensis [apfelsine]
ref|XP_002515455.1|  aspartate aminotransferase, putative               355   3e-117   Ricinus communis
emb|CAN76227.1|  hypothetical protein VITISV_000267                     355   6e-117   Vitis vinifera
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    355   6e-117   Malus domestica [apple tree]
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    355   6e-117   Vitis vinifera
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    355   6e-117   Prunus mume [ume]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             354   9e-117   Prunus persica
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    351   3e-116   Cucumis melo [Oriental melon]
dbj|BAD94538.1|  aspartate aminotransferase                             343   3e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46621.1|  unknown                                                 345   4e-116   Lotus japonicus
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    352   5e-116   Elaeis guineensis
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    352   6e-116   Cucumis sativus [cucumbers]
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    351   7e-116   
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    352   1e-115   Cucumis melo [Oriental melon]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             350   2e-115   Capsella rubella
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    351   2e-115   Eucalyptus grandis [rose gum]
ref|XP_010089944.1|  Aspartate aminotransferase                         351   4e-115   
gb|ABK24563.1|  unknown                                                 350   5e-115   Picea sitchensis
gb|ACN40845.1|  unknown                                                 349   7e-115   Picea sitchensis
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   349   8e-115   Citrus sinensis [apfelsine]
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             348   2e-114   
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    347   3e-114   Camelina sativa [gold-of-pleasure]
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                347   4e-114   Erythranthe guttata [common monkey flower]
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                347   4e-114   Erythranthe guttata [common monkey flower]
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             347   6e-114   
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          347   7e-114   Amborella trichopoda
gb|AAC12674.1|  aspartate aminotransferase                              347   7e-114   Lotus corniculatus
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    346   8e-114   Brassica rapa
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    346   8e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    347   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    346   1e-113   Phoenix dactylifera
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    345   2e-113   Camelina sativa [gold-of-pleasure]
emb|CDJ26231.1|  putative aspartate aminotransferase                    345   2e-113   Brassica oleracea
ref|NP_194927.1|  aspartate aminotransferase                            345   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190885.1|  aspartate aminotransferase                         345   4e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CAA56932.1|  aspartate aminotransferase                             345   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161154.1|  hypothetical protein PHAVU_001G0470000g            337   7e-113   Phaseolus vulgaris [French bean]
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             344   1e-112   
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    343   1e-112   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                          343   1e-112   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    343   2e-112   Glycine max [soybeans]
ref|XP_007011759.1|  Aspartate aminotransferase                         343   2e-112   
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    342   2e-112   
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    343   3e-112   Cicer arietinum [garbanzo]
gb|ABR16448.1|  unknown                                                 341   3e-112   Picea sitchensis
gb|KEH39860.1|  aspartate aminotransferase                              343   3e-112   Medicago truncatula
prf||1908424A  Asp aminotransferase                                     343   3e-112
emb|CDY13467.1|  BnaA03g51850D                                          342   4e-112   Brassica napus [oilseed rape]
gb|AAB46611.1|  aspartate aminotransferase                              342   4e-112   Medicago sativa [alfalfa]
emb|CDX68807.1|  BnaC01g06460D                                          344   4e-112   
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    342   5e-112   Glycine max [soybeans]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    341   7e-112   Fragaria vesca subsp. vesca
gb|AAM67272.1|  aspartate aminotransferase                              341   8e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAO23563.1|  aspartate aminotransferase                              340   1e-111   Oryza sativa [red rice]
ref|NP_001031767.1|  aspartate aminotransferase                         341   1e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55008.1|  hypothetical protein B456_009G060500                    338   2e-111   Gossypium raimondii
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    339   3e-111   
ref|NP_001048397.1|  Os02g0797500                                       340   4e-111   
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     340   4e-111   Eucalyptus grandis [rose gum]
gb|KJB55007.1|  hypothetical protein B456_009G060500                    340   6e-111   Gossypium raimondii
gb|KJB65890.1|  hypothetical protein B456_010G117400                    339   6e-111   Gossypium raimondii
gb|KJB55006.1|  hypothetical protein B456_009G060500                    339   6e-111   Gossypium raimondii
gb|KJB65891.1|  hypothetical protein B456_010G117400                    339   7e-111   Gossypium raimondii
gb|ACU24502.1|  unknown                                                 339   9e-111   Glycine max [soybeans]
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    338   1e-110   Phaseolus vulgaris [French bean]
emb|CDX72339.1|  BnaC07g43610D                                          338   1e-110   
ref|NP_001237987.1|  aspartate aminotransferase                         338   1e-110   
gb|KJB55009.1|  hypothetical protein B456_009G060500                    339   3e-110   Gossypium raimondii
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   337   3e-110   Panicum miliaceum [broom millet]
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    336   9e-110   Lupinus angustifolius
dbj|BAJ97030.1|  predicted protein                                      332   1e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    335   2e-109   Gossypium arboreum [tree cotton]
gb|ACR34530.1|  unknown                                                 335   2e-109   Zea mays [maize]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    335   3e-109   Setaria italica
ref|XP_001785888.1|  predicted protein                                  335   3e-109   
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    334   5e-109   Glycine max [soybeans]
ref|NP_001149005.1|  aspartate aminotransferase                         333   1e-108   
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               333   1e-108   Triticum urartu
dbj|BAJ92741.1|  predicted protein                                      332   3e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               333   4e-108   
dbj|BAJ96638.1|  predicted protein                                      330   1e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    330   2e-107   Brachypodium distachyon [annual false brome]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             328   4e-107   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             328   4e-107   
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  327   3e-106   Canavalia lineata
prf||2009357A  Asp aminotransferase                                     327   4e-106
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  320   8e-105   Triticum aestivum [Canadian hard winter wheat]
emb|CAA04697.1|  aspartate aminotransferase 2                           313   9e-101   Canavalia lineata
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    309   7e-100   
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    305   2e-97    Phoenix dactylifera
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            303   9e-97    Glycine soja [wild soybean]
ref|XP_008784800.1|  PREDICTED: aspartate aminotransferase, chlor...    284   3e-90    
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    285   3e-89    
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    276   1e-86    Nicotiana tomentosiformis
ref|XP_005642879.1|  aspartate aminotransferase                         266   1e-82    Coccomyxa subellipsoidea C-169
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    264   7e-82    Tarenaya hassleriana [spider flower]
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             264   8e-82    Chlorella variabilis
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       259   1e-80    Auxenochlorella protothecoides
ref|XP_002501168.1|  aspartate aminotransferase                         243   3e-74    Micromonas commoda
gb|EPS71467.1|  aspartate aminotransferase                              231   3e-73    Genlisea aurea
tpg|DAA57533.1|  TPA: hypothetical protein ZEAMMB73_000065              233   5e-73    
ref|XP_010519716.1|  PREDICTED: aspartate aminotransferase, cytop...    237   1e-72    Tarenaya hassleriana [spider flower]
ref|XP_002514283.1|  aspartate aminotransferase, putative               239   2e-72    
ref|XP_001700039.1|  aspartate aminotransferase                         239   3e-72    Chlamydomonas reinhardtii
ref|XP_010519717.1|  PREDICTED: aspartate aminotransferase, cytop...    238   4e-72    Tarenaya hassleriana [spider flower]
gb|AAM91546.1|  aspartate aminotransferase Asp2                         231   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    237   9e-72    Populus euphratica
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         236   1e-71    Jatropha curcas
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            236   1e-71    
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    236   1e-71    Oryza sativa Japonica Group [Japonica rice]
gb|KIZ05915.1|  aspartate aminotransferase                              234   2e-71    Monoraphidium neglectum
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    236   2e-71    Populus euphratica
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    237   3e-71    Oryza brachyantha
ref|XP_002954714.1|  aspartate aminotransferase                         236   3e-71    Volvox carteri f. nagariensis
ref|NP_001044317.1|  Os01g0760600                                       236   4e-71    
emb|CBI20886.3|  unnamed protein product                                235   6e-71    Vitis vinifera
ref|XP_009131210.1|  PREDICTED: aspartate aminotransferase 3, chl...    236   7e-71    Brassica rapa
emb|CDX70399.1|  BnaC03g04830D                                          236   7e-71    
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    236   8e-71    Setaria italica
ref|XP_002324997.1|  aspartate aminotransferase family protein          234   8e-71    Populus trichocarpa [western balsam poplar]
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    235   1e-70    Vitis vinifera
emb|CAN70394.1|  hypothetical protein VITISV_020521                     234   1e-70    Vitis vinifera
gb|ACU21245.1|  unknown                                                 232   1e-70    Glycine max [soybeans]
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          235   1e-70    Amborella trichopoda
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             235   1e-70    Citrus clementina [clementine]
ref|XP_009401092.1|  PREDICTED: aspartate aminotransferase, chlor...    229   1e-70    
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    235   1e-70    Phoenix dactylifera
emb|CDP03316.1|  unnamed protein product                                234   1e-70    Coffea canephora [robusta coffee]
ref|XP_002308618.1|  aspartate transaminase family protein              235   2e-70    Populus trichocarpa [western balsam poplar]
ref|XP_002950644.1|  aspartate aminotransferase                         234   2e-70    Volvox carteri f. nagariensis
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    234   2e-70    Populus euphratica
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    233   2e-70    Vitis vinifera
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         234   2e-70    Jatropha curcas
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    234   3e-70    Citrus sinensis [apfelsine]
gb|ABY58643.1|  aspartate aminotransferase                              232   3e-70    Triticum aestivum [Canadian hard winter wheat]
emb|CDP16161.1|  unnamed protein product                                233   3e-70    Coffea canephora [robusta coffee]
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       233   4e-70    Glycine max [soybeans]
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    233   4e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007012061.1|  Aspartate aminotransferase 3                       234   4e-70    
emb|CDM84293.1|  unnamed protein product                                234   5e-70    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003064597.1|  aspartate amino transferase                        233   5e-70    Micromonas pusilla CCMP1545
ref|XP_010100270.1|  Aspartate aminotransferase                         234   5e-70    Morus notabilis
ref|XP_005643912.1|  aspartate aminotransferase                         233   5e-70    Coccomyxa subellipsoidea C-169
gb|KHN10226.1|  Aspartate aminotransferase 1                            233   5e-70    Glycine soja [wild soybean]
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 232   6e-70    Gossypium arboreum [tree cotton]
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    232   6e-70    Camelina sativa [gold-of-pleasure]
ref|NP_001141224.1|  uncharacterized protein LOC100273311               233   7e-70    Zea mays [maize]
ref|XP_002516566.1|  aspartate aminotransferase, putative               233   7e-70    Ricinus communis
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    233   7e-70    Elaeis guineensis
ref|NP_001237541.1|  aspartate aminotransferase glyoxysomal isozy...    233   8e-70    Glycine max [soybeans]
ref|XP_001695040.1|  aspartate aminotransferase                         233   8e-70    Chlamydomonas reinhardtii
gb|AEX09182.1|  putative aspartate aminotransferase 1                   231   9e-70    Gossypium hirsutum [American cotton]
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    231   1e-69    Camelina sativa [gold-of-pleasure]
ref|XP_008466236.1|  PREDICTED: aspartate aminotransferase, cytop...    233   1e-69    Cucumis melo [Oriental melon]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    233   1e-69    Solanum lycopersicum
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    233   1e-69    Sesamum indicum [beniseed]
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             231   1e-69    Citrus clementina [clementine]
ref|XP_004136291.1|  PREDICTED: aspartate aminotransferase, chlor...    233   1e-69    Cucumis sativus [cucumbers]
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    233   1e-69    
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             231   1e-69    Arabidopsis lyrata subsp. lyrata
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    232   2e-69    Gossypium arboreum [tree cotton]
ref|XP_002873517.1|  hypothetical protein ARALYDRAFT_487989             232   2e-69    Arabidopsis lyrata subsp. lyrata
gb|AAA79370.1|  aspartate aminotransferase                              231   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    231   2e-69    Nicotiana sylvestris
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    232   2e-69    Nicotiana tomentosiformis
ref|NP_196713.1|  aspartate aminotransferase 3                          232   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg             230   2e-69    Capsella rubella
gb|AAL09704.1|AF419301_1  aspartate aminotransferase                    228   2e-69    Securigera parviflora
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    232   3e-69    Nelumbo nucifera [Indian lotus]
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 230   3e-69    
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       232   3e-69    Cicer arietinum [garbanzo]
ref|NP_197456.1|  aspartate aminotransferase                            230   3e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    230   3e-69    Camelina sativa [gold-of-pleasure]
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    230   3e-69    Sesamum indicum [beniseed]
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    232   4e-69    Prunus mume [ume]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    231   4e-69    Solanum tuberosum [potatoes]
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    230   5e-69    Nicotiana tomentosiformis
gb|KJB07521.1|  hypothetical protein B456_001G028100                    231   5e-69    Gossypium raimondii
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    231   6e-69    Nicotiana sylvestris
ref|XP_001771002.1|  predicted protein                                  229   6e-69    
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    231   8e-69    Citrus sinensis [apfelsine]
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    229   8e-69    Daucus carota [carrots]
ref|XP_006289742.1|  hypothetical protein CARUB_v10003310mg             230   8e-69    Capsella rubella
gb|KFK25414.1|  aspartate aminotransferase                              230   1e-68    Arabis alpina [alpine rockcress]
ref|XP_010688229.1|  PREDICTED: aspartate aminotransferase, cytop...    229   1e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    229   1e-68    Malus domestica [apple tree]
ref|XP_010419724.1|  PREDICTED: aspartate aminotransferase 3, chl...    230   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             230   1e-68    Prunus persica
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     230   1e-68    Eucalyptus grandis [rose gum]
ref|XP_010048107.1|  PREDICTED: aspartate aminotransferase, cytop...    228   1e-68    Eucalyptus grandis [rose gum]
ref|XP_006399658.1|  hypothetical protein EUTSA_v10013515mg             230   1e-68    Eutrema salsugineum [saltwater cress]
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799              228   1e-68    Chlorella variabilis
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    230   1e-68    Brachypodium distachyon [annual false brome]
gb|AEX09183.1|  putative aspartate aminotransferase 2                   229   2e-68    Gossypium hirsutum [American cotton]
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    230   2e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010042868.1|  PREDICTED: aspartate aminotransferase P2, mi...    219   2e-68    Eucalyptus grandis [rose gum]
gb|KJB64944.1|  hypothetical protein B456_010G072900                    228   2e-68    Gossypium raimondii
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    229   2e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    229   2e-68    
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    229   2e-68    
emb|CAA45023.1|  aspartate aminotransferase                             228   3e-68    Panicum miliaceum [broom millet]
ref|XP_004291203.1|  PREDICTED: aspartate aminotransferase, cytop...    229   3e-68    Fragaria vesca subsp. vesca
ref|XP_010453196.1|  PREDICTED: aspartate aminotransferase 3, chl...    229   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010491885.1|  PREDICTED: aspartate aminotransferase 3, chl...    229   3e-68    Camelina sativa [gold-of-pleasure]
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                    227   4e-68    Arabis alpina [alpine rockcress]
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    227   6e-68    Brassica rapa
emb|CDX92520.1|  BnaA10g15590D                                          227   6e-68    
emb|CDY65959.1|  BnaC09g54080D                                          227   7e-68    Brassica napus [oilseed rape]
ref|XP_009367911.1|  PREDICTED: aspartate aminotransferase, cytop...    228   9e-68    Pyrus x bretschneideri [bai li]
emb|CDY44925.1|  BnaA02g04300D                                          226   9e-68    Brassica napus [oilseed rape]
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             226   1e-67    Eutrema salsugineum [saltwater cress]
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    228   1e-67    Pyrus x bretschneideri [bai li]
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    226   1e-67    Solanum tuberosum [potatoes]
ref|XP_010532471.1|  PREDICTED: aspartate aminotransferase 3, chl...    227   2e-67    Tarenaya hassleriana [spider flower]
gb|AFK40370.1|  unknown                                                 226   3e-67    Medicago truncatula
ref|XP_004243159.1|  PREDICTED: aspartate aminotransferase, cytop...    225   3e-67    
gb|AAA33408.1|  aspartate aminotransferase P1                           225   4e-67    Lupinus angustifolius
gb|KEH36022.1|  aspartate aminotransferase                              225   4e-67    Medicago truncatula
gb|AAA50160.1|  aspartate aminotransferase P1                           225   4e-67    Lupinus angustifolius
emb|CAA43779.1|  aspartate aminotransferase                             225   4e-67    Medicago sativa [alfalfa]
emb|CDY71396.1|  BnaCnng72730D                                          219   5e-67    Brassica napus [oilseed rape]
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    229   8e-67    
emb|CDY42276.1|  BnaC02g08820D                                          224   1e-66    Brassica napus [oilseed rape]
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818             224   1e-66    
gb|KEH36020.1|  aspartate aminotransferase                              225   1e-66    Medicago truncatula
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                225   1e-66    Erythranthe guttata [common monkey flower]
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    223   4e-66    Medicago sativa [alfalfa]
gb|ABR16105.1|  unknown                                                 223   4e-66    Picea sitchensis
emb|CAA63894.1|  aspartate aminotransferase                             222   5e-66    Lotus japonicus
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954             222   7e-66    
gb|KJB64945.1|  hypothetical protein B456_010G072900                    221   8e-66    Gossypium raimondii
gb|ACN40894.1|  unknown                                                 222   1e-65    Picea sitchensis
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    221   1e-65    Brassica rapa
gb|KCW80240.1|  hypothetical protein EUGRSUZ_C01585                     220   2e-65    Eucalyptus grandis [rose gum]
dbj|BAE99790.1|  aspartate aminotransferase                             214   8e-65    Arabidopsis thaliana [mouse-ear cress]
gb|KJB07520.1|  hypothetical protein B456_001G028000                    216   2e-64    Gossypium raimondii
ref|XP_002308617.2|  hypothetical protein POPTR_0006s25820g             219   5e-64    
ref|XP_009112705.1|  PREDICTED: aspartate aminotransferase, cytop...    216   1e-63    Brassica rapa
gb|KJB07518.1|  hypothetical protein B456_001G028000                    216   1e-63    Gossypium raimondii
gb|KHG23915.1|  Aspartate aminotransferase, cytoplasmic                 216   1e-63    Gossypium arboreum [tree cotton]
ref|XP_011401594.1|  Aspartate aminotransferase 1                       215   2e-63    Auxenochlorella protothecoides
ref|XP_010048111.1|  PREDICTED: aspartate aminotransferase, cytop...    214   3e-63    
tpg|DAA57534.1|  TPA: hypothetical protein ZEAMMB73_000065              207   5e-63    
emb|CDY39814.1|  BnaA09g10660D                                          214   5e-63    Brassica napus [oilseed rape]
ref|XP_010048110.1|  PREDICTED: aspartate aminotransferase, cytop...    214   7e-63    Eucalyptus grandis [rose gum]
ref|XP_011019649.1|  PREDICTED: aspartate aminotransferase, cytop...    214   9e-63    Populus euphratica
ref|NP_849838.1|  aspartate aminotransferase 4                          213   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AAA79372.1|  aspartate aminotransferase                              213   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564803.1|  aspartate aminotransferase 4                          213   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002680594.1|  aspartate aminotransferase                         214   2e-62    Naegleria gruberi strain NEG-M
ref|XP_004339901.1|  aspartate aminotransferase, putative               214   2e-62    Acanthamoeba castellanii str. Neff
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779              213   3e-62    Guillardia theta CCMP2712
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...    213   3e-62    Acanthamoeba castellanii str. Neff
ref|XP_010473503.1|  PREDICTED: aspartate aminotransferase, cytop...    212   3e-62    Camelina sativa [gold-of-pleasure]
gb|ADP03185.1|  aspartate transaminase                                  210   3e-62    Pinus sylvestris [Scotch pine]
gb|ADP03197.1|  aspartate transaminase                                  210   3e-62    Pinus sylvestris [Scotch pine]
gb|ADP03191.1|  aspartate transaminase                                  210   3e-62    Pinus sylvestris [Scotch pine]
ref|XP_007012062.1|  Aspartate aminotransferase 3, putative             216   3e-62    
ref|XP_002886453.1|  hypothetical protein ARALYDRAFT_475071             212   4e-62    
emb|CBK20182.2|  unnamed protein product                                212   7e-62    Blastocystis hominis
gb|ADP03202.1|  aspartate transaminase                                  209   1e-61    Pinus sylvestris [Scotch pine]
gb|ADP03187.1|  aspartate transaminase                                  209   1e-61    Pinus sylvestris [Scotch pine]
emb|CDY20276.1|  BnaC04g36800D                                          210   2e-61    Brassica napus [oilseed rape]
ref|XP_002516565.1|  aspartate aminotransferase, putative               209   3e-61    
ref|XP_009123404.1|  PREDICTED: aspartate aminotransferase, cytop...    209   3e-61    
gb|AIT70258.1|  aspartate aminotransferase                              209   4e-61    
ref|XP_010430356.1|  PREDICTED: aspartate aminotransferase, cytop...    209   4e-61    
emb|CDS12997.1|  Putative Aspartate aminotransferase                    209   5e-61    
ref|XP_009113043.1|  PREDICTED: aspartate aminotransferase, cytop...    208   7e-61    
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                   209   8e-61    
emb|CDY32206.1|  BnaA03g54610D                                          208   8e-61    
emb|CDY31847.1|  BnaC09g13020D                                          208   1e-60    
emb|CDH50946.1|  aspartate aminotransferase                             208   2e-60    
gb|AIT70254.1|  aspartate aminotransferase                              207   2e-60    
ref|XP_008220045.1|  PREDICTED: aspartate aminotransferase, cytop...    207   2e-60    
gb|AIT70267.1|  aspartate aminotransferase                              207   2e-60    
ref|XP_007338662.1|  aspartate aminotransferase                         207   3e-60    
gb|AIT70257.1|  aspartate aminotransferase                              207   3e-60    
ref|XP_003036007.1|  hypothetical protein SCHCODRAFT_65913              207   3e-60    
ref|XP_006302336.1|  hypothetical protein CARUB_v10020394mg             207   3e-60    
emb|CDY46924.1|  BnaA09g12700D                                          206   4e-60    
ref|XP_005705870.1|  aspartate aminotransferase                         206   5e-60    
ref|XP_008347631.1|  PREDICTED: aspartate aminotransferase, cytop...    206   5e-60    
emb|CDY34689.1|  BnaC04g19940D                                          207   5e-60    
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635              206   5e-60    
gb|AIT70262.1|  aspartate aminotransferase                              206   6e-60    
ref|XP_009058471.1|  hypothetical protein LOTGIDRAFT_217673             206   9e-60    
ref|XP_006391820.1|  hypothetical protein EUTSA_v10023500mg             206   1e-59    
ref|XP_010418279.1|  PREDICTED: aspartate aminotransferase, cytop...    205   1e-59    
ref|XP_002168444.2|  PREDICTED: aspartate aminotransferase, mitoc...    205   2e-59    
gb|ESA01319.1|  hypothetical protein GLOINDRAFT_338037                  205   2e-59    
gb|AIT70256.1|  aspartate aminotransferase                              205   2e-59    
gb|KIJ34684.1|  hypothetical protein M422DRAFT_213094                   205   2e-59    
gb|AIT70259.1|  aspartate aminotransferase                              204   3e-59    
gb|AIT70252.1|  aspartate aminotransferase                              206   3e-59    
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828             204   3e-59    
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821              204   4e-59    
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                    204   4e-59    
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517                 204   9e-59    
ref|XP_004365869.1|  aspartate aminotransferase P1                      203   9e-59    
gb|KIR78943.1|  aspartate aminotransferase                              202   2e-58    
gb|EMD38441.1|  hypothetical protein CERSUDRAFT_82693                   202   2e-58    
gb|KIR97164.1|  aspartate aminotransferase                              202   2e-58    
gb|AFR98265.1|  aspartate aminotransferase                              202   3e-58    
gb|EPZ32806.1|  Aspartate aminotransferase, mitochondrial               201   4e-58    
emb|CEL53865.1|  aspartate aminotransferase                             202   4e-58    
gb|AIT70250.1|  aspartate aminotransferase                              202   4e-58    
gb|KIR44346.1|  aspartate aminotransferase                              201   5e-58    
ref|XP_003197192.1|  aspartate transaminase                             201   5e-58    
ref|NP_998544.1|  aspartate aminotransferase 2a                         201   5e-58    
gb|KIR50768.1|  aspartate aminotransferase                              201   5e-58    
ref|XP_008378103.1|  PREDICTED: aspartate aminotransferase, cytop...    205   5e-58    
gb|KEH36021.1|  aspartate aminotransferase                              201   6e-58    
gb|EJU05387.1|  aspartate aminotransferase                              201   7e-58    
ref|XP_007407231.1|  hypothetical protein MELLADRAFT_42605              201   7e-58    
gb|KGB78925.1|  aspartate transaminase                                  201   7e-58    
ref|XP_003331101.1|  aspartate aminotransferase, mitochondrial          201   8e-58    
gb|KFM62856.1|  Aspartate aminotransferase, mitochondrial               194   8e-58    
ref|XP_568366.1|  aspartate transaminase                                201   9e-58    
gb|AFJ23640.1|  plasma membrane fatty acid binding protein              194   9e-58    
ref|XP_002765977.1|  aspartate aminotransferase, cytoplasmic isoz...    195   1e-57    
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   201   1e-57    
gb|KIR82897.1|  aspartate aminotransferase                              200   1e-57    
gb|EFZ21338.1|  hypothetical protein SINV_02306                         201   1e-57    
ref|XP_007223291.1|  hypothetical protein PRUPE_ppa005576mg             201   1e-57    
ref|XP_011175557.1|  PREDICTED: aspartate aminotransferase, mitoc...    201   1e-57    
gb|KFH12158.1|  aspartate aminotransferase                              198   1e-57    
ref|XP_006476085.1|  PREDICTED: aspartate aminotransferase, cytop...    200   1e-57    
gb|EJT48226.1|  aspartate transaminase                                  200   2e-57    
gb|KDP34207.1|  hypothetical protein JCGZ_07778                         200   2e-57    
ref|XP_003886076.1|  Contig An16c0190, complete genome. (Precurso...    200   2e-57    
ref|XP_002764661.1|  aspartate aminotransferase, cytoplasmic, put...    199   2e-57    
ref|XP_002391771.1|  hypothetical protein MPER_08751                    193   2e-57    
gb|AIT70255.1|  aspartate aminotransferase                              199   2e-57    
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873             200   2e-57    
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                   199   3e-57    
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644             199   3e-57    
ref|XP_008883875.1|  aspartate aminotransferase                         199   3e-57    
ref|XP_006476084.1|  PREDICTED: aspartate aminotransferase, cytop...    199   3e-57    
gb|KFG54125.1|  aspartate aminotransferase                              198   3e-57    
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1             199   3e-57    
ref|XP_007385770.1|  aspartate aminotransferase                         199   4e-57    
gb|KDE07915.1|  aspartate aminotransferase                              199   4e-57    
gb|KFH15985.1|  aspartate aminotransferase                              197   5e-57    
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                   199   5e-57    
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242              199   5e-57    
emb|CEI89409.1|  Putative Aspartate aminotransferase                    199   6e-57    
ref|XP_007395810.1|  hypothetical protein PHACADRAFT_256136             199   6e-57    
gb|AFR98315.2|  aspartate aminotransferase, mitchondrial                199   6e-57    
gb|EIE83310.1|  aspartate aminotransferase                              199   6e-57    
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             199   7e-57    
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475             198   8e-57    
ref|XP_003402856.1|  PREDICTED: aspartate aminotransferase, mitoc...    198   8e-57    
gb|EFA86317.1|  aspartate aminotransferase                              199   9e-57    
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521              198   9e-57    
ref|XP_011301390.1|  PREDICTED: probable aspartate aminotransfera...    198   1e-56    
gb|EKD02362.1|  aspartate aminotransferase                              198   1e-56    
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...    198   1e-56    
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                   198   1e-56    
ref|XP_011348908.1|  PREDICTED: aspartate aminotransferase, mitoc...    198   1e-56    
ref|XP_009112706.1|  PREDICTED: aspartate aminotransferase, cytop...    197   1e-56    
gb|KFG64384.1|  aspartate aminotransferase                              197   1e-56    
ref|XP_010195211.1|  PREDICTED: aspartate aminotransferase, mitoc...    192   1e-56    
gb|AID18683.1|  aspartate aminotransferase                              197   1e-56    
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                  197   2e-56    
ref|XP_640082.1|  aspartate aminotransferase                            198   2e-56    
ref|XP_006005346.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   2e-56    
ref|XP_007945864.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   2e-56    
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1             197   2e-56    
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               197   2e-56    
ref|NP_001080255.1|  aspartate aminotransferase 2                       197   2e-56    
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   2e-56    
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                   197   2e-56    
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                   197   2e-56    
gb|KDR10996.1|  Aspartate aminotransferase, mitochondrial               197   2e-56    
ref|XP_003706300.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   2e-56    
emb|CEG72748.1|  Putative Aspartate aminotransferase                    197   2e-56    
gb|AIT70268.1|  aspartate aminotransferase                              197   2e-56    
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   2e-56    
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   2e-56    
gb|AIT70266.1|  aspartate aminotransferase                              197   2e-56    
gb|KEP48167.1|  aspartate aminotransferase                              197   2e-56    
ref|XP_007863462.1|  aspartate amino-transferase                        197   3e-56    
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                   197   3e-56    
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial               197   3e-56    
gb|KGB35954.1|  Aspartate aminotransferase, mitochondrial               197   3e-56    
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   3e-56    
gb|KDO34648.1|  hypothetical protein SPRG_00710                         197   3e-56    
gb|KIP08181.1|  hypothetical protein PHLGIDRAFT_29717                   197   3e-56    
emb|CAX70162.1|  glutamic-oxaloacetic transaminase 1                    190   3e-56    
gb|KFH62511.1|  aspartate aminotransferase                              197   3e-56    
gb|AIT70269.1|  aspartate aminotransferase                              197   3e-56    
gb|KGB78963.1|  aspartate aminotransferase                              197   3e-56    
gb|KFV73576.1|  hypothetical protein N308_13552                         196   3e-56    
ref|XP_007361273.1|  aspartate aminotransferase                         196   3e-56    
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial               197   4e-56    
ref|XP_006878783.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   4e-56    
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial               197   4e-56    
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...    197   4e-56    
gb|KIR52756.1|  aspartate aminotransferase, mitochondrial               197   4e-56    
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...    197   4e-56    
dbj|GAN02936.1|  aspartate aminotransferase                             196   4e-56    
ref|XP_011054104.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   5e-56    
ref|XP_010224070.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   5e-56    
gb|KIY68604.1|  aspartate amino-transferase                             196   5e-56    
gb|EFA04122.1|  hypothetical protein TcasGA2_TC014364                   196   5e-56    
gb|EPB81442.1|  aspartate aminotransferase                              196   5e-56    
emb|CDM87357.1|  mitochondrial aspartate aminotransferase               193   5e-56    
ref|XP_007882640.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   5e-56    
ref|XP_568414.1|  aspartate aminotransferase mitochondrial precursor    197   5e-56    
dbj|BAO48147.2|  mitochondrial aspartate aminotransferase               193   5e-56    
ref|XP_004600686.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   5e-56    
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   6e-56    
ref|XP_007321884.1|  hypothetical protein SERLADRAFT_475342             196   6e-56    
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   6e-56    
gb|KIR45953.1|  aspartate aminotransferase, mitochondrial               196   6e-56    
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial               196   6e-56    
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   6e-56    
ref|XP_002644843.1|  Hypothetical protein CBG05011                      196   6e-56    
ref|XP_011258211.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   7e-56    
emb|CEP19900.1|  hypothetical protein                                   196   7e-56    
ref|XP_009542586.1|  hypothetical protein HETIRDRAFT_414741             196   7e-56    
ref|XP_001833338.2|  aspartate aminotransferase                         196   8e-56    
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   8e-56    
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                  196   8e-56    
gb|AIT70270.1|  aspartate aminotransferase                              196   9e-56    
gb|EFN75676.1|  Aspartate aminotransferase, mitochondrial               195   9e-56    
ref|XP_007468386.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   9e-56    
gb|KFG46516.1|  aspartate aminotransferase                              199   9e-56    
gb|KGL84885.1|  hypothetical protein N309_05764                         195   9e-56    
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   9e-56    
ref|XP_004395810.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   9e-56    
gb|KDQ60719.1|  hypothetical protein JAAARDRAFT_31694                   195   9e-56    
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   196   9e-56    
ref|XP_003486130.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   9e-56    
ref|XP_004356181.1|  aspartate aminotransferase                         196   1e-55    
ref|XP_003401530.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    195   1e-55    
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   1e-55    
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   1e-55    
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    194   1e-55    
ref|XP_010329683.1|  PREDICTED: aspartate aminotransferase, mitoc...    196   1e-55    
gb|AAF19543.1|AC007190_11  F23N19.17                                    194   1e-55    
ref|XP_001017054.2|  aminotransferase, classes I and II family pr...    196   1e-55    
ref|XP_772230.1|  hypothetical protein CNBM0360                         195   1e-55    
ref|XP_006732871.1|  PREDICTED: aspartate aminotransferase, mitoc...    194   1e-55    
gb|EPR63537.1|  aspartate aminotransferase                              199   1e-55    
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   1e-55    
ref|XP_002367206.1|  aspartate aminotransferase, putative               197   1e-55    
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                   195   1e-55    
ref|XP_002764660.1|  aspartate aminotransferase, cytoplasmic, put...    194   1e-55    
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   1e-55    
ref|XP_008868102.1|  hypothetical protein H310_05218                    195   1e-55    
gb|KCW80245.1|  hypothetical protein EUGRSUZ_C01588                     194   1e-55    
gb|KIO06515.1|  hypothetical protein M404DRAFT_946120                   194   2e-55    
gb|AEI84589.1|  mitochondrial aspartate transaminase                    194   2e-55    
ref|XP_011152687.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|KFO92044.1|  hypothetical protein N320_04667                         194   2e-55    
gb|EJT99836.1|  aspartate aminotransferase                              195   2e-55    
ref|XP_001176672.2|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
emb|CDO72878.1|  hypothetical protein BN946_scf185002.g63               196   2e-55    
dbj|BAE29370.1|  unnamed protein product                                193   2e-55    
ref|XP_004067248.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|EFB22248.1|  hypothetical protein PANDA_000063                       194   2e-55    
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   194   2e-55    
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|EPT06097.1|  hypothetical protein FOMPIDRAFT_1021172                 194   2e-55    
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|KFP90495.1|  hypothetical protein N311_04899                         194   2e-55    
ref|XP_010965547.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial          195   2e-55    
gb|AEI84602.1|  mitochondrial aspartate transaminase                    194   2e-55    
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|EGT43052.1|  hypothetical protein CAEBREN_26153                      194   2e-55    
ref|XP_004690564.1|  PREDICTED: aspartate aminotransferase, mitoc...    194   2e-55    
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|KFG48451.1|  aspartate aminotransferase                              198   2e-55    
gb|AEI84593.1|  mitochondrial aspartate transaminase                    194   2e-55    
ref|XP_007359882.1|  PLP-dependent transferase                          195   2e-55    
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
gb|EUC62180.1|  aspartate aminotransferase                              195   2e-55    
ref|XP_003493676.1|  PREDICTED: probable aspartate aminotransfera...    194   2e-55    
gb|AEI84595.1|  mitochondrial aspartate transaminase                    194   2e-55    
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...    195   2e-55    
ref|XP_006193091.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    195   2e-55    



>dbj|BAD02268.1| aspartate aminotransferase [Nicotiana tabacum]
Length=227

 Score =   360 bits (924),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG LD DASSVR+FA+RG+ELLVAQSYSKNLGLY ERIGAINV CSSADAA RVKS
Sbjct  40   QGFASGGLDEDASSVRLFAARGMELLVAQSYSKNLGLYGERIGAINVPCSSADAATRVKS  99

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KD
Sbjct  100  QLKRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKD  159

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW +ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAI
Sbjct  160  KSGKDWPYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAI  219

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  220  IDSYYNVS  227



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RG+ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKS
Sbjct  275  QGFASGSLDEDASSVRLFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KD
Sbjct  335  QLKRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSTKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW++ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAI
Sbjct  395  KSGKDWSYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAI  454

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  455  IDSYYNVS  462



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVRMFA+RG+ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKS
Sbjct  282  QGFASGSLDEDASSVRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKS  341

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KD
Sbjct  342  QLKRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKD  401

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAI
Sbjct  402  KSGKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAI  461

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  462  IDSYYNVS  469



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASS+R+FASRG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  272  QGFASGSLDEDASSMRLFASRGMELLVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGA+IVANVVGNP+LFNEWK+EMEMMAGRIKSVRQKLYD+L  KD
Sbjct  332  QLKRLARPMYSNPPVHGAKIVANVVGNPDLFNEWKEEMEMMAGRIKSVRQKLYDNLISKD  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW++ILKQIGMFSFTGLNKAQS+NM+NKWHIYMTKDGRISLAGLSAAKCEYLADAI
Sbjct  392  KSGKDWSYILKQIGMFSFTGLNKAQSDNMTNKWHIYMTKDGRISLAGLSAAKCEYLADAI  451

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  452  IDSYYNVS  459



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  279  QGFASGSLDADASSVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  338

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KD
Sbjct  339  QLKRIARPMYSNPPVHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKD  398

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  399  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  458

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  459  IDSYHNVS  466



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVRMFA+RG+ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKS
Sbjct  275  QGFASGSLDEDASSVRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KD
Sbjct  335  QLKRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGK+W+FILKQIGMFSFTGL++AQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAI
Sbjct  395  KSGKNWSFILKQIGMFSFTGLDRAQSENMANKWHVYMTKDGRISLAGLSAAKCEYLADAI  454

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  455  IDSYYNVS  462



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVRMFA+RG+ELLVAQSYSKNLGLY ERIGAINV+CSSA AA RVKS
Sbjct  275  QGFASGSLDEDASSVRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSAYAATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KD
Sbjct  335  QLKRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAI
Sbjct  395  KSGKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAI  454

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  455  IDSYYNVS  462



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELL+AQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  279  QGFASGSLDADASSVRLFAARGMELLIAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  338

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KD
Sbjct  339  QLKRIARPMYSNPPVHGARIVANVVGDPILFNEWKEEMEMLAGRIKNVRQKLFDSLSAKD  398

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  399  KSGKDWSFILKQIGMFSFTGLNKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  458

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  459  IDSYHNVS  466



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  279  QGFASGSLDADAASVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  338

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKL+DSLS KD
Sbjct  339  QLKRLARPMYSNPPVHGARIVANVVGDPTLFNEWKAEMEMMAGRIKGVRQKLFDSLSAKD  398

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  399  KSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  458

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  459  IDSYHNVS  466



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELL+AQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  279  QGFASGSLDADASSVRLFAARGMELLIAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  338

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KD
Sbjct  339  QLKRIARPMYSNPPVHGARIVANVVGDPTLFNEWKEEMEMLAGRIKNVRQKLFDSLSAKD  398

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  399  KSGKDWSFILKQIGMFSFTGLTKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  458

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  459  IDSYHNVS  466



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+ GLELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKS
Sbjct  283  QGFASGSLDADASSVRLFAACGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKS  342

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEW++EME+MAGRIK+VRQKL+DSLS KD
Sbjct  343  QLKRLARPMYSNPPVHGARIVANVVGDPALFNEWREEMELMAGRIKNVRQKLFDSLSAKD  402

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  403  KSGKDWSFILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  462

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  463  IDSYHNVS  470



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  279  QGFASGSLDADASSVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  338

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNP +HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KD
Sbjct  339  QLKRIARPMYSNPSVHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKD  398

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  399  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  458

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  459  IDSYHNVS  466



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RG+E LVAQSYSKNLGLYAERIGAINVVCSS+D A RVKS
Sbjct  264  QGFASGSLDTDASSVRLFAARGMEFLVAQSYSKNLGLYAERIGAINVVCSSSDIAKRVKS  323

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVGNPELFN+WK+EME+MAGRIKSVR+KLYDSLS KD
Sbjct  324  QLKRLARPMYSNPPIHGARIVANVVGNPELFNDWKEEMELMAGRIKSVRKKLYDSLSAKD  383

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+F+LKQIGMFSFTGLN AQSENM+NKWH+YMTKDGRISLAGLS+AKCEYLADAI
Sbjct  384  NSGKDWSFVLKQIGMFSFTGLNDAQSENMTNKWHVYMTKDGRISLAGLSSAKCEYLADAI  443

Query  225  IDSYYNVS  202
            IDSYYN+S
Sbjct  444  IDSYYNIS  451



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RGLELLVAQSYSKNLGLYAERIGAIN+VCSSADAA RVKS
Sbjct  362  QGFASGSLDVDASSVRLFAARGLELLVAQSYSKNLGLYAERIGAINIVCSSADAATRVKS  421

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+KRLARPMYSNPP+HGARIVANVVG+PELFNEWK+EME+MAGRIKSVRQKLYDSL  KD
Sbjct  422  QIKRLARPMYSNPPVHGARIVANVVGDPELFNEWKEEMEVMAGRIKSVRQKLYDSLRAKD  481

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+AKCEYLADAI
Sbjct  482  KSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSAKCEYLADAI  541

Query  225  IDSYYNVS  202
             DSY+NVS
Sbjct  542  FDSYHNVS  549



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AARVKS
Sbjct  272  QGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKS  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KD
Sbjct  332  QLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKD  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  392  KSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  451

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  452  IDSYHNVS  459



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   355 bits (912),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AARVKS
Sbjct  223  QGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKS  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KD
Sbjct  283  QLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKD  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  343  KSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  402

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  403  IDSYHNVS  410



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR+FA+RG+ELLVAQSYSKNLGLYAERIGA+NVVCSSADAAARVKS
Sbjct  277  QGFASGSLDADAASVRLFAARGMELLVAQSYSKNLGLYAERIGALNVVCSSADAAARVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  LFNEWK EMEMMAGRIK VRQKLYDSLS KD
Sbjct  337  QLKRIARPMYSNPPVHGARIVANVVGDQSLFNEWKDEMEMMAGRIKGVRQKLYDSLSAKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  397  KSGKDWSFILKQIGMFSYTGLNKTQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  456

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  457  IDSYHNVS  464



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  275  QGFASGSLDADASSVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPPIHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KD
Sbjct  335  QLKRIARPMYSNPPIHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            K GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  395  KCGKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  454

Query  225  IDSYYNVS  202
            IDS++ VS
Sbjct  455  IDSFHCVS  462



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+S+DAA RVKS
Sbjct  277  QGFASGSLDTDAASVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCASSDAATRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPPIHGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKLYD+L+  D
Sbjct  337  QLKRIARPMYSNPPIHGARIVANVVGDPALFNEWKAEMEMMAGRIKGVRQKLYDNLTATD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAI
Sbjct  397  KSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAI  456

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  457  IDSYHNVS  464



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS
Sbjct  275  QGFASGSLDADASSVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPPIHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KD
Sbjct  335  QLKRIARPMYSNPPIHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            K GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  395  KCGKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  454

Query  225  IDSYYNVS  202
            IDS++ VS
Sbjct  455  IDSFHCVS  462



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+S+D A RVKS
Sbjct  277  QGFASGSLDTDAASVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSSDTATRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LF+EWK EMEMMAGRIK+VRQKLYD+L+ KD
Sbjct  337  QLKRIARPMYSNPPVHGARIVANVVGDPTLFSEWKAEMEMMAGRIKNVRQKLYDNLTAKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAI
Sbjct  397  KSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAI  456

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  457  IDSYHNVS  464



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   354 bits (909),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+S+D A RVKS
Sbjct  277  QGFASGSLDTDAASVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSSDTATRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LF EWK EMEMMAGRIK+VRQKLYD+L+ KD
Sbjct  337  QLKRIARPMYSNPPVHGARIVANVVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDNLTAKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAI
Sbjct  397  KSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAI  456

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  457  IDSYHNVS  464



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKS
Sbjct  223  QGFASGSLDADAASVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAATRVKS  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  283  QLKRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKD  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  343  KSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  402

Query  225  IDSYYNV  205
            IDS++NV
Sbjct  403  IDSFHNV  409



>dbj|BAD94538.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=187

 Score =   343 bits (879),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  GFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQ  583
            GFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQ
Sbjct  1    GFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQ  60

Query  582  LKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDK  403
            LKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDK
Sbjct  61   LKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDK  120

Query  402  SGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  223
            SGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAII
Sbjct  121  SGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAII  180

Query  222  DSYYNVS  202
            DSY+NVS
Sbjct  181  DSYHNVS  187



>gb|AFK46621.1| unknown [Lotus japonicus]
Length=241

 Score =   345 bits (884),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  54   QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  113

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KD
Sbjct  114  QLKRIARPMYSNPPVHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKD  173

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  174  KSGKDWSFILEQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  233

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  234  IDSYHNVS  241



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RGLELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKS
Sbjct  267  QGFASGSLDTDAYSVRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKS  326

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KD
Sbjct  327  QLKRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKD  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAI
Sbjct  387  KSGKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAI  446

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  447  IDSFHNVS  454



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADASSVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKS
Sbjct  277  QGFASGSLDADASSVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAAIRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  337  QLKRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  397  KSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  456

Query  225  IDSYYNV  205
            IDS++NV
Sbjct  457  IDSFHNV  463



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   351 bits (901),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RGLELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKS
Sbjct  251  QGFASGSLDTDAYSVRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKS  310

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KD
Sbjct  311  QLKRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKD  370

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAI
Sbjct  371  KSGKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAI  430

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  431  IDSFHNVS  438



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR+FA+RGLELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKS
Sbjct  278  QGFASGSLDADAASVRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAATRVKS  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  338  QLKRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKD  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  398  KSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  457

Query  225  IDSYYNV  205
            IDS++NV
Sbjct  458  IDSFHNV  464



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDPTMFGEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+FASRG+ELLVAQSYSKNLGLYAERIGAINVVCS+ADAA RVKS
Sbjct  275  QGFASGSLDADAGSVRLFASRGMELLVAQSYSKNLGLYAERIGAINVVCSTADAATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGA+IVAN+V +P LFNEWK EMEMMAGRIK+VRQKLYDSLS KD
Sbjct  335  QLKRLARPMYSNPPVHGAKIVANIVSDPALFNEWKAEMEMMAGRIKNVRQKLYDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCE LADAI
Sbjct  395  KSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEDLADAI  454

Query  225  IDSYYNVS  202
            +DSY+NVS
Sbjct  455  VDSYHNVS  462



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   351 bits (900),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR FA+RG+EL VAQSYSKNLGLYAERIGA+NVVC+SADAAARVKS
Sbjct  295  QGFASGSLDADAASVRSFAARGMELFVAQSYSKNLGLYAERIGAMNVVCTSADAAARVKS  354

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P LFNEWK EME+MAGRIK+VRQKLYDSL  KD
Sbjct  355  QLKRLARPMYSNPPIHGARIVANVVGDPVLFNEWKAEMELMAGRIKNVRQKLYDSLCAKD  414

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLN+AQS+ M+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  415  KSGKDWSFILKQIGMFSFTGLNEAQSDKMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  474

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  475  IDSFHNVS  482



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F +RG+E+ VAQSYSKNLGLYAERIGAINVVCSS+DAA RVKS
Sbjct  277  QGFASGSLDEDASSVRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSDAAIRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KD
Sbjct  337  QLKRLARPMYSNPPVHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            K+GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI
Sbjct  397  KTGKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAI  456

Query  225  IDSYYNVS  202
            +DSYYNVS
Sbjct  457  VDSYYNVS  464



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F +RG+E+ VAQSYSKNLGLYAERIGAINVVCSS+DAA RVKS
Sbjct  266  QGFASGSLDEDASSVRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSDAAIRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KD
Sbjct  326  QLKRLARPMYSNPPVHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            K+GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI
Sbjct  386  KTGKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAI  445

Query  225  IDSYYNVS  202
            +DSYYNVS
Sbjct  446  VDSYYNVS  453



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   349 bits (896),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 8/196 (4%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAAR---  595
            QGFASGSLD DASSVR+FA+RG+ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AAR   
Sbjct  272  QGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARCCE  331

Query  594  -----VKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL  430
                 VKSQLKRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL
Sbjct  332  VAVIQVKSQLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKL  391

Query  429  YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK  250
            +DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AK
Sbjct  392  FDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAK  451

Query  249  CEYLADAIIDSYYNVS  202
            CEYLADAIIDSY+NVS
Sbjct  452  CEYLADAIIDSYHNVS  467



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFADRGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVRMFA+RGLELL+AQSYSKNLGLYAERIGAINVVCSS+D A RVKS
Sbjct  275  QGFASGSLDKDASSVRMFAARGLELLIAQSYSKNLGLYAERIGAINVVCSSSDVAHRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD
Sbjct  335  QLKRLARPMYSNPPIHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAI
Sbjct  395  NSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAI  454

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  455  IDSYHNVS  462



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVRMFA+RGLELL+AQSYSKNLGLYAERIGAINVVCSS+D A RVKS
Sbjct  276  QGFASGSLDKDASSVRMFAARGLELLIAQSYSKNLGLYAERIGAINVVCSSSDVAHRVKS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD
Sbjct  336  QLKRLARPMYSNPPIHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAI
Sbjct  396  NSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFSEWKAEMEMMAGRIKTVRQKLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   347 bits (890),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F SRG+EL VAQSYSKNLGLYAERIGA+NV+CSS+DAAARVKS
Sbjct  282  QGFASGSLDEDASSVRLFVSRGMELFVAQSYSKNLGLYAERIGAVNVICSSSDAAARVKS  341

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LF+EWK EME MAGRIKSVR++L+++LS KD
Sbjct  342  QLKRLARPMYSNPPVHGARIVANVVGDPALFSEWKSEMEFMAGRIKSVRKRLFENLSQKD  401

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS +KCEYLADAI
Sbjct  402  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLSKCEYLADAI  461

Query  225  IDSYYNVS  202
            IDSY+NV+
Sbjct  462  IDSYHNVN  469



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  270  QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  329

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KD
Sbjct  330  QLKRIARPMYSNPPVHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKD  389

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  390  KSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  449

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  450  IDSYHNVS  457



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  308  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  367

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  368  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKD  427

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  428  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAI  487

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  488  IDSYHNVS  495



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RGLELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKS
Sbjct  267  QGFASGSLDTDAYSVRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKS  326

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KD
Sbjct  327  QLKRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSQKD  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS++M+NKW +YMTKDGRISLAGLS +KCEYLADAI
Sbjct  387  KSGKDWSFILKQIGMFSFTGLNKAQSDHMTNKWRVYMTKDGRISLAGLSLSKCEYLADAI  446

Query  225  IDSYYNVS  202
            +DS++NVS
Sbjct  447  MDSFHNVS  454



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  446  IDSHHNVS  453



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  261  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  320

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  321  QLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKD  380

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  381  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  440

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  441  IDSYHNVS  448



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>ref|XP_007161154.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
 gb|ESW33148.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
Length=261

 Score =   337 bits (864),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  74   QGFASGSLDEDAASVRLFVARGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  133

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD
Sbjct  134  QLKRLARPMYSNPPVHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKD  193

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  194  NSGKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  253

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  254  IDSYHNVS  261



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFADRGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYN  208
            IDSY+N
Sbjct  446  IDSYHN  451



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYN  208
            IDSY+N
Sbjct  446  IDSYHN  451



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAI  445

Query  225  IDSYYN  208
            IDSY+N
Sbjct  446  IDSYHN  451



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  276  QGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  396  KSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAA+RVKS
Sbjct  277  QGFASGSLDTDAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAASRVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+P LF EW  EMEMMAGRIK+VRQKL+DSLS KD
Sbjct  337  QLKRIARPMYSNPPVHGARIVANVVGDPALFKEWNVEMEMMAGRIKNVRQKLFDSLSSKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  397  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  456

Query  225  IDSYYNV  205
            IDSY+NV
Sbjct  457  IDSYHNV  463



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F  RG ELLVAQSYSKNLGLYAERIGAINVVCSS+DA  RVKS
Sbjct  238  QGFASGSLDADAYSVRLFVKRGFELLVAQSYSKNLGLYAERIGAINVVCSSSDAGTRVKS  297

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+LY++LS KD
Sbjct  298  QLKRLARPMYSNPPVHGARIVANVVGDPNLFNEWKQEMELMAGRIKNVRQRLYENLSQKD  357

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFS+TGL+KAQS++M++KWHIYMTKDGRISLAGLS +KCEYLADAI
Sbjct  358  KSGKDWSFVLKQIGMFSYTGLHKAQSDHMTDKWHIYMTKDGRISLAGLSLSKCEYLADAI  417

Query  225  IDSYYNV  205
            IDS++NV
Sbjct  418  IDSFHNV  424



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+GAINV+ SS ++AARVKS
Sbjct  280  QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESAARVKS  339

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KD
Sbjct  340  QLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKNVRQALYDSISSKD  399

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  400  KSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAI  459

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  460  IDSYHNVS  467



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F +RG+E+ VAQSYSKNLGLYAERIGAINVVCSS++ A RVKS
Sbjct  223  QGFASGSLDEDASSVRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSEVANRVKS  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LY +LS KD
Sbjct  283  QLKRLARPMYSNPPVHGAQIVANVVGNPVLFDEWKSEMELMSGRIKGVRQRLYANLSAKD  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+L+QIGMFSFTGLNKAQSENMS+KWHIYMTKDGRISLAGLS +KCEYLADAI
Sbjct  343  KSGKDWSFVLRQIGMFSFTGLNKAQSENMSSKWHIYMTKDGRISLAGLSLSKCEYLADAI  402

Query  225  IDSYYNVS  202
            IDSYYNVS
Sbjct  403  IDSYYNVS  410



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKS
Sbjct  278  QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKS  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KD
Sbjct  338  QLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKD  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  398  KSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAI  457

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  458  IDSYHNVS  465



>prf||1908424A Asp aminotransferase
Length=465

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKS
Sbjct  278  QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKS  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KD
Sbjct  338  QLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKD  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  398  KSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAI  457

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  458  IDSYHNVS  465



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADA  229
            KSGKDW+FILKQIGMFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADA
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADA  445

Query  228  IIDSYYNVS  202
            IIDSY+NVS
Sbjct  446  IIDSYHNVS  454



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKS
Sbjct  268  QGFASGSLDEDAASVRLFESRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKS  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KD
Sbjct  328  QLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKD  387

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  388  KSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAI  447

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  448  IDSYHNVS  455



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  317  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  376

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  377  QLKRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKD  436

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  437  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAI  496

Query  225  IDSYYN  208
            IDSY+N
Sbjct  497  IDSYHN  502



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINVV SS ++AARVKS
Sbjct  276  QGFASGSLDEDAASVRLFVARGMEVLVAQSYSKNLGLYAERIGAINVVSSSPESAARVKS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLN  QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  396  KSGKDWSFILKQIGMFSFTGLNTNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR+F +RG+ELLVAQSYSKNLGLYAERIGAINVV +S+D AARVKS
Sbjct  266  QGFASGSLDADAASVRLFVARGMELLVAQSYSKNLGLYAERIGAINVVLTSSDTAARVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVAN+VG+P LF EWK EMEMMAGRIK+VRQKLYDSL  KD
Sbjct  326  QLKRLARPMYSNPPIHGAKIVANIVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDSLCAKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLN  Q+ENM+ KWH++MTKDGRISLAGL+ AKCEYL+DAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNTTQTENMTKKWHVFMTKDGRISLAGLNLAKCEYLSDAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK+QS+NM++KWH+Y TKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKSQSDNMTDKWHVYXTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  446  IDSYHNVS  453



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKS
Sbjct  227  QGFASGSLDEDASSVRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVVCSTPEVANRVKS  286

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD
Sbjct  287  QLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKD  346

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  347  DSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAI  406

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  407  IDSFHNVS  414



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI  445

Query  225  IDSYYN  208
            IDSY+N
Sbjct  446  IDSYHN  451



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKS
Sbjct  209  QGFASGSLDADAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKS  268

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  269  QLKRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  328

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  329  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  388

Query  225  IDSYYNVS  202
            IDSY+N S
Sbjct  389  IDSYHNGS  396



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLY+ERIGAINVVCS+ + A RVKS
Sbjct  235  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYSERIGAINVVCSTPEVADRVKS  294

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD
Sbjct  295  QLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKD  354

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  355  NSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAI  414

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  415  IDSFHNVS  422



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKS
Sbjct  271  QGFASGSLDEDASSVRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVVCSTPEVANRVKS  330

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD
Sbjct  331  QLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKD  390

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  391  DSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAI  450

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  451  IDSFHNVS  458



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+FA+RG+ELLVAQSYSKNLGLYAERIGAINVVCS+ADAA RVKS
Sbjct  274  QGFASGSLDPDAGSVRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSTADAATRVKS  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK+LAR MYSNPP+HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KD
Sbjct  334  QLKQLARLMYSNPPVHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKD  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI
Sbjct  394  KSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAI  453

Query  225  IDSYYNVS  202
            +DSY+NVS
Sbjct  454  VDSYHNVS  461



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   340 bits (871),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKS
Sbjct  281  QGFASGSLDADAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKS  340

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  341  QLKRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  400

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  401  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  460

Query  225  IDSYYNVS  202
            IDSY+N S
Sbjct  461  IDSYHNGS  468



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS +AAARVKS
Sbjct  273  QGFASGSLDTDAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPEAAARVKS  332

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  333  QLKRIARPMYSNPPVHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  392

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  393  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  452

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  453  IDSYHNVS  460



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKS
Sbjct  277  QGFASGSLDADAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  337  QLKRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  397  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  456

Query  225  IDSYYNVS  202
            IDSY+N S
Sbjct  457  IDSYHNGS  464



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   339 bits (870),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS +AAARVKS
Sbjct  273  QGFASGSLDTDAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPEAAARVKS  332

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  333  QLKRIARPMYSNPPVHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  392

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  393  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  452

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  453  IDSYHNVS  460



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   339 bits (869),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  276  QGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFT LNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  396  KSGKDWSFILKQIGMFSFTSLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  455

Query  225  IDSYYNV  205
            IDSY+NV
Sbjct  456  IDSYHNV  462



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  274  QGFASGSLDEDAASVRLFVARGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD
Sbjct  334  QLKRLARPMYSNPPVHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKD  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  394  NSGKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  453

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  454  IDSYHNVS  461



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 174/187 (93%), Gaps = 1/187 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKS
Sbjct  266  QGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KD
Sbjct  326  QLKRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADA  229
            KSGKDW+FILKQIGMFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADA
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADA  445

Query  228  IIDSYYN  208
            IIDSY+N
Sbjct  446  IIDSYHN  452



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AAR  S
Sbjct  276  QGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARETS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  396  KSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKS
Sbjct  309  QGFASGSLDADAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKS  368

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KD
Sbjct  369  QLKRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKD  428

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  429  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  488

Query  225  IDSYYNVS  202
            IDSY+N S
Sbjct  489  IDSYHNGS  496



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RG+E+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKS
Sbjct  270  QGFASGSLDEDAFSVRLFVKRGMEVFVAQSYSKNLGLYAERIGAINVVCSAPEVADRVKS  329

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVAN+VG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD
Sbjct  330  QLKRLARPMYSNPPIHGARIVANIVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKD  389

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAI
Sbjct  390  KSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAI  449

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  450  IDSFHNVS  457



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   336 bits (862),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RGLE+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  267  QGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  326

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA++VGNP LF+EWK EMEMMAGRIK+VRQ+LYDS+S KD
Sbjct  327  QLKRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNVRQQLYDSISSKD  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  387  KSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  446

Query  225  IDSYYNVS  202
            IDS++ VS
Sbjct  447  IDSFHYVS  454



>dbj|BAJ97030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKS
Sbjct  158  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKS  217

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  218  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKD  277

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  278  QSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  337

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  338  IDSFHNVN  345



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSL ADA+SVRMF +RG+E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKS
Sbjct  277  QGFASGSLGADAASVRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKS  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS +D
Sbjct  337  QLKRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRDKLFDSLSSED  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQ +NM+ KWHIYMTKDGRISLAGLS AKCEYLADAI
Sbjct  397  KSGKDWSFVLKQIGMFSFTGLNKAQCDNMTTKWHIYMTKDGRISLAGLSLAKCEYLADAI  456

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  457  IDSYHNVS  464



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RG+E+ VAQSYSKNLGLY+ER+GAINVVCS+ + A RVKS
Sbjct  272  QGFASGSLDEDAFSVRLFVKRGMEVFVAQSYSKNLGLYSERVGAINVVCSAPEVADRVKS  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KD
Sbjct  332  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKD  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAI
Sbjct  392  KSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAI  451

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  452  IDSFHNVN  459



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RG+E+ VAQSYSKNLGLY+ERIGAINVVCS+   A RVKS
Sbjct  271  QGFASGSLDEDAFSVRLFVKRGMEVFVAQSYSKNLGLYSERIGAINVVCSAPGVADRVKS  330

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS+KD
Sbjct  331  QLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSVKD  390

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAI
Sbjct  391  KSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAI  450

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  451  IDSFHNVN  458



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR F +RG+E+ VAQSYSKNLGLYAER+GAIN + SSAD AARVKS
Sbjct  274  QGFASGSLDDDASSVRKFVARGMEVFVAQSYSKNLGLYAERVGAINAIVSSADVAARVKS  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVANVVG P +F+EW+ EM+MMAGRIK+VRQ+LYD LS KD
Sbjct  334  QLKRIARPMYSNPPVHGARIVANVVGEPTMFDEWRAEMQMMAGRIKTVRQRLYDELSTKD  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+F+LKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGL+ AKC YLADAI
Sbjct  394  KSGKDWSFVLKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLNLAKCAYLADAI  453

Query  225  IDSYYNV  205
            IDSYYN+
Sbjct  454  IDSYYNI  460



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYA+RIGAINV+ SS ++AAR  S
Sbjct  276  QGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAQRIGAINVISSSPESAARETS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRIS AGLS AKCEYLADAI
Sbjct  396  KSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISSAGLSLAKCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RG+E+ VAQSYSKNLGLY+ER+GAINVVCS+ + A RV S
Sbjct  272  QGFASGSLDEDAFSVRLFVKRGMEVFVAQSYSKNLGLYSERVGAINVVCSAPEVADRVNS  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KD
Sbjct  332  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKD  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAI
Sbjct  392  KSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAI  451

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  452  IDSFHNVN  459



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINV+CS+ + A RVKS
Sbjct  281  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICSAPEVADRVKS  340

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  341  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKD  400

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  401  QSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  460

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  461  IDSFHNVN  468



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKS
Sbjct  270  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKS  329

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  330  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKD  389

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  390  QSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  449

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  450  IDSFHNVN  457



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINV+CS+ + A RVKS
Sbjct  296  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICSAPEVADRVKS  355

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  356  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTEKD  415

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  416  QSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  475

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  476  IDSFHNVN  483



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKS
Sbjct  270  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKS  329

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  330  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKD  389

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLA+AI
Sbjct  390  QSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLAEAI  449

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  450  IDSFHNVN  457



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+F  RGLE+ VAQSYSKNLGLY+ER+GAINV+CS+ + A RVKS
Sbjct  268  QGFASGSLDEDAFSVRLFVERGLEVFVAQSYSKNLGLYSERVGAINVICSAPEVADRVKS  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD
Sbjct  328  QLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKD  387

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFS+TGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  388  QSGKDWSFILSQIGMFSYTGLNRNQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  447

Query  225  IDSYYNVS  202
            IDS++NV+
Sbjct  448  IDSFHNVN  455



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR FASRG E+ VAQSYSKNLGLYAERIGAINV+  +AD AARVKS
Sbjct  223  QGFASGSLDDDASSVRKFASRGFEMFVAQSYSKNLGLYAERIGAINVILPTADLAARVKS  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KD
Sbjct  283  QLKRLARPMYSNPPVHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKD  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAI
Sbjct  343  KSGKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAI  402

Query  225  IDSYYNV  205
            IDSYYNV
Sbjct  403  IDSYYNV  409



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR FASRG E+ VAQSYSKNLGLYAERIGAINV+  +AD AARVKS
Sbjct  223  QGFASGSLDDDASSVRKFASRGFEMFVAQSYSKNLGLYAERIGAINVILPTADLAARVKS  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KD
Sbjct  283  QLKRLARPMYSNPPVHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKD  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAI
Sbjct  343  KSGKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAI  402

Query  225  IDSYYNV  205
            IDSYYNV
Sbjct  403  IDSYYNV  409



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+  +RG+EL +AQSYSKNLGLYA+RIGAINV+ SS ++AAR+ S
Sbjct  278  QGFASGSLDEDAASVRLLVARGIELFIAQSYSKNLGLYAQRIGAINVISSSPESAARLTS  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA++VGNP LF EWK  MEMMAGRIK+VRQ LYDS+S KD
Sbjct  338  QLKRIARPMYSNPPVHGARIVADLVGNPLLFEEWKAFMEMMAGRIKNVRQLLYDSISSKD  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  398  KSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  457

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  458  IDSYHNVS  465



>prf||2009357A Asp aminotransferase
Length=463

 Score =   327 bits (838),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+G   V+ SS ++A RVKS
Sbjct  278  QGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVG---VISSSPESATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KD
Sbjct  335  QLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAGLSAAKCEYLADA  229
            KSGKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAGLS AKCEYLADA
Sbjct  395  KSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAGLSLAKCEYLADA  454

Query  228  IIDSYYNVS  202
            IIDSY+NVS
Sbjct  455  IIDSYHNVS  463



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   320 bits (821),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAI+V+CS+ + A RVKS
Sbjct  188  QGFASGSLDEDASSVRLFVKRGLEVFVAQSYSKNLGLYAERIGAISVICSAPEVADRVKS  247

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD
Sbjct  248  QLKRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKD  307

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAI
Sbjct  308  QSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAI  367

Query  225  I  223
            I
Sbjct  368  I  368



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   313 bits (803),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+  +RG+EL +A SY K++GLYA+RIGAINV+ SS ++AAR  S
Sbjct  278  QGFASGSLDEDAASVRLLVARGIELFIADSYPKDVGLYAQRIGAINVISSSPESAARDTS  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA++V  P+LF+EWK EMEMMAGRIK+VRQ LYD +S KD
Sbjct  338  QLKRIARPMYSNPPVHGARIVADLVSKPQLFDEWKAEMEMMAGRIKNVRQLLYDPISSKD  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+ MTKDGRIS AGLS AKCEYLADAI
Sbjct  398  KSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVLMTKDGRISPAGLSLAKCEYLADAI  457

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  458  IDSYHNVS  465



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   309 bits (791),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QG+ASG ++ADASSVR+FA+RG+ELLVAQSYSKN+GLYAERIGAINVVCSS D+A RVKS
Sbjct  219  QGYASGRVEADASSVRLFAARGMELLVAQSYSKNMGLYAERIGAINVVCSSPDSAQRVKS  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLAR M+SNPP+HGARIV NVVGN +LF+EW++E+ +MAGRIKSVR+KLYD LS KD
Sbjct  279  QLKRLARAMHSNPPVHGARIVTNVVGNSDLFSEWEEELRLMAGRIKSVRKKLYDCLSAKD  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             SGKDW+F +K IGM+S++GLN+AQ ENM NKWH+YMTKDGR++L G+S AKCEYLADA 
Sbjct  339  MSGKDWSFFVKHIGMYSYSGLNEAQRENMRNKWHVYMTKDGRMALTGVSQAKCEYLADAF  398

Query  225  IDSYYNV  205
            IDSY+ V
Sbjct  399  IDSYHYV  405



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA +VR+F  RGLELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKS
Sbjct  266  QGFASGNLDADAYAVRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD
Sbjct  326  QLKWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            +SG+DW+FI+K+ G+FSF GLNKAQ +NM NKWH+YM KDGR+SL GLS ++CEYLADAI
Sbjct  386  RSGRDWSFIVKENGIFSFIGLNKAQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAI  445

Query  225  IDSYYNVS  202
            IDS++NVS
Sbjct  446  IDSFHNVS  453



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKS
Sbjct  276  QGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKS  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KD
Sbjct  336  QLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKD  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
            KSG+  +       +    GLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAI
Sbjct  396  KSGQSASQYPDNCVLPFIPGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI  455

Query  225  IDSYYNVS  202
            IDSY+NVS
Sbjct  456  IDSYHNVS  463



>ref|XP_008784800.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=386

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 168/227 (74%), Gaps = 39/227 (17%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA +VR+F  RGLELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKS
Sbjct  160  QGFASGNLDADAYAVRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKS  219

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD
Sbjct  220  QLKWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKD  279

Query  405  KSGKDWTFILKQIGMFSFTGLNKA------------------------------------  334
            +SG+DW+FI+K+ G+FSF GLNKA                                    
Sbjct  280  RSGRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFV  339

Query  333  ---QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  202
               Q +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  340  RLSQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  386



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 168/227 (74%), Gaps = 39/227 (17%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA +VR+F  RGLELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKS
Sbjct  266  QGFASGNLDADAYAVRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD
Sbjct  326  QLKWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKA------------------------------------  334
            +SG+DW+FI+K+ G+FSF GLNKA                                    
Sbjct  386  RSGRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFV  445

Query  333  ---QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  202
               Q +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  446  RLSQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  492



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DASSVR+FA+RG+ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKS
Sbjct  275  QGFASGSLDEDASSVRLFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKS  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KD
Sbjct  335  QLKRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKD  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQ  331
            KSGKDW++ILKQIGMFSFTGLNKAQ
Sbjct  395  KSGKDWSYILKQIGMFSFTGLNKAQ  419



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA + R FA RG+ELLVAQSYSKNLGLYAER+GAIN V S A+AA RV S
Sbjct  268  QGFASGSLDDDAWAPRYFAGRGIELLVAQSYSKNLGLYAERVGAINFVLSDAEAAKRVMS  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+AR +YSNPP+HGARI + VV  PELF EW +EME M+GRIK VRQ L+D L+ K 
Sbjct  328  QLKRIARALYSNPPVHGARIASLVVSRPELFQEWNEEMEYMSGRIKDVRQVLHDELA-KL  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
               KDW+FIL+Q+GMFSFTGLN AQ +NM+NK HIYMTKDGRISLAGL ++K  YLA AI
Sbjct  387  NGDKDWSFILRQLGMFSFTGLNPAQVDNMTNKHHIYMTKDGRISLAGLPSSKAAYLAAAI  446

Query  225  IDSYYN  208
             DS+ N
Sbjct  447  DDSFRN  452



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR+FA RG+E  VAQSYSKNLGLYAERIGAIN +CSSADAAARVKS
Sbjct  266  QGFASGSLDEDAGSVRLFAERGMEFFVAQSYSKNLGLYAERIGAINAICSSADAAARVKS  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLARPMYSNPP+HGARIVANVVG+P LF EWK EME+MAGRIK+VRQ LYD L+ KD
Sbjct  326  QLKRLARPMYSNPPVHGARIVANVVGDPTLFGEWKAEMELMAGRIKNVRQMLYDRLAEKD  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQ  331
            KSGKDW+FILKQIGMFSFTGLNKAQ
Sbjct  386  KSGKDWSFILKQIGMFSFTGLNKAQ  410



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFA+GSL+ DA + R F  RGLE  VAQSYSKNLGLYAER+GA++ V S A AA RV S
Sbjct  256  QGFATGSLEEDAFAPRYFVERGLEFAVAQSYSKNLGLYAERVGAMSFVLSEAGAAQRVLS  315

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+KR+AR +YSNPP+HGARIVA VVG+ E+F EWK EMEMMAGRIK VRQ LYD+L ++ 
Sbjct  316  QMKRIARAIYSNPPVHGARIVAEVVGSEEMFGEWKGEMEMMAGRIKGVRQDLYDAL-VEI  374

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
               KDW+F+LKQIGMF+FTG+   Q +NM+NKWH+YMTKDGR+SLAGLS+AK  YLA AI
Sbjct  375  NPDKDWSFVLKQIGMFTFTGMTPQQCDNMTNKWHVYMTKDGRLSLAGLSSAKAAYLARAI  434

Query  225  IDSYYN  208
             DS  N
Sbjct  435  DDSVRN  440



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 5/186 (3%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA + R+F  RGLE+LVAQSYSKNLGLYAERIGA+N+V +S+ AA RV S
Sbjct  205  QGFASGSLDDDAFAPRLFVERGLEVLVAQSYSKNLGLYAERIGALNIVLASSQAADRVLS  264

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+AR +YSNPP+HGARIVA VVG+  +F EW  EME MAGRIK+VRQ LYD L+ + 
Sbjct  265  QLKRIARAIYSNPPVHGARIVAEVVGDAAMFGEWNVEMEEMAGRIKTVRQDLYDHLT-RL  323

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
               KDW+F    IGMFSFTGL+  Q ENM+NKWH++MTKDGRISLAGL+ AK  YLA+AI
Sbjct  324  LPSKDWSF----IGMFSFTGLSPQQVENMTNKWHVFMTKDGRISLAGLNRAKAGYLAEAI  379

Query  225  IDSYYN  208
            +DS  N
Sbjct  380  VDSVQN  385



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSL+ DA + R+F  RG+E   AQSYSKNLGLYAERIGAIN V +  + AA+  S
Sbjct  225  QGFASGSLEEDAYAPRLFERRGIEFFCAQSYSKNLGLYAERIGAINAVVNDKETAAKTLS  284

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+ R+AR +YSNPP+HGARI A V+ +P LF  W +EM  MAGRIK+VR  LYD+L  K 
Sbjct  285  QMNRIARAIYSNPPVHGARIAATVINDPALFARWNEEMGEMAGRIKTVRAMLYDNLC-KL  343

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
               KDW+F+ +QIGMFSFTGLN  Q ++M+ K  IYMT DGRISLAGLS AKCEYLA+AI
Sbjct  344  NPDKDWSFVTRQIGMFSFTGLNPNQVKHMTEKHAIYMTGDGRISLAGLSQAKCEYLANAI  403

Query  225  IDSY  214
            +DS+
Sbjct  404  VDSF  407



>gb|EPS71467.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=133

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  606  AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY  427
            +A RV+SQ+KR+ARPMYSNPP+HGARIVANVVGNP+LF EWK EME+MAGRIKSVR+ LY
Sbjct  1    SACRVRSQIKRIARPMYSNPPVHGARIVANVVGNPDLFKEWKDEMEVMAGRIKSVRKLLY  60

Query  426  DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC  247
            + LS  D +GKDW+FIL+QIGMFSFTGLNK QSE M+ KWH+YMTKDGRISLAGLS+AKC
Sbjct  61   EELSRSDGTGKDWSFILRQIGMFSFTGLNKEQSEKMTGKWHVYMTKDGRISLAGLSSAKC  120

Query  246  EYLADAIIDSYYN  208
             YLA AI+DSY+N
Sbjct  121  SYLAGAIVDSYHN  133



>tpg|DAA57533.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=201

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  15   QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVAVRVES  74

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  + 
Sbjct  75   QLKLVIRPMYSNPPLHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRG  134

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  135  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  193



>ref|XP_010519716.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X1 [Tarenaya hassleriana]
Length=340

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G E L+AQSY+KNLGLY ER+GA+++VC SAD A++V+S
Sbjct  154  QGFASGSLDADAHPVRMFVADGGECLIAQSYAKNLGLYGERVGALSIVCKSADVASKVES  213

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  + 
Sbjct  214  QVKLVVRPMYSNPPIHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARG  273

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  274  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  332



>ref|XP_002514283.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF48237.1| aspartate aminotransferase, putative [Ricinus communis]
Length=404

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G E LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  218  QGFASGSLDADAQPVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTADVASRVES  277

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS + 
Sbjct  278  QLKLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARG  337

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  338  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTADGRISMAGLSSKTVPHLADAI  396



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 144/186 (77%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFA+G LD DA + R+F  +GLE++V+QSYSKNLGLY ER+GA+ +V +  +AA R  S
Sbjct  243  QGFATGDLDKDAYAPRLFVEKGLEIVVSQSYSKNLGLYGERVGALVMVLNDKEAATRCLS  302

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLAR +YSNPP HGARI A VV + ELF EWK EM  MAGRI+ VR +L  SL  K 
Sbjct  303  QLKRLARALYSNPPTHGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRSLESKY  362

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             S KDW+FI KQIGMFSFTGL  AQ +NM+NK  I+MT+DGRISLAGL++AK +YLA+AI
Sbjct  363  PS-KDWSFITKQIGMFSFTGLTPAQVDNMTNKHAIFMTRDGRISLAGLNSAKVDYLAEAI  421

Query  225  IDSYYN  208
            +DS  N
Sbjct  422  VDSVRN  427



>ref|XP_010519717.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X2 [Tarenaya hassleriana]
Length=405

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G E L+AQSY+KNLGLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDADAHPVRMFVADGGECLIAQSYAKNLGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  + 
Sbjct  279  QVKLVVRPMYSNPPIHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>gb|AAM91546.1| aspartate aminotransferase Asp2 [Arabidopsis thaliana]
Length=201

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  15   QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  74

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  + 
Sbjct  75   QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARG  134

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  135  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  193



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  221  QGFASGSLDADAGSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS + 
Sbjct  281  QLKLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F   G E LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  221  QGFASGSLDADAQPVRLFVGDGGECLVAQSYAKNMGLYGERVGALSIVCKTADVASRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ N +L+NEW  E++ MA RI S+R +L+D+L+ + 
Sbjct  281  QLKLVIRPMYSNPPIHGASIVATILKNSDLYNEWTIELKAMADRIISMRHQLFDALTARG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  TPG-DWSHIMKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  399



>ref|XP_007013138.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
 gb|EOY30757.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
Length=405

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDADAQSVRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA I A ++ N +++NEWK E++ MA RI S+R++L+D+LS + 
Sbjct  279  QLKLVIRPMYSNPPIHGASIAATILKNSDMYNEWKIELKAMAERIISMRKQLFDALSARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  221  QGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++
Sbjct  281  QLKLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRE  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  399



>gb|KIZ05915.1| aspartate aminotransferase [Monoraphidium neglectum]
Length=345

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 144/186 (77%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFA+G LD DA + R+F   GLE++VAQSYSKNLGLY ER+GA+N V + +++A RV S
Sbjct  160  QGFATGDLDKDAFAPRLFVDNGLEVVVAQSYSKNLGLYGERVGALNFVLADSESAKRVLS  219

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKR+AR ++SNPP HGARI A VVG+  +F EWK EM  MAGRI  VR +L  +L  K 
Sbjct  220  QLKRIARALWSNPPTHGARIAAEVVGDAAMFEEWKGEMAGMAGRISKVRGELRAALE-KR  278

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             + KDW+F+ KQIGMFS+TG++  Q +NM+NK  +YMT+DGRISLAGLS+AK +YLADAI
Sbjct  279  MADKDWSFVTKQIGMFSYTGMSPQQVDNMTNKHAVYMTRDGRISLAGLSSAKVDYLADAI  338

Query  225  IDSYYN  208
            +DS  N
Sbjct  339  VDSVRN  344



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  221  QGFASGSLDADAGSVRMFVADGGECLAAQSYAKNMGLYGERVGALSMVCKTADVASRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS + 
Sbjct  281  QLKLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  272  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVES  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++
Sbjct  332  QLKLVIRPMYSNPPIHGASIVATILKDSVMFNEWTVELKAMADRIISMRQQLFDALKTRE  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  392  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  450



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 144/186 (77%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG LDADA+SVR+F   GLEL++AQS++KN+GLY ER GA++VV  + + A RV+S
Sbjct  241  QGFASGDLDADAASVRLFLEAGLELVLAQSFAKNMGLYGERAGALSVVSKTKEVATRVES  300

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA I A V+G+P+L   WK+E+  MA RIKS+RQ LYD L  ++
Sbjct  301  QLKLVVRPMYSNPPMHGAAIAARVMGDPKLNALWKEELRGMAERIKSMRQVLYDQLVARN  360

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+F+LKQIGMFSFTG+ + Q E + +KWH+++T DGRIS+AGLSAA   YLA+AI
Sbjct  361  VPG-DWSFVLKQIGMFSFTGMTRHQCEQLVSKWHVHLTLDGRISMAGLSAATAPYLAEAI  419

Query  225  IDSYYN  208
             D   N
Sbjct  420  ADVIQN  425



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  274  QGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVES  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++
Sbjct  334  QLKLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRE  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  394  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  452



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  236  QGFASGSLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVES  295

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPM+SNPPIHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  296  QVKLVIRPMFSNPPIHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARG  355

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  356  TPG-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  414



>ref|XP_009131210.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Brassica 
rapa]
 emb|CDX78428.1| BnaA03g03400D [Brassica napus]
Length=452

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  266  QGFASGSLDTDAKPIRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCKAADVAGRVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  326  QLKLVIRPMYSNPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>emb|CDX70399.1| BnaC03g04830D [Brassica napus]
Length=450

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  264  QGFASGSLDTDAKPIRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCKAADVAGRVES  323

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  324  QLKLVIRPMYSNPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  383

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  384  TPG-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  274  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVES  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HG  IVA ++ + E+FNEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  334  QLKLVIRPMYSNPPLHGPSIVATILKDSEMFNEWTLELKAMADRIISMRQQLFDALKSRG  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  394  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSTRTVPHLADAI  452



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+S
Sbjct  221  QGFASGSLDADAGSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKKADVASRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+LS + 
Sbjct  281  QLKLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQQLFDALSARG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  399



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  264  QGFASGSLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVES  323

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPM+SNPPIHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  324  QVKLVIRPMFSNPPIHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARG  383

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  384  TPG-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  442



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  225  QGFASGSLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKAADVASRVES  284

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  + 
Sbjct  285  QLKLVIRPMYSNPPIHGASIVATILKDSDMYNEWTXELKAMADRIISMRQLLFDTLRDRG  344

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  345  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>gb|ACU21245.1| unknown [Glycine max]
Length=344

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+S
Sbjct  158  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVES  217

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  218  QLKLVIRPMYSSPPIHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRG  277

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  278  TPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  336



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G EL  AQSY+KN+GLY ER+GA++VVC SA  A RV+S
Sbjct  266  QGFASGSLDTDAQSVRMFVADGGELFAAQSYAKNMGLYGERVGALSVVCKSAAVAGRVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++G+  LFNEW  E++ MA RI S+R++LYD+L  + 
Sbjct  326  QLKLVIRPMYSNPPLHGASIVAKILGDRNLFNEWTVELKAMADRIISMRKQLYDALCSRG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  444



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD+DA SVRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+S
Sbjct  263  QGFASGSLDSDAQSVRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  + 
Sbjct  323  QVKLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  383  TPG-DWSHIIKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_009401092.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  762  GFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQ  583
            GFASGSLDADA S+ +F  RGLELLVAQSYSK LGLYAERIGAINVVC S+DAAARVK Q
Sbjct  91   GFASGSLDADAYSISLFVDRGLELLVAQSYSKKLGLYAERIGAINVVCLSSDAAARVKIQ  150

Query  582  LKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDK  403
            LKRLARPMYSNPP+HGARIVAN+  +P LF+E KQEME+MAGRIK+VR++L+++LS KDK
Sbjct  151  LKRLARPMYSNPPVHGARIVANIARDPNLFDERKQEMELMAGRIKNVRRRLHENLSQKDK  210

Query  402  SGKDWTFILKQIGMFSFTGLNKAQ  331
               DW++ILKQIG  S+TGLN+AQ
Sbjct  211  RRSDWSYILKQIGTSSYTGLNEAQ  234



>ref|XP_008789337.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Phoenix dactylifera]
Length=463

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F + G E L AQSY+KN+GLY ER+GA+++VCSSAD A RV+S
Sbjct  277  QGFASGSLDADAQSVRIFVADGGECLTAQSYAKNMGLYGERVGALSIVCSSADVAVRVES  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  + 
Sbjct  337  QLKLVIRPMYSNPPIHGASIVATILKDRALFHEWTIELKAMADRIISMRQLLFDALHARG  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN+ Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  397  TPG-DWSHIIKQIGMFTFTGLNREQVAFMTQEYHIYMTSDGRISMAGLSSKTVPHLADAI  455



>emb|CDP03316.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF S G E LVAQSY+KN+G+Y ER+GA+++VC SAD A RV+S
Sbjct  224  QGFASGSLDEDAQSVRMFVSDGGECLVAQSYAKNMGMYGERVGALSIVCKSADVAVRVES  283

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  + 
Sbjct  284  QLKLVIRPMYSNPPIHGASIVAAILKDSHMYHEWTVELKAMADRIISMRQKLFDALQARG  343

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  344  TPG-DWSHIIKQIGMFTFTGLNAQQVAFMTKEYHIYMTSDGRISMAGLSSQTVPLLADAI  402



>ref|XP_002308618.1| aspartate transaminase family protein [Populus trichocarpa]
 gb|EEE92141.1| aspartate transaminase family protein [Populus trichocarpa]
Length=449

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G ELL+AQSY+KN+GLY ERIGA+++VC +AD A RV+S
Sbjct  263  QGFASGSLDADAQPVRMFVADGGELLLAQSYAKNMGLYGERIGALSIVCKTADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  + 
Sbjct  323  QLKLVIRPMYSNPPIHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALHARG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  383  TPG-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFA+G LD DA + R+F  RGLE++V+QSYSKNLGLY ER+GA+ +V    + A R  S
Sbjct  253  QGFATGDLDKDAFAPRLFVDRGLEIMVSQSYSKNLGLYGERVGALVMVLKDKEPATRCLS  312

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLKRLAR +YSNPP HGARI A VV + ELF EWK EM  MAGRI+ VR +L  +L  K 
Sbjct  313  QLKRLARALYSNPPTHGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRALEAK-  371

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
               KDW+FI KQIGMF+FTGL  AQ +NM+NK  ++MT+DGRISLAGL++AK EYLA+AI
Sbjct  372  YPDKDWSFITKQIGMFTFTGLTPAQVDNMTNKHSVFMTRDGRISLAGLNSAKVEYLANAI  431

Query  225  IDSYYN  208
            ++S  N
Sbjct  432  VESVRN  437



>ref|XP_011019648.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=449

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G ELL+AQSY+KN+GLY ERIGA+++VC +AD A RV+S
Sbjct  263  QGFASGSLDADAQPVRMFVADGGELLLAQSYAKNMGLYGERIGALSIVCKTADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  + 
Sbjct  323  QLKLVIRPMYSNPPIHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALRARG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  383  TPG-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  225  QGFASGSLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKAADVASRVES  284

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  + 
Sbjct  285  QLKLVIRPMYSNPPIHGASIVATILKDSDMYNEWTLELKAMADRIISMRQLLFDTLRDRG  344

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  345  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD+DA SVRMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  268  QGFASGSLDSDAQSVRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCRTADVASRVES  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  L+NEW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  328  QLKLVIRPMYSNPPIHGASIVAFILKDRNLYNEWTIELKAMADRIICMRQQLFDALHARG  387

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  TPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>ref|XP_006476088.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=449

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD+DA SVRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+S
Sbjct  263  QGFASGSLDSDAQSVRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  + 
Sbjct  323  QVKLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  383  TPG-DWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>gb|ABY58643.1| aspartate aminotransferase [Triticum aestivum]
Length=380

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+S
Sbjct  200  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVES  259

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++
Sbjct  260  QLKLVIRPMYSNPPLHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRE  319

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  320  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  378



>emb|CDP16161.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  234  QGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCRAADVAGRVES  293

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +F+EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  294  QLKLVIRPMYSNPPIHGASIVATILKDRNMFHEWTLELKAMADRIISMRQQLFDALRARG  353

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  354  TPG-DWSHIIKQIGMFTFTGLNSEQVTFMRKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  412



>gb|AAC50015.1| aspartate aminotransferase cytosolic isozyme AAT2 [Glycine max]
Length=419

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+S
Sbjct  233  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVES  292

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  + 
Sbjct  293  QLKLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRG  352

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  353  TPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  411



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  235  QGFASGNLDADAQSVRMFVADGGECLTAQSYAKNMGLYGERVGALSIVCKSADVATRVES  294

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + EL++EW  E++ MA RI ++RQ+L+D+L  + 
Sbjct  295  QLKLVIRPMYSNPPIHGASIVATILKDRELYHEWTIELKAMADRIINMRQQLFDALRARG  354

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  355  TPG-DWSHIIKQIGMFTFTGLNTEQVTFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  413



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVRMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A+RV+S
Sbjct  265  QGFASGNLDADAQSVRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCKTADVASRVES  324

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IVA V+ +  ++NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  325  QLKLVIRPMFSNPPIHGASIVATVLKDRNMYNEWTIELKAMADRIISMRQQLFDALRARG  384

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+S
Sbjct  268  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVES  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++
Sbjct  328  QLKLVIRPMYSNPPLHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRE  387

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  446



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 4/189 (2%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSL  DA++ R+FA  G+E   AQSYSKNLGLYAERIGA+N V + A AA    S
Sbjct  225  QGFASGSLVEDAAAPRLFAEMGMEFFCAQSYSKNLGLYAERIGALNAVLNDATAATNTLS  284

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELF---NEWKQEMEMMAGRIKSVRQKLYDSLS  415
            Q+ R+AR MYSNPP+HGARI A V+ +PELF   + W  EM  MAGRIK+VR++L++ L+
Sbjct  285  QMNRIARAMYSNPPVHGARIAATVINDPELFQARSRWNDEMGTMAGRIKTVRRELFEELT  344

Query  414  LKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLA  235
             +    KDW+F+ +QIGMFSFTGL+ AQ E M+    I+MTKDGRISLAGLS+AK +YLA
Sbjct  345  -RLNPDKDWSFVTRQIGMFSFTGLSPAQVERMTGTHKIFMTKDGRISLAGLSSAKVKYLA  403

Query  234  DAIIDSYYN  208
            +AI DS+ N
Sbjct  404  NAIDDSFRN  412



>ref|XP_010100270.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB82277.1| Aspartate aminotransferase [Morus notabilis]
Length=463

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  277  QGFASGSLDADAQPVRLFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASRVES  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  337  QLKLVIRPMYSNPPIHGASIVAIILKDRDLYNEWTIELKAMADRIISMRQQLFDALRARG  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  397  TPG-DWSHIIKQIGMFTFTGLNAEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  455



>ref|XP_005643912.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE19368.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=440

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG L+ DA+++R+FA  GLELL+AQSY+KN+GLY ER+GA++V+  SAD   RV+S
Sbjct  255  QGFASGDLERDATAIRLFADAGLELLLAQSYAKNMGLYGERVGALSVITKSADVTKRVES  314

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK++ RPM+SNPP HGA IV  V+ +P L+ EW++E++ MAGRI  +RQ+L+ +L    
Sbjct  315  QLKQVIRPMFSNPPRHGAAIVVEVLSDPSLYAEWREELKGMAGRIMQMRQELFRALQQVG  374

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G  W  IL QIGMFSFTGL K Q   M++KWH+YMT DGRIS+AGLS++KC YLA+AI
Sbjct  375  APG-SWNHILDQIGMFSFTGLTKEQVRVMTDKWHVYMTFDGRISMAGLSSSKCHYLAEAI  433

Query  225  IDS  217
             D+
Sbjct  434  NDA  436



>gb|KHN10226.1| Aspartate aminotransferase 1 [Glycine soja]
Length=416

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+S
Sbjct  230  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVES  289

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  290  QLKLVIRPMYSSPPIHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRG  349

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  350  TPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  408



>gb|KHG24168.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=405

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDADAQPVRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K 
Sbjct  279  QLKLVIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGL+  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLDSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_010420761.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Camelina sativa]
Length=405

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  273  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVAVRVES  332

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  + 
Sbjct  333  QLKLVIRPMYSNPPLHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRG  392

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  393  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  451



>ref|XP_002516566.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF45907.1| aspartate aminotransferase, putative [Ricinus communis]
Length=440

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G ELLV QSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  254  QGFASGSLDADAQPVRMFVADGGELLVVQSYAKNMGLYGERVGALSIVCRTADVASRVES  313

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  L++EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  314  QLKLVIRPMYSNPPIHGASIVAFILKDRNLYSEWTIELKAMADRIISMRQQLFDALRARG  373

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  374  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  432



>ref|XP_010920378.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Elaeis guineensis]
Length=464

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E L+AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  278  QGFASGSLDADAQSVRMFVADGGECLMAQSYAKNMGLYGERVGALSIVCRSADVAVRVES  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  + 
Sbjct  338  QLKLVIRPMYSNPPIHGASIVAAILKDRALFHEWTVELKAMADRIISMRQMLFDALRARG  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  398  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  456



>ref|NP_001237541.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|AAC50014.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|KHN18198.1| Aspartate aminotransferase 1 [Glycine soja]
Length=456

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+S
Sbjct  270  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVES  329

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  + 
Sbjct  330  QLKLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRG  389

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  390  TPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  448



>ref|XP_001695040.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP02192.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=433

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 144/188 (77%), Gaps = 3/188 (2%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRG--LELLVAQSYSKNLGLYAERIGAINVVCSSADAAARV  592
            QGFASG LDADA+SVR+FAS     E+++AQS++KN+GLY ER GA++VVC S + A RV
Sbjct  243  QGFASGDLDADAASVRLFASAPGPQEMVLAQSFAKNMGLYGERAGALSVVCKSKEVAGRV  302

Query  591  KSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSL  412
            +SQLK + RPMYSNPP+HGA I A V+ +P L   WK+E+  MA RIK++RQ LY  L  
Sbjct  303  ESQLKLVIRPMYSNPPMHGAAIAARVMADPRLNALWKEELAGMAHRIKAMRQALYGQLVA  362

Query  411  KDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLAD  232
            +   G DW+F+LKQIGMFS+TGL+KAQ E ++ KWHI++T DGRIS+AGLSAA C YLA+
Sbjct  363  RQLPG-DWSFVLKQIGMFSYTGLSKAQCEVLTRKWHIHLTMDGRISMAGLSAASCPYLAE  421

Query  231  AIIDSYYN  208
            AI D   N
Sbjct  422  AIADVVTN  429



>gb|AEX09182.1| putative aspartate aminotransferase 1 [Gossypium hirsutum]
Length=405

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDADAQPVRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK L RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K 
Sbjct  279  QLKLLIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGL+  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLDSDQVAFMIKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_010454237.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_008466236.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Cucumis melo]
Length=460

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  VR+F + G E  VAQSY+KNLGLY ER+GA+++VC +AD A+RV+S
Sbjct  274  QGFASGSLDKDAQPVRLFVADGGECFVAQSYAKNLGLYGERVGALSIVCKNADVASRVES  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+++L  + 
Sbjct  334  QLKLVIRPMYSNPPIHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFEALRARG  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  394  TPG-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD  +RV+S
Sbjct  266  QGFASGSLDTDAQSVRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVTSRVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K 
Sbjct  326  QLKLVIRPMYSNPPIHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  444



>ref|XP_011090162.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=460

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVRMFA  G E LVAQSY+KN+GLY ER+GA+++VC SAD A+RV+S
Sbjct  274  QGFASGNLDADAESVRMFAKDGGECLVAQSYAKNMGLYGERVGALSIVCRSADVASRVES  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  334  QLKLVIRPMYSNPPIHGASIVATILKDRSMYQEWTIELKAMAERIISMRQQLFDALRSRG  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  394  TPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_006451184.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 ref|XP_006475645.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Citrus 
sinensis]
 gb|ESR64424.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 gb|KDO48875.1| hypothetical protein CISIN_1g015435mg [Citrus sinensis]
Length=407

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E LVAQSY+KN+GLY ER+GA+++VC + D A+RV+S
Sbjct  221  QGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+LS + 
Sbjct  281  QLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI  399



>ref|XP_004136291.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168053.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60208.1| hypothetical protein Csa_3G889160 [Cucumis sativus]
Length=464

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  VR+F + G E  VAQSY+KNLGLY ER+GA+++VC +AD A+RV+S
Sbjct  278  QGFASGSLDKDAQPVRLFVADGGECFVAQSYAKNLGLYGERVGALSIVCKNADVASRVES  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  338  QLKLVIRPMYSSPPIHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFDALRARG  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  398  TPG-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  456



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  272  QGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCRTADVASRVES  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  332  QLKLVIRPMYSNPPIHGASIVATILKDRDMYNEWTIELKAMADRIISMRQQLFDALRDRG  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  392  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  450



>ref|XP_002871893.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48152.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWTHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD DA S+RMF + G E  VAQSY+KN+GLY ER+GA++VVC++AD A++V+S
Sbjct  266  QGFASGNLDEDAQSIRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCTAADVASKVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  + 
Sbjct  326  QLKLVIRPMFSNPPIHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_002873517.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49776.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  263  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  323  QLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  383  TPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>gb|AAA79370.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYTKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_009762342.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=409

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+S
Sbjct  223  QGFASGNLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDADVASRVES  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  283  QLKLVIRPMYSNPPIHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARG  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             +G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  343  TTG-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  262  QGFASGSLDTDAQSVRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVES  321

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +++EW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  322  QLKLVIRPMYSNPPIHGASIVATILKDRNMYHEWTLELKAMADRIIRMRQQLFDALRARG  381

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  382  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  440



>ref|NP_196713.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
 sp|P46644.1|AAT3_ARATH RecName: Full=Aspartate aminotransferase 3, chloroplastic; AltName: 
Full=Protein YELLOW-LEAF-SPECIFIC GENE 4; AltName: Full=Transaminase 
A; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA79371.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB87712.1| aspartate aminotransferase (Asp3) [Arabidopsis thaliana]
 gb|AAK92700.1| putative aspartate aminotransferase Asp3 [Arabidopsis thaliana]
 gb|AAL85041.1| putative aspartate aminotransferase ASP3 [Arabidopsis thaliana]
 gb|AED91691.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
Length=449

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  263  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  323  QLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  383  TPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_006287876.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
 gb|EOA20774.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
Length=405

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVVS  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|AAL09704.1|AF419301_1 aspartate aminotransferase [Securigera parviflora]
Length=341

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR F + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A+  +S
Sbjct  155  QGFASGSLDADAQSVRSFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVASLAES  214

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ +  L+NEW  E++ MA RI S+RQ+L+D+L  K 
Sbjct  215  QLKLVIRPMYSNPPLHGASIVATILKDRNLYNEWTIELKAMADRIISMRQQLFDALRAKG  274

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  275  TPG-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVSHLADAI  333



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  275  QGFASGSLDTDAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCRTADVATRVES  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA +  + +++ EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  335  QLKLVIRPMYSNPPIHGASIVATIFKDRDMYTEWTIELKAMADRIISMRQQLFDALRARG  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q  +M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  395  TPG-DWSHIVKQIGMFTFTGLNTEQVASMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  453



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+S
Sbjct  221  QGFASGSLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+++L +++
Sbjct  281  QLKLVIRPMYSNPPLHGASIVATILKDSAMFDEWTLELKAMADRIISMREQLFNALKIRE  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  399



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  +R+F + G ELL AQSY+KN+GLY ER+GA+++VC SAD A+RV+S
Sbjct  272  QGFASGSLDADAQPIRLFVADGGELLAAQSYAKNMGLYGERVGALSIVCKSADVASRVES  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+NEW  E++ MA RI ++RQ+L+D+L  + 
Sbjct  332  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNEWTIELKAMADRIINMRQQLFDALRARG  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  392  TPG-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYMTSDGRISMAGLSSRTVSHLADAI  450



>ref|NP_197456.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46645.2|AAT2_ARATH RecName: Full=Aspartate aminotransferase, cytoplasmic isozyme 
1; AltName: Full=Transaminase A [Arabidopsis thaliana]
 gb|ABG25061.1| At5g19550 [Arabidopsis thaliana]
 gb|AED92724.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_010493028.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+A+SY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAQSVRTFVADGGECLIAKSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA S+R+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  220  QGFASGNLDADAESIRLFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVATRVES  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IVA ++ + +++ EW  E++ MA RI S+RQ+LYD+L  + 
Sbjct  280  QLKLVIRPMFSNPPIHGASIVATILKDGDMYTEWSVELKAMADRIISMRQQLYDALCARG  339

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  340  TPG-DWSHIIKQIGMFTFTGLNTNQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_008220042.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Prunus mume]
Length=463

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA+SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  277  QGFASGSLDADAASVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASKVES  336

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K 
Sbjct  337  QLKLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKG  396

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  397  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  455



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  267  QGFASGSLDIDAQSVRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVES  326

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K 
Sbjct  327  QLKLVIRPMYSSPPIHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKG  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  387  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTIPHLTDAI  445



>ref|XP_009617506.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=409

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFA+G+LDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+S
Sbjct  223  QGFATGNLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDADVASRVES  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  283  QLKLVIRPMYSNPPIHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARG  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
             +G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  343  TAG-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD DA S+RMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A++V+S
Sbjct  266  QGFASGNLDEDAQSIRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCRAADVASKVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  + 
Sbjct  326  QLKLVIRPMFSNPPIHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  264  QGFASGSLDTDAQSVRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVES  323

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  ++ EW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  324  QLKLVIRPMYSNPPIHGASIVATILKDRNMYREWTLELKAMADRIIRMRQQLFDALRARG  383

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  384  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  442



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA +VR+F + G E  VAQSY+KN+GLY ER+GA++VVC++A  A+RV S
Sbjct  220  QGFASGSLDKDAHAVRLFVADGGECFVAQSYAKNMGLYGERVGALSVVCTNAAVASRVDS  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PP HGA I A ++ +  LF EW  E++ MA RI S+RQ+LYD+L  + 
Sbjct  280  QLKLVIRPMYSSPPAHGAAIAATILADGRLFQEWTVELKGMADRIISMRQQLYDALQARG  339

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT +LKQIGMF+FTGLNK+Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  340  TPG-DWTHVLKQIGMFTFTGLNKSQVEFMTRQYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_006476087.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=455

 Score =   231 bits (588),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 140/185 (76%), Gaps = 5/185 (3%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD+DA SVRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+S
Sbjct  263  QGFASGSLDSDAQSVRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  ++
Sbjct  323  QVKLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARE  382

Query  405  -----KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEY  241
                  +  DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +
Sbjct  383  IWYIAGTPGDWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPH  442

Query  240  LADAI  226
            LADAI
Sbjct  443  LADAI  447



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  219  QGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PP+HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QLKLVIRPMYSSPPLHGASIVAAILKDGDLYNEWTLELKAMADRIISMRQELFNALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+N++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_006289742.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
 gb|EOA22640.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
Length=452

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A RV+S
Sbjct  266  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGRVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  326  QLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRTRG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>gb|KFK25414.1| aspartate aminotransferase [Arabis alpina]
Length=449

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A +V+S
Sbjct  263  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGKVES  322

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LF+EW  E++ MA RI S+R++L+++L  + 
Sbjct  323  QLKLVIRPMYSSPPIHGASIVAVILRDKNLFHEWTLELKAMADRIISMRKQLFEALRARG  382

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  383  TPG-DWTHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_010688229.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDEDAQSVRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKTADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA+++ +  L++EW  E++ MA RI S+RQ+L+D+L+ + 
Sbjct  279  QLKLVVRPMYSNPPLHGASIVASILKDKSLYDEWTIELKEMADRIISMRQQLFDALNARG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNADQVTFMRAEYHIYMTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_008378104.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=421

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  235  QGFASGSLDGDAQSVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVES  294

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K 
Sbjct  295  QLKLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKEMADRIISMRHQLFESLRAKG  354

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  355  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  413



>ref|XP_010419724.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=454

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+S
Sbjct  268  QGFASGSLDADAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVES  327

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  328  QLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  387

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  TPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>ref|XP_007222958.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
 gb|AGF95095.1| aspartate aminotransferase [Prunus persica]
 gb|EMJ24157.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
Length=467

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  281  QGFASGSLDADAESVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASKVES  340

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K 
Sbjct  341  QVKLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKG  400

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  401  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  459



>gb|KCW81535.1| hypothetical protein EUGRSUZ_C02894 [Eucalyptus grandis]
Length=452

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA S+R F + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  266  QGFASGNLDADAQSIRSFVADGGECLVAQSYAKNMGLYGERVGALSIVCRTADVAGRVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  + 
Sbjct  326  QLKLVIRPMYSNPPIHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_010048107.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Eucalyptus 
grandis]
 gb|KCW80239.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=406

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E LVAQSY+KN+GLY ER+GA+++VC ++D A +V+S
Sbjct  220  QGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTSDVAGKVES  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ + +++NEW  E++ MA RI S+R +L+++L  + 
Sbjct  280  QLKLVIRPMYSNPPLHGASIVATILRDKDMYNEWTIELKAMADRIISMRHQLFEALKTRG  339

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  340  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  398



>ref|XP_006399658.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
 dbj|BAJ33906.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41111.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
Length=453

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  267  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVES  326

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  327  QLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  386

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LAD+I
Sbjct  387  TPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADSI  445



>ref|XP_005843806.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
 gb|EFN51704.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
Length=406

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG LD D  S+R+F   GLELL+AQS++KN+GLY ER+GA+ V+   + AA +V+S
Sbjct  221  QGFASGDLDRDGYSIRLFCDAGLELLLAQSFAKNMGLYGERVGALTVIVGDSAAAKKVES  280

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK  AR MYSNPP HGA I   ++ +P+L+ +WK E++ MA RI ++RQ+LY +L    
Sbjct  281  QLKITARQMYSNPPRHGASIATRILADPQLYAQWKVELKGMADRILTMRQQLYQALQEVG  340

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW  IL+QIGMFS+TGL KAQ ENM+NKWH+YMT DGRIS+AGLS++KC YLA A+
Sbjct  341  APG-DWGHILRQIGMFSYTGLTKAQVENMTNKWHVYMTFDGRISMAGLSSSKCGYLAQAM  399

Query  225  IDSYYNV  205
             DS  N 
Sbjct  400  KDSVENC  406



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG LD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+S
Sbjct  278  QGFASGDLDKDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVKVES  337

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ N ++F EW  E++ MA RI S+RQ+L+++L+++ 
Sbjct  338  QLKLVIRPMYSNPPLHGATIVATILNNRDMFEEWTIELKGMANRIISMRQQLFNALNIRG  397

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+   ++LA+AI
Sbjct  398  TPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVDHLANAI  456



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD DA S+RMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A++V+S
Sbjct  266  QGFASGNLDEDAQSIRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCRAADVASKVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IV  ++ +  +FNEW  E++ MA RI S+R++L+D+L  + 
Sbjct  326  QLKLVIRPMFSNPPIHGASIVVTILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_009410920.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+L+ADA S+RMF + G E L AQSY+KN+GLY ER+GA+++VC SAD A RV+S
Sbjct  273  QGFASGNLEADAQSIRMFVADGGECLTAQSYAKNMGLYGERVGALSIVCKSADVAVRVES  332

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + E+++EW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  333  QLKLVIRPMYSNPPIHGASIVATILKDREMYHEWTIELKAMADRIIRMRQQLFDALRTRG  392

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN+ Q  +M+ ++HIYMT DGRIS+AGLS+    +LA AI
Sbjct  393  TPG-DWSHIVKQIGMFTFTGLNREQVTSMTKEYHIYMTSDGRISMAGLSSKTVPHLAGAI  451



>ref|XP_010042868.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Eucalyptus grandis]
Length=120

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  561  MYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTF  382
            MY +PP+HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KDKSGKDW+F
Sbjct  1    MYCSPPVHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSF  60

Query  381  ILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  202
            ILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  61   ILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  120



>gb|KJB64944.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=405

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  VR F + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDVDAQPVRTFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K 
Sbjct  279  QLKLVIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G +W+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-NWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_010693429.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD DA  VRMF + G E L+AQSY+KN+GLY ER+GA+++VC++AD A RV+S
Sbjct  265  QGFASGNLDTDAKPVRMFVADGGECLLAQSYAKNMGLYGERVGALSIVCNTADVANRVES  324

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPM+SNPPIHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  + 
Sbjct  325  QLKLVTRPMFSNPPIHGASIVATILRDRNMYDEWTVELKAMAERIISMRQKLFDALQTRG  384

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  385  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSKTIPHLADAM  443



>ref|XP_008352022.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  275  QGFASGSLDGDAQSVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVES  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K 
Sbjct  335  QLKLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKG  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  395  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>ref|XP_008361035.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  275  QGFASGSLDGDAQSVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVES  334

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K 
Sbjct  335  QLKLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKG  394

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  395  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  VRMF + G ELL+AQSY+KN+G+Y ER+GA+++VC SAD AARV+S
Sbjct  223  QGFASGSLDKDAQPVRMFIADGGELLMAQSYAKNMGMYGERVGALSIVCGSADVAARVES  282

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PP+HG  +VA ++ + E+F+EW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  283  QLKLVIRPMYSSPPLHGPSVVATILKDSEMFHEWTVELKAMADRIISMRQQLFDALKSRG  342

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGL+     +LADAI
Sbjct  343  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLNMKNVPHLADAI  401



>ref|XP_004291203.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR FA+ G ELLVAQSY+KN+GLY ER+GA+++V  ++  AA+V+S
Sbjct  273  QGFASGSLDADAQSVRRFAADGGELLVAQSYAKNMGLYGERVGALSIVLKTSGVAAKVES  332

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L+DSL  K 
Sbjct  333  QLKLVIRPMYSNPPIHGASIVATILKDKDLFNEWTIELKAMADRIISMRHQLFDSLRAKG  392

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  393  TPG-DWSHIIKQIGMFTFTGLNPEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  451



>ref|XP_010453196.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Camelina 
sativa]
Length=455

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+S
Sbjct  269  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVES  328

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  329  QLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  388

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  389  TPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>ref|XP_010491885.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=451

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+S
Sbjct  265  QGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVES  324

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  + 
Sbjct  325  QLKLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARG  384

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  TPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>gb|KFK26196.1| hypothetical protein AALP_AA8G215200 [Arabis alpina]
Length=405

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVRMF + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAGSVRMFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+R++L+++L  + 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKAMADRIISMRKQLFEALQTRG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEHHIYMTSDGRISMAGLSSKTVPHLADAI  397

Query  225  IDS  217
             D+
Sbjct  398  HDA  400



>ref|XP_009120876.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Brassica rapa]
Length=405

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDX92520.1| BnaA10g15590D [Brassica napus]
Length=405

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDY65959.1| BnaC09g54080D [Brassica napus]
Length=405

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>ref|XP_009367911.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X2 
[Pyrus x bretschneideri]
Length=452

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  266  QGFASGSLDGDAQSVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVES  325

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K 
Sbjct  326  QLKLVIRPMYSNPPIHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKG  385

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  386  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  444



>emb|CDY44925.1| BnaA02g04300D [Brassica napus]
Length=405

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC S+D A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSSDVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MAGRI S+RQ L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMAGRIISMRQHLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>ref|XP_006400515.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
 gb|ESQ41968.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
Length=405

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + E++N+W  E++ MA RI S+R++L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSEMYNDWTIELKGMADRIISMRKQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVDAI  397



>ref|XP_009367910.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X1 
[Pyrus x bretschneideri]
Length=460

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+S
Sbjct  274  QGFASGSLDGDAQSVRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVES  333

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K 
Sbjct  334  QLKLVIRPMYSNPPIHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKG  393

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  394  TPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  452



>ref|XP_006352160.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Solanum 
tuberosum]
Length=406

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC  ++ A++V+S
Sbjct  220  QGFASGNLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDSNVASKVES  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LYD++  + 
Sbjct  280  QLKMVIRPMYSNPPIHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYDAMQARG  339

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  340  TPG-DWSHIIKQIGMFTFTGLNVEQVSFMTREYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>ref|XP_010532471.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Tarenaya 
hassleriana]
Length=451

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+L++DA S+RMF + G E LVAQS++KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  265  QGFASGNLESDAQSIRMFVADGGECLVAQSFAKNMGLYGERVGALSIVCKAADVAGRVES  324

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  + 
Sbjct  325  QLKLVIRPMYSNPPIHGASIVAAILRDRNMFNEWTLELKAMADRIISMRKQLFDALRARG  384

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  385  TPG-DWSHIVKQIGMFTFTGLNTAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLTEAI  443



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+S
Sbjct  232  QGFASGSLDADAQPVRLFVAEGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVES  291

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  292  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARG  351

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  352  TPG-DWSHIIKQIGMFTFTGLNSEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_004243159.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=406

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG LDADA SVRMF + G E L AQSY+KN+GLY ER+GA+++VC  +D A++V+S
Sbjct  220  QGFASGKLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDSDVASKVES  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LY ++  + 
Sbjct  280  QLKMVIRPMYSNPPIHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYAAMQARG  339

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M++++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  340  TPG-DWSHIIKQIGMFTFTGLNAEQVSFMTSEYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>gb|AAA33408.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA +VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SAD A+RV+S
Sbjct  234  QGFASGSLDIDAQAVRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSADVASRVES  293

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  294  QVKLVVRPMYSNPPIHGASIVAAILRDRDLYNEWHIELKAMADRIIKMRQQLFDALQSRG  353

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  354  TPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+S
Sbjct  232  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVES  291

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  292  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARG  351

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  352  TPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>gb|AAA50160.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA +VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SAD A+RV+S
Sbjct  234  QGFASGSLDIDAQAVRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSADVASRVES  293

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  + 
Sbjct  294  QVKLVVRPMYSNPPIHGASIVAAILRDRDLYNEWTIELKAMADRIIKMRQQLFDALQSRG  353

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  354  TPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+S
Sbjct  231  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVES  290

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  291  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARG  350

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  351  TPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  409



>emb|CDY71396.1| BnaCnng72730D [Brassica napus]
Length=240

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD+DA SVRMF + G E L+AQS++KN+GLY ERIGA+ +VC+S D A +VKS
Sbjct  54   QGFASGNLDSDAQSVRMFVADGGECLIAQSFAKNMGLYGERIGALTIVCTSEDVARKVKS  113

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QL  + RPMY +PPIHGA IV  ++ N +++ +W  E++ MA RI S+RQ+LY+++  + 
Sbjct  114  QLLLVVRPMYLSPPIHGASIVTTILKNSDMYKDWTIELKGMADRIISMRQQLYEAIQARG  173

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMFSFTGLN+ Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  174  TPG-DWSHIIKQIGMFSFTGLNEKQVRMMAKEYHIYMTYDGRISMAGLSSKTVPQLADAI  232



>ref|XP_010049084.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Eucalyptus 
grandis]
Length=594

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA S+R F + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  408  QGFASGNLDADAQSIRSFVADGGECLVAQSYAKNMGLYGERVGALSIVCRTADVAGRVES  467

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  + 
Sbjct  468  QLKLVIRPMYSNPPIHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARG  527

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  528  TPG-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  586



>emb|CDY42276.1| BnaC02g08820D [Brassica napus]
Length=405

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC S+D A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSSDVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>ref|XP_002989786.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
 gb|EFJ09053.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
Length=413

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA +VR F + G E  +AQS++KNLGLY ER+GA+++V  S+  A RV+S
Sbjct  226  QGFASGSLDKDAHAVRTFVADGGECFIAQSFAKNLGLYGERVGALSIVTKSSGVATRVES  285

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  + 
Sbjct  286  QLKLVIRPMYSNPPIHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARG  345

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  346  TPG-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  404



>gb|KEH36020.1| aspartate aminotransferase [Medicago truncatula]
Length=458

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+S
Sbjct  272  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVES  331

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  332  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARG  391

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  392  TPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  450



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LD DA SVRMF   G E +VAQS++KN+GLY ER+GA+++VC +AD A RV+S
Sbjct  269  QGFASGNLDTDAQSVRMFVKDGGECIVAQSFAKNMGLYGERVGALSIVCRNADVAGRVES  328

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA V+ +  +F EW  E++ MA RI ++R +L+D+L  + 
Sbjct  329  QLKLVIRPMYSNPPIHGASIVATVLKDRNMFQEWTVELKAMADRIINMRTQLFDALRSRG  388

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  389  TPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  447



>sp|P28011.2|AAT1_MEDSA RecName: Full=Aspartate aminotransferase 1; AltName: Full=Transaminase 
A [Medicago sativa]
 gb|AAB46610.1| aspartate aminotransferase [Medicago sativa]
Length=418

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+S
Sbjct  232  QGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVES  291

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  + 
Sbjct  292  QLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARG  351

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LA AI
Sbjct  352  TPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLAHAI  410



>gb|ABR16105.1| unknown [Picea sitchensis]
Length=424

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F   G E L+AQS++KN+GLY ER+GA+++VC SA  A RV+S
Sbjct  238  QGFASGSLDADAYSVRLFVGDGGECLIAQSFAKNMGLYGERVGALSIVCRSATVATRVES  297

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  L+  W  E++ MA RI S+R +LYD+L  + 
Sbjct  298  QLKLVIRPMYSSPPIHGASIVATILSDRNLYYNWTVELKNMADRIISMRHQLYDALKARG  357

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  358  TPG-DWSHIIKQIGMFTFTGLNKDQVSFMTAEYHIYLTSDGRISMAGLSSKTVPHLADAI  416



>emb|CAA63894.1| aspartate aminotransferase [Lotus japonicus]
Length=418

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASG+LDADA SVR F + G ELL AQSY+KN+GLY ER+GA+++V  SAD A+ V+S
Sbjct  232  QGFASGNLDADAHSVRSFVADGGELLAAQSYAKNMGLYGERVGALSIVSKSADVASLVES  291

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPP+HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  + 
Sbjct  292  QLKLVIRPMYSNPPLHGASIVATILKDRDLYNEWTIELKGMADRIISMRQQLFDALRSRG  351

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+K IGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  352  TPG-DWSHIIKSIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_002990136.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
 gb|EFJ08853.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
Length=414

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA +VR F + G E  +AQS++KN+GLY ER+GA+++V  S+  A RV+S
Sbjct  227  QGFASGSLDKDALAVRTFVADGGECFIAQSFAKNMGLYGERVGALSIVSKSSGVATRVES  286

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  + 
Sbjct  287  QLKLVIRPMYSNPPIHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARG  346

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  347  TPG-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  405



>gb|KJB64945.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=404

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA  VR F + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+S
Sbjct  219  QGFASGSLDVDAQPVRTFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K 
Sbjct  279  QLKLVIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G +W+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DG IS+AGLS+    +LADAI
Sbjct  339  TPG-NWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDG-ISMAGLSSKTVPHLADAI  396



>gb|ACN40894.1| unknown [Picea sitchensis]
Length=462

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVR+F   G E L+AQS++KN+GLY ER+GA+++VC SA  A RV+S
Sbjct  276  QGFASGSLDADAYSVRLFVGDGGECLIAQSFAKNMGLYGERVGALSIVCRSATVATRVES  335

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            QLK + RPMYS+PPIHGA IVA ++ +  L+  W  E++ MA RI S+R +LYD+L  + 
Sbjct  336  QLKLVIRPMYSSPPIHGASIVATILSDRNLYYNWTVELKNMADRIISMRHQLYDALKARG  395

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  396  TPG-DWSHIIKQIGMFTFTGLNKDQVSFMTAEYHIYLTSDGRISMAGLSSKTVPHLADAI  454



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLD DA SVR F + G   L+AQSY+KN+GLY ER+GA+++VC S+D A++V+S
Sbjct  219  QGFASGSLDTDAHSVRTFVADGGGCLIAQSYAKNMGLYGERVGALSIVCKSSDVASKVES  278

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K 
Sbjct  279  QVKLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKG  338

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  339  TPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>gb|KCW80240.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=415

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 10/189 (5%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA SVRMF + G E LVAQSY+KN+GLY ER+GA+++VC ++D A +V+S
Sbjct  220  QGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTSDVAGKVES  279

Query  585  QLKRLARPMYSNPPIHGARIVANVVGN-----P----ELFNEWKQEMEMMAGRIKSVRQK  433
            QLK + RPMYSNPP+HGA IVA ++ +     P    +++NEW  E++ MA RI S+R +
Sbjct  280  QLKLVIRPMYSNPPLHGASIVATILRDNQICLPHICRDMYNEWTIELKAMADRIISMRHQ  339

Query  432  LYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAA  253
            L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+ 
Sbjct  340  LFEALKTRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSR  398

Query  252  KCEYLADAI  226
               +LADAI
Sbjct  399  TVPHLADAI  407



>dbj|BAE99790.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=240

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  765  QGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKS  586
            QGFASGSLDADA +VRMF + G E L+AQSY+KN+GLY ERIG++ +VC+S D A +V++
Sbjct  54   QGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVCTSEDVAKKVEN  113

Query  585  QLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD  406
            Q+  + RPMY  PPIHGA IVA ++ N +++N+W  E++ MA RI S+RQ+LY +L  + 
Sbjct  114  QVLLVVRPMYLTPPIHGASIVATILKNSDMYNDWTIELKGMADRIISMRQQLYAALEARG  173

Query  405  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  226
              G DW+ I+K IGMF+FTGL++ Q   M+ ++HIYMT DGRIS+A LS+     LADAI
Sbjct  174  TPG-DWSHIIKHIGMFTFTGLSEEQVRLMAKEYHIYMTYDGRISMASLSSKTVPQLADAI  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890