BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031H04

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608295.1|  PREDICTED: importin subunit alpha-2-like           313   1e-103   Nicotiana tomentosiformis
ref|XP_009783203.1|  PREDICTED: importin subunit alpha-2                317   7e-102   Nicotiana sylvestris
ref|XP_011077370.1|  PREDICTED: importin subunit alpha-2                305   3e-97    Sesamum indicum [beniseed]
gb|KDP29087.1|  hypothetical protein JCGZ_16476                         305   4e-97    Jatropha curcas
ref|XP_007027272.1|  Importin alpha isoform 1                           302   5e-96    
ref|XP_002525173.1|  Importin alpha-2 subunit, putative                 300   2e-95    Ricinus communis
ref|XP_008449813.1|  PREDICTED: importin subunit alpha-2 isoform X2     297   1e-94    Cucumis melo [Oriental melon]
gb|KJB11224.1|  hypothetical protein B456_001G248100                    298   1e-94    Gossypium raimondii
gb|KDO48092.1|  hypothetical protein CISIN_1g0096472mg                  288   1e-94    Citrus sinensis [apfelsine]
ref|XP_011006955.1|  PREDICTED: importin subunit alpha-2                298   2e-94    Populus euphratica
ref|XP_008449812.1|  PREDICTED: importin subunit alpha-2 isoform X1     296   7e-94    Cucumis melo [Oriental melon]
ref|XP_002323457.1|  hypothetical protein POPTR_0016s08790g             296   1e-93    Populus trichocarpa [western balsam poplar]
gb|KHG28931.1|  hypothetical protein F383_14389                         296   1e-93    Gossypium arboreum [tree cotton]
ref|XP_002279724.1|  PREDICTED: importin subunit alpha-2                296   1e-93    Vitis vinifera
ref|XP_004249499.1|  PREDICTED: importin subunit alpha-2                296   2e-93    
ref|XP_010248168.1|  PREDICTED: importin subunit alpha-2-like           285   3e-93    Nelumbo nucifera [Indian lotus]
ref|XP_009358163.1|  PREDICTED: importin subunit alpha-2-like           295   3e-93    Pyrus x bretschneideri [bai li]
ref|XP_010696399.1|  PREDICTED: importin subunit alpha-2                294   6e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008239299.1|  PREDICTED: importin subunit alpha-2                294   7e-93    Prunus mume [ume]
gb|KEH42271.1|  importin subunit alpha-like protein                     294   8e-93    Medicago truncatula
ref|XP_007204998.1|  hypothetical protein PRUPE_ppa004234mg             294   8e-93    Prunus persica
ref|XP_004497474.1|  PREDICTED: importin subunit alpha-2-like           293   1e-92    Cicer arietinum [garbanzo]
ref|XP_004304406.1|  PREDICTED: importin subunit alpha-9                293   1e-92    Fragaria vesca subsp. vesca
ref|XP_008793530.1|  PREDICTED: importin subunit alpha-2                293   1e-92    Phoenix dactylifera
ref|XP_006339060.1|  PREDICTED: importin subunit alpha-2-like           293   1e-92    Solanum tuberosum [potatoes]
ref|XP_009342579.1|  PREDICTED: importin subunit alpha-2-like           293   2e-92    Pyrus x bretschneideri [bai li]
gb|EYU38519.1|  hypothetical protein MIMGU_mgv1a004564mg                292   3e-92    Erythranthe guttata [common monkey flower]
ref|XP_004142168.1|  PREDICTED: importin subunit alpha-2-like           292   5e-92    
ref|XP_004162005.1|  PREDICTED: importin subunit alpha-2-like           292   5e-92    
ref|XP_008387624.1|  PREDICTED: importin subunit alpha-2-like           291   1e-91    
ref|XP_010920896.1|  PREDICTED: importin subunit alpha-2 isoform X2     290   2e-91    
ref|XP_006428837.1|  hypothetical protein CICLE_v10011496mg             290   2e-91    Citrus clementina [clementine]
ref|XP_010920895.1|  PREDICTED: importin subunit alpha-2 isoform X1     290   2e-91    Elaeis guineensis
ref|XP_010543379.1|  PREDICTED: importin subunit alpha-2                286   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_007144541.1|  hypothetical protein PHAVU_007G164500g             285   3e-89    Phaseolus vulgaris [French bean]
emb|CDP06714.1|  unnamed protein product                                284   1e-88    Coffea canephora [robusta coffee]
emb|CAN61727.1|  hypothetical protein VITISV_032422                     283   2e-88    Vitis vinifera
ref|XP_003542502.1|  PREDICTED: importin subunit alpha-2-like iso...    280   1e-87    Glycine max [soybeans]
ref|XP_010037940.1|  PREDICTED: importin subunit alpha-2                280   2e-87    Eucalyptus grandis [rose gum]
ref|XP_003542503.1|  PREDICTED: importin subunit alpha-2-like iso...    277   3e-86    
emb|CDX70330.1|  BnaA10g26790D                                          267   9e-86    
ref|XP_009125477.1|  PREDICTED: importin subunit alpha-2-like           273   8e-85    Brassica rapa
emb|CDY55698.1|  BnaC02g03390D                                          273   9e-85    Brassica napus [oilseed rape]
ref|XP_009421388.1|  PREDICTED: importin subunit alpha-2                272   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK24759.1|  hypothetical protein AALP_AA8G021400                    271   4e-84    Arabis alpina [alpine rockcress]
emb|CDY04878.1|  BnaAnng00600D                                          270   2e-83    
ref|XP_006398757.1|  hypothetical protein EUTSA_v10013263mg             268   8e-83    Eutrema salsugineum [saltwater cress]
emb|CAB86074.1|  importin alpha-like protein                            265   6e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195927.2|  importin alpha isoform 9                              265   9e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107576.1|  Importin subunit alpha-2                           264   1e-81    
ref|XP_002873075.1|  binding protein                                    264   4e-81    
ref|XP_006594124.1|  PREDICTED: importin subunit alpha-2-like iso...    261   2e-80    
ref|XP_006836482.1|  hypothetical protein AMTR_s00108p00104150          259   4e-79    
dbj|BAJ94044.1|  predicted protein                                      256   4e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY10407.1|  BnaCnng03080D                                          257   8e-79    Brassica napus [oilseed rape]
ref|XP_004968263.1|  PREDICTED: importin subunit alpha-2-like           258   1e-78    Setaria italica
ref|NP_001147773.1|  importin alpha-2 subunit                           256   5e-78    Zea mays [maize]
gb|ACN31641.1|  unknown                                                 255   1e-77    Zea mays [maize]
emb|CDM81997.1|  unnamed protein product                                254   1e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002457309.1|  hypothetical protein SORBIDRAFT_03g005380          254   3e-77    Sorghum bicolor [broomcorn]
gb|EMT10396.1|  Importin subunit alpha-2                                254   5e-77    
gb|EMS52684.1|  Importin subunit alpha-2                                254   6e-77    Triticum urartu
ref|XP_003567730.1|  PREDICTED: importin subunit alpha-2                251   4e-76    Brachypodium distachyon [annual false brome]
ref|XP_006289370.1|  hypothetical protein CARUB_v10002864mg             249   1e-75    Capsella rubella
gb|EEC69979.1|  hypothetical protein OsI_00484                          247   1e-74    Oryza sativa Indica Group [Indian rice]
dbj|BAA31220.1|  unnamed protein product                                247   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643773.1|  PREDICTED: importin subunit alpha-2-like           246   4e-74    Oryza brachyantha
ref|XP_010423779.1|  PREDICTED: importin subunit alpha-2-like           245   4e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010452168.1|  PREDICTED: importin subunit alpha-2-like           245   6e-74    Camelina sativa [gold-of-pleasure]
gb|EAZ10619.1|  hypothetical protein OsJ_00451                          242   6e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042074.1|  Os01g0158000                                       242   7e-73    
ref|XP_010490774.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    240   3e-72    
gb|EPS72639.1|  hypothetical protein M569_02116                         228   1e-67    Genlisea aurea
ref|XP_007027273.1|  Importin subunit alpha-2 isoform 2                 213   6e-62    
ref|XP_001758629.1|  predicted protein                                  213   8e-62    
ref|XP_001775435.1|  predicted protein                                  201   2e-57    
ref|XP_009122933.1|  PREDICTED: importin subunit alpha-2-like           178   4e-50    
ref|XP_002985897.1|  hypothetical protein SELMODRAFT_123107             178   1e-48    
ref|XP_002976434.1|  hypothetical protein SELMODRAFT_105015             178   1e-48    
ref|XP_010107579.1|  hypothetical protein L484_024435                   136   5e-37    
ref|XP_004353002.1|  Armadillo/betacatenin-like repeat domain con...    117   7e-27    Acanthamoeba castellanii str. Neff
ref|XP_005846007.1|  hypothetical protein CHLNCDRAFT_58379              101   8e-21    Chlorella variabilis
emb|CCA14786.1|  importin alpha 1 subunitlike protein putative        94.4    1e-18    Albugo laibachii Nc14
gb|ETI56772.1|  hypothetical protein, variant 1                       94.0    1e-18    Phytophthora parasitica P1569
dbj|GAN02228.1|  importin subunit alpha-2-like                        94.4    1e-18    Mucor ambiguus
ref|XP_008890414.1|  hypothetical protein PPTG_00708                  93.6    3e-18    Phytophthora parasitica INRA-310
emb|CCI11425.1|  unnamed protein product                              93.2    3e-18    Albugo candida
tpg|DAA38992.1|  TPA: hypothetical protein ZEAMMB73_042843            92.8    6e-18    
ref|XP_009523333.1|  hypothetical protein PHYSODRAFT_354318           92.0    1e-17    Phytophthora sojae
gb|EPB91411.1|  hypothetical protein HMPREF1544_01733                 91.7    1e-17    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002896684.1|  importin alpha-2 subunit                         90.5    3e-17    Phytophthora infestans T30-4
gb|ELU07006.1|  hypothetical protein CAPTEDRAFT_224969                89.4    6e-17    Capitella teleta
emb|CEP10345.1|  hypothetical protein                                 89.4    7e-17    Parasitella parasitica
ref|WP_028833024.1|  hypothetical protein                             89.0    1e-16    
ref|XP_005778844.1|  hypothetical protein EMIHUDRAFT_421349           87.4    4e-16    Emiliania huxleyi CCMP1516
ref|XP_005758728.1|  hypothetical protein EMIHUDRAFT_460128           87.4    4e-16    Emiliania huxleyi CCMP1516
ref|XP_001713610.1|  importin alpha                                   87.0    4e-16    Guillardia theta
ref|XP_001698656.1|  importin alpha                                   85.5    1e-15    Chlamydomonas reinhardtii
gb|KFH65960.1|  hypothetical protein MVEG_08062                       85.1    2e-15    Mortierella verticillata NRRL 6337
ref|XP_005849695.1|  hypothetical protein CHLNCDRAFT_30497            84.7    2e-15    Chlorella variabilis
ref|XP_002508520.1|  predicted protein                                84.7    3e-15    Micromonas commoda
ref|XP_011214471.1|  PREDICTED: importin subunit alpha-7              84.7    3e-15    Bactrocera dorsalis [papaya fruit fly]
ref|XP_009401503.1|  PREDICTED: importin subunit alpha-1b-like        84.7    3e-15    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412111.1|  PREDICTED: importin subunit alpha-1b-like        84.3    4e-15    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP27954.1|  hypothetical protein JCGZ_19034                       84.0    5e-15    Jatropha curcas
emb|CBN79488.1|  conserved unknown protein                            84.0    6e-15    Ectocarpus siliculosus
ref|XP_010152917.1|  PREDICTED: importin subunit alpha-7              81.3    7e-15    Eurypyga helias
ref|XP_008137233.1|  PREDICTED: importin subunit alpha-6 isoform X2   83.6    7e-15    
ref|XP_008137225.1|  PREDICTED: importin subunit alpha-6 isoform X1   83.2    8e-15    Eptesicus fuscus
ref|XP_011193831.1|  PREDICTED: importin subunit alpha-7              83.2    8e-15    Zeugodacus cucurbitae [melon fruit fly]
gb|EPQ03176.1|  Importin subunit alpha-6                              83.2    9e-15    Myotis brandtii
gb|AFW79686.1|  importin alpha-1b subunit, mRNA                       81.3    9e-15    
ref|XP_010649543.1|  PREDICTED: importin subunit alpha-1 isoform X2   83.2    9e-15    
ref|XP_005858982.1|  PREDICTED: importin subunit alpha-6 isoform X2   83.2    1e-14    
ref|XP_005858981.1|  PREDICTED: importin subunit alpha-6 isoform X1   83.2    1e-14    Myotis brandtii
ref|XP_006089255.1|  PREDICTED: importin subunit alpha-6 isoform X1   82.8    1e-14    Myotis lucifugus
ref|XP_004977076.1|  PREDICTED: importin subunit alpha-1b-like is...  82.8    1e-14    Setaria italica
gb|EAX07569.1|  karyopherin alpha 6 (importin alpha 7), isoform C...  80.9    1e-14    Homo sapiens [man]
ref|XP_010147047.1|  PREDICTED: importin subunit alpha-6-like         80.1    1e-14    Eurypyga helias
ref|XP_003057280.1|  predicted protein                                82.8    1e-14    Micromonas pusilla CCMP1545
ref|XP_006089256.1|  PREDICTED: importin subunit alpha-6 isoform X2   82.8    1e-14    
ref|XP_009796205.1|  PREDICTED: importin subunit alpha-1              82.8    1e-14    Nicotiana sylvestris
ref|XP_010281281.1|  PREDICTED: importin subunit alpha-6              81.3    1e-14    Phaethon lepturus
emb|CEF99159.1|  Armadillo-type fold                                  82.4    1e-14    Ostreococcus tauri
gb|KFQ71708.1|  Importin subunit alpha-6                              81.3    1e-14    Phaethon lepturus
ref|XP_008870934.1|  hypothetical protein H310_07333                  82.4    1e-14    Aphanomyces invadans
ref|XP_002275593.1|  PREDICTED: importin subunit alpha-1 isoform X1   82.4    2e-14    
ref|XP_008350735.1|  PREDICTED: importin subunit alpha-1b-like        79.7    2e-14    
ref|XP_006778476.1|  PREDICTED: importin subunit alpha-6              82.0    2e-14    Myotis davidii
ref|XP_009204486.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...  80.5    2e-14    
gb|KFK43224.1|  hypothetical protein AALP_AA1G096500                  82.0    2e-14    Arabis alpina [alpine rockcress]
ref|XP_009606138.1|  PREDICTED: importin subunit alpha                82.0    2e-14    Nicotiana tomentosiformis
ref|XP_009592620.1|  PREDICTED: importin subunit alpha-1              82.0    2e-14    Nicotiana tomentosiformis
ref|XP_010129497.1|  PREDICTED: importin subunit alpha-6              81.3    2e-14    Buceros rhinoceros silvestris
gb|EXX74289.1|  Srp1p                                                 81.6    2e-14    Rhizophagus irregularis DAOM 197198w
gb|KFO86679.1|  Importin subunit alpha-6                              81.3    2e-14    Buceros rhinoceros silvestris
gb|EKC27679.1|  Importin subunit alpha-2                              81.6    2e-14    Crassostrea gigas
ref|XP_011445049.1|  PREDICTED: importin subunit alpha-9-like         81.6    3e-14    Crassostrea gigas
ref|XP_009789105.1|  PREDICTED: importin subunit alpha                81.6    3e-14    Nicotiana sylvestris
ref|XP_009817162.1|  PREDICTED: importin subunit alpha-6              81.3    3e-14    Gavia stellata
gb|KFV45640.1|  Importin subunit alpha-6                              81.3    3e-14    Gavia stellata
ref|XP_004526135.1|  PREDICTED: importin subunit alpha-7-like         81.6    3e-14    Ceratitis capitata [medfly]
gb|ERZ95887.1|  hypothetical protein GLOINDRAFT_340985                81.6    3e-14    
ref|XP_009643521.1|  PREDICTED: importin subunit alpha-6 isoform X2   81.6    3e-14    Egretta garzetta
ref|XP_010003132.1|  PREDICTED: importin subunit alpha-6 isoform X1   81.6    3e-14    Chaetura pelagica
ref|XP_009643520.1|  PREDICTED: importin subunit alpha-6 isoform X1   81.6    3e-14    Egretta garzetta
ref|XP_005820010.1|  hypothetical protein GUITHDRAFT_148189           79.7    3e-14    Guillardia theta CCMP2712
ref|XP_010003142.1|  PREDICTED: importin subunit alpha-6 isoform X2   81.6    3e-14    Chaetura pelagica
gb|KFU84641.1|  Importin subunit alpha-6                              81.6    3e-14    Chaetura pelagica
gb|ABM05487.1|  Impa1                                                 81.6    3e-14    Nicotiana benthamiana
ref|XP_001500078.2|  PREDICTED: importin subunit alpha-7 isoform X1   81.6    3e-14    Equus caballus [domestic horse]
ref|XP_006994430.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.6    3e-14    Peromyscus maniculatus bairdii
ref|XP_006026210.1|  PREDICTED: importin subunit alpha-6 isoform X1   81.3    3e-14    Alligator sinensis
gb|KFO34425.1|  Importin subunit alpha-7                              81.6    3e-14    Fukomys damarensis [Damara mole rat]
ref|XP_005079689.1|  PREDICTED: importin subunit alpha-7              81.6    3e-14    
gb|KFP21239.1|  Importin subunit alpha-6                              81.6    3e-14    Egretta garzetta
gb|KFO76871.1|  Importin subunit alpha-7                              81.6    3e-14    Cuculus canorus
ref|XP_005607308.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.6    3e-14    Equus caballus [domestic horse]
ref|XP_003356325.2|  PREDICTED: importin subunit alpha-7 isoform X1   81.6    3e-14    
ref|XP_010619871.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.6    3e-14    Fukomys damarensis [Damara mole rat]
ref|XP_007170659.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.6    3e-14    Balaenoptera acutorostrata scammoni
ref|XP_005607307.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.6    3e-14    Equus caballus [domestic horse]
ref|XP_008846287.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.6    3e-14    
gb|ELR48730.1|  Importin subunit alpha-7                              81.6    3e-14    Bos mutus
ref|XP_004900261.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.6    3e-14    
ref|XP_010619874.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.6    3e-14    Fukomys damarensis [Damara mole rat]
pdb|4UAD|A  Chain A, Importin Alpha 7 Delta Ibb In Complex With I...  81.3    3e-14    Influenza A virus (A/Victoria/3/1975(H3N2))
ref|XP_004266579.1|  PREDICTED: importin subunit alpha-7 isoform 2    81.6    3e-14    
ref|XP_004425941.1|  PREDICTED: importin subunit alpha-7 isoform 1    81.6    3e-14    
ref|XP_003500689.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    3e-14    Cricetulus griseus [Chinese hamsters]
ref|NP_001069422.1|  importin subunit alpha-7                         81.3    3e-14    Bos taurus [bovine]
ref|XP_010619873.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.6    3e-14    
ref|XP_006176257.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.3    3e-14    
ref|XP_004850892.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...  81.3    3e-14    
ref|XP_007125169.1|  PREDICTED: importin subunit alpha-7              81.3    3e-14    Physeter catodon
ref|XP_005317796.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    3e-14    
tpg|DAA33092.1|  TPA: importin subunit alpha-7                        81.3    3e-14    Bos taurus [bovine]
ref|XP_007663330.1|  PREDICTED: importin subunit alpha-6 isoform X1   81.6    3e-14    
ref|XP_009864307.1|  PREDICTED: importin subunit alpha-6 isoform X2   81.3    3e-14    Apaloderma vittatum
ref|NP_001015029.2|  importin subunit alpha-7                         81.3    3e-14    Rattus norvegicus [brown rat]
ref|XP_004266578.1|  PREDICTED: importin subunit alpha-7 isoform 1    81.3    3e-14    Orcinus orca [Orca]
ref|XP_004005080.1|  PREDICTED: importin subunit alpha-7 isoform 1    81.3    3e-14    
ref|XP_005906256.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    3e-14    Bos mutus
ref|XP_006196983.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.3    3e-14    
ref|XP_004425942.1|  PREDICTED: importin subunit alpha-7 isoform 2    81.3    3e-14    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004266580.1|  PREDICTED: importin subunit alpha-7 isoform 3    81.3    3e-14    Orcinus orca [Orca]
ref|XP_010684628.1|  PREDICTED: importin subunit alpha                81.3    3e-14    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007170657.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    3e-14    Balaenoptera acutorostrata scammoni
ref|XP_004967840.1|  PREDICTED: importin subunit alpha-1a-like        81.3    3e-14    Setaria italica
ref|XP_005665232.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    3e-14    
ref|XP_003769440.1|  PREDICTED: importin subunit alpha-6              81.3    3e-14    
ref|XP_008271998.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.3    4e-14    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004900259.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    
dbj|BAA88950.1|  importin alpha 1b                                    81.3    4e-14    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006026212.1|  PREDICTED: importin subunit alpha-6 isoform X3   81.3    4e-14    
ref|XP_010211331.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    Tinamus guttatus
ref|XP_003801323.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    
ref|XP_009864306.1|  PREDICTED: importin subunit alpha-6 isoform X1   81.3    4e-14    Apaloderma vittatum
ref|XP_009560128.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    Cuculus canorus
ref|XP_004005081.1|  PREDICTED: importin subunit alpha-7 isoform 2    81.3    4e-14    
gb|EEC78554.1|  hypothetical protein OsI_18524                        81.3    4e-14    Oryza sativa Indica Group [Indian rice]
ref|XP_448210.1|  hypothetical protein                                81.3    4e-14    [Candida] glabrata
ref|XP_004178435.1|  hypothetical protein TBLA_0B00730                81.3    4e-14    Tetrapisispora blattae CBS 6284
ref|XP_008271999.1|  PREDICTED: importin subunit alpha-7 isoform X4   81.3    4e-14    Oryctolagus cuniculus [domestic rabbit]
gb|KGL76141.1|  Importin subunit alpha-7                              81.3    4e-14    Tinamus guttatus
ref|XP_008846295.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Nannospalax galili
gb|ELK02023.1|  Importin subunit alpha-7                              81.3    4e-14    Pteropus alecto
ref|XP_007468725.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Lipotes vexillifer [baiji]
ref|XP_005317797.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Ictidomys tridecemlineatus
gb|KFP74630.1|  Importin subunit alpha-6                              81.3    4e-14    Apaloderma vittatum
gb|EFB27376.1|  hypothetical protein PANDA_010861                     81.3    4e-14    Ailuropoda melanoleuca
ref|XP_006026211.1|  PREDICTED: importin subunit alpha-6 isoform X2   81.3    4e-14    
ref|XP_004900260.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    
ref|NP_001054692.1|  Os05g0155500                                     81.3    4e-14    
ref|XP_009914620.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    4e-14    Haliaeetus albicilla
ref|XP_008692699.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Ursus maritimus [white bear]
ref|XP_004591683.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    
ref|XP_006924365.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    Pteropus alecto
ref|XP_006258983.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    4e-14    
ref|XP_004406508.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    
ref|XP_008999056.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Callithrix jacchus [common marmoset]
dbj|BAK62519.1|  importin alpha-7 subunit                             81.3    4e-14    Pan troglodytes
dbj|BAE00657.1|  unnamed protein product                              81.3    4e-14    Macaca fascicularis [crab eating macaque]
ref|XP_008951744.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.3    4e-14    Pan paniscus [bonobo]
ref|XP_003989858.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Felis catus [cat]
dbj|BAE01108.1|  unnamed protein product                              81.3    4e-14    Macaca fascicularis [crab eating macaque]
ref|XP_004678794.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Condylura cristata
ref|XP_004678795.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    
ref|NP_036448.1|  importin subunit alpha-7                            81.3    4e-14    Homo sapiens [man]
ref|XP_009950957.1|  PREDICTED: importin subunit alpha-6 isoform X3   80.9    4e-14    Leptosomus discolor
dbj|BAG63185.1|  unnamed protein product                              81.3    4e-14    Homo sapiens [man]
ref|XP_007538559.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Erinaceus europaeus [common hedgehog]
ref|XP_008999057.1|  PREDICTED: importin subunit alpha-7 isoform X3   81.3    4e-14    Callithrix jacchus [common marmoset]
ref|XP_006734216.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Leptonychotes weddellii
ref|XP_007538558.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Erinaceus europaeus [common hedgehog]
ref|XP_004603617.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Sorex araneus [Eurasian shrew]
ref|XP_004591684.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    
ref|XP_006158180.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Tupaia chinensis
gb|ELW48631.1|  Importin subunit alpha-7                              81.3    4e-14    Tupaia chinensis
ref|XP_004940344.1|  PREDICTED: importin subunit alpha-6 isoform X9   80.9    4e-14    
ref|XP_002720679.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    
ref|XP_003891548.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Papio anubis [baboon]
ref|XP_010352204.1|  PREDICTED: importin subunit alpha-7 isoform X2   81.3    4e-14    Rhinopithecus roxellana
ref|XP_004603616.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Sorex araneus [Eurasian shrew]
ref|XP_008271996.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    
ref|XP_004784121.1|  PREDICTED: importin subunit alpha-7              80.9    4e-14    
ref|XP_009950956.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    4e-14    Leptosomus discolor
ref|XP_005270768.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    Homo sapiens [man]
ref|XP_004740986.1|  PREDICTED: importin subunit alpha-7              81.3    4e-14    
ref|XP_003686153.1|  hypothetical protein TPHA_0F02380                81.3    4e-14    Tetrapisispora phaffii CBS 4417
gb|ERE85411.1|  importin subunit alpha-7 isoform 1                    81.3    4e-14    Cricetulus griseus [Chinese hamsters]
ref|XP_002750602.1|  PREDICTED: importin subunit alpha-7 isoform X1   81.3    4e-14    
ref|XP_011036931.1|  PREDICTED: importin subunit alpha-1 isoform X2   80.9    5e-14    Populus euphratica
ref|XP_011036930.1|  PREDICTED: importin subunit alpha-1 isoform X1   80.9    5e-14    Populus euphratica
gb|KFQ54745.1|  Importin subunit alpha-6                              80.9    5e-14    Nestor notabilis
ref|XP_005646985.1|  importin alpha                                   80.9    5e-14    Coccomyxa subellipsoidea C-169
ref|XP_004471452.1|  PREDICTED: importin subunit alpha-7              80.9    5e-14    
ref|XP_009950955.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Leptosomus discolor
gb|KFZ61448.1|  Importin subunit alpha-6                              80.9    5e-14    Podiceps cristatus
ref|XP_010184359.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Mesitornis unicolor
ref|XP_010018466.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    Nestor notabilis
ref|XP_005016733.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
ref|XP_010208974.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Colius striatus
ref|XP_010074216.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Pterocles gutturalis
ref|XP_010018465.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Nestor notabilis
ref|XP_009489509.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Pelecanus crispus
ref|XP_010208975.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    Colius striatus
ref|XP_009458875.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    Nipponia nippon
ref|XP_009489510.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    Pelecanus crispus
ref|XP_005243786.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
dbj|BAK62408.1|  importin alpha-7 subunit                             80.9    5e-14    Pan troglodytes
ref|XP_419770.2|  PREDICTED: importin subunit alpha-6 isoform X6      80.9    5e-14    
ref|XP_009080895.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Acanthisitta chloris
ref|XP_009895696.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Picoides pubescens
ref|XP_005306412.1|  PREDICTED: importin subunit alpha-6              80.9    5e-14    Chrysemys picta bellii
ref|XP_004940342.1|  PREDICTED: importin subunit alpha-6 isoform X7   80.9    5e-14    
ref|XP_010170106.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Antrostomus carolinensis
ref|XP_009702292.1|  PREDICTED: importin subunit alpha-6              80.9    5e-14    Cariama cristata
ref|XP_009679980.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    Struthio camelus australis
ref|XP_009821810.1|  hypothetical protein H257_00701                  80.9    5e-14    
ref|XP_005243787.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
gb|KFU98483.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_010221210.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
ref|XP_009888788.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
ref|XP_009080896.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
gb|KFP99162.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_009895697.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
ref|XP_009895698.1|  PREDICTED: importin subunit alpha-6 isoform X3   80.9    5e-14    
gb|KFP71375.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_009888789.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
gb|EOB03409.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_004330147.1|  PREDICTED: importin subunit alpha-6-like         79.0    5e-14    
gb|KFQ23404.1|  Importin subunit alpha-6                              80.9    5e-14    
gb|KFZ47836.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_010170107.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
ref|XP_005016734.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
ref|XP_010571722.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
gb|KGL82931.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_009458868.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
gb|KFW87180.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_006258982.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
gb|EMC85980.1|  Importin subunit alpha-6                              80.9    5e-14    
gb|KFV17558.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_005363663.1|  PREDICTED: importin subunit alpha-6              80.9    5e-14    
ref|XP_008929654.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.9    5e-14    
ref|XP_008064949.1|  PREDICTED: importin subunit alpha-7              80.9    5e-14    
ref|XP_010184360.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
ref|XP_010074217.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    5e-14    
gb|KFV84814.1|  Importin subunit alpha-6                              80.9    5e-14    
gb|KFV64990.1|  Importin subunit alpha-6                              80.9    5e-14    
gb|KFQ90854.1|  Importin subunit alpha-6                              80.9    5e-14    
gb|KFP59564.1|  Importin subunit alpha-6                              80.9    5e-14    
ref|XP_010221211.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.5    5e-14    
ref|XP_006842676.1|  hypothetical protein AMTR_s00147p00043750        80.9    6e-14    
gb|KGL97642.1|  Importin subunit alpha-6                              80.9    6e-14    
gb|KFQ55518.1|  Importin subunit alpha-6                              80.9    6e-14    
gb|KFP41647.1|  Importin subunit alpha-6                              80.9    6e-14    
gb|KFP24103.1|  Importin subunit alpha-6                              80.9    6e-14    
ref|XP_009679981.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.5    6e-14    
ref|XP_008929655.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.9    6e-14    
ref|XP_011244136.1|  PREDICTED: importin subunit alpha-5 isoform X2   79.3    6e-14    
ref|XP_002519264.1|  importin alpha, putative                         80.5    6e-14    
ref|XP_001419614.1|  predicted protein                                80.5    6e-14    
ref|XP_004940343.1|  PREDICTED: importin subunit alpha-6 isoform X8   80.9    6e-14    
ref|XP_004230322.1|  PREDICTED: importin subunit alpha-1              80.5    6e-14    
gb|ABB55384.1|  importin alpha 1-like                                 80.1    6e-14    
gb|EDL80567.1|  karyopherin (importin) alpha 6                        78.2    6e-14    
ref|XP_009943154.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.5    6e-14    
ref|XP_011206698.1|  PREDICTED: importin subunit alpha-3              80.5    6e-14    
ref|XP_003955331.1|  hypothetical protein KAFR_0A07620                80.5    6e-14    
ref|XP_009943155.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.5    6e-14    
ref|XP_005518357.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.5    6e-14    
ref|XP_006344784.1|  PREDICTED: importin subunit alpha-1              80.5    7e-14    
ref|XP_005822407.1|  hypothetical protein GUITHDRAFT_79857            80.5    7e-14    
ref|XP_001760522.1|  predicted protein                                80.5    7e-14    
ref|XP_011184988.1|  PREDICTED: importin subunit alpha-3              80.5    7e-14    
gb|KFR03624.1|  Importin subunit alpha-6                              80.5    7e-14    
ref|XP_005518356.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.5    7e-14    
ref|XP_007056828.1|  PREDICTED: importin subunit alpha-6 isoform X3   80.5    7e-14    
emb|CEG62930.1|  hypothetical protein RMATCC62417_00160               79.3    7e-14    
ref|XP_007056827.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.5    7e-14    
ref|XP_008862374.1|  hypothetical protein H310_01121                  80.5    7e-14    
ref|XP_007056826.1|  PREDICTED: importin subunit alpha-6 isoform X1   80.5    7e-14    
ref|XP_003239871.1|  importin alpha                                   80.1    8e-14    
ref|XP_008491046.1|  PREDICTED: importin subunit alpha-7              80.5    8e-14    
ref|XP_004144766.1|  PREDICTED: importin subunit alpha-1-like         80.5    8e-14    
ref|XP_001973388.1|  GG16059                                          80.5    8e-14    
gb|KFP47367.1|  Importin subunit alpha-7                              79.7    8e-14    
gb|KDP23418.1|  hypothetical protein JCGZ_23251                       80.1    8e-14    
ref|XP_004614061.1|  PREDICTED: importin subunit alpha-6              80.5    8e-14    
ref|XP_001763761.1|  predicted protein                                80.1    8e-14    
ref|XP_007954456.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...  80.1    8e-14    
gb|KFP00115.1|  Importin subunit alpha-7                              80.1    8e-14    
dbj|BAK07842.1|  predicted protein                                    78.2    9e-14    
ref|XP_001773628.1|  predicted protein                                80.1    9e-14    
ref|XP_009925144.1|  PREDICTED: importin subunit alpha-7 isoform X1   80.1    9e-14    
ref|XP_005509665.1|  PREDICTED: importin subunit alpha-7 isoform X2   80.1    1e-13    
ref|XP_009330442.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
ref|XP_005020493.1|  PREDICTED: importin subunit alpha-7 isoform X4   80.1    1e-13    
gb|EYU38410.1|  hypothetical protein MIMGU_mgv1a004192mg              80.1    1e-13    
ref|XP_010142506.1|  PREDICTED: importin subunit alpha-7 isoform X1   80.1    1e-13    
ref|XP_005654450.1|  PREDICTED: importin subunit alpha-6 isoform X3   80.1    1e-13    
ref|XP_009998863.1|  PREDICTED: importin subunit alpha-7              80.1    1e-13    
emb|CAD89699.1|  importin alpha 5.1 protein                           80.1    1e-13    
gb|KFO94777.1|  Importin subunit alpha-7                              80.1    1e-13    
gb|KFQ20174.1|  Importin subunit alpha-6                              80.1    1e-13    
ref|XP_010076088.1|  PREDICTED: importin subunit alpha-7              80.1    1e-13    
ref|XP_010024770.1|  PREDICTED: importin subunit alpha-1              79.7    1e-13    
ref|XP_008943715.1|  PREDICTED: importin subunit alpha-6 isoform X2   80.1    1e-13    
gb|EMC82688.1|  Importin subunit alpha-7                              80.1    1e-13    
ref|XP_005020490.1|  PREDICTED: importin subunit alpha-7 isoform X1   80.1    1e-13    
ref|XP_003228760.2|  PREDICTED: importin subunit alpha-7              80.1    1e-13    
ref|XP_004494548.1|  PREDICTED: importin subunit alpha-like           79.7    1e-13    
ref|XP_005141968.1|  PREDICTED: importin subunit alpha-7 isoform X2   80.1    1e-13    
ref|XP_005509664.1|  PREDICTED: importin subunit alpha-7 isoform X1   80.1    1e-13    
ref|XP_009450163.1|  PREDICTED: importin subunit alpha-6 isoform X4   79.7    1e-13    
gb|KFV03609.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_001925247.4|  PREDICTED: importin subunit alpha-6 isoform X1   80.1    1e-13    
ref|XP_005141967.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.7    1e-13    
gb|AES82394.2|  importin subunit alpha-1b                             79.7    1e-13    
ref|XP_010300779.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_004673854.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
ref|XP_009881056.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_009479218.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
gb|EOB00689.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_002714809.2|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_005654449.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
ref|XP_004673853.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_009906721.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_005965064.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
gb|KFP59542.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_008943714.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_009679325.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_005020492.1|  PREDICTED: importin subunit alpha-7 isoform X3   79.7    1e-13    
ref|XP_010191319.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_009957438.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_009646820.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.7    1e-13    
ref|XP_005707794.1|  importin alpha                                   79.7    1e-13    
gb|KFV75068.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|KFV44555.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_010144524.1|  PREDICTED: importin subunit alpha-5-like         77.0    1e-13    
ref|XP_005965063.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_009970296.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_009863004.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_006205749.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
gb|KFP95806.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_006895019.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
gb|KFP74084.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_009814515.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_010963772.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_006879213.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_010142507.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
ref|NP_001084482.1|  importin alpha 5.2 protein                       79.7    1e-13    
ref|XP_007948646.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.7    1e-13    
ref|XP_004372063.1|  PREDICTED: importin subunit alpha-7 isoform 1    79.7    1e-13    
ref|NP_001148537.1|  LOC100282153                                     79.7    1e-13    
gb|KFQ60322.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|KFQ41160.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|KFQ03858.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|KFO10902.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_009646822.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
ref|XP_005239839.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_002095564.1|  GE19625                                          79.7    1e-13    
ref|XP_006193146.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
gb|EYU44000.1|  hypothetical protein MIMGU_mgv1a004419mg              79.7    1e-13    
gb|KFV40758.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_006050671.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_006193145.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_005896921.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
gb|KFV84485.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|EHH53437.1|  hypothetical protein EGM_14077                        79.7    1e-13    
ref|XP_003626176.1|  Importin subunit alpha                           79.7    1e-13    
gb|KFU91827.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_007190809.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
gb|KFM11285.1|  Importin subunit alpha-7                              79.7    1e-13    
gb|EHH18746.1|  hypothetical protein EGK_15410                        79.7    1e-13    
ref|XP_009148181.1|  PREDICTED: importin subunit alpha-1              79.7    1e-13    
emb|CDX93514.1|  BnaA06g05340D                                        79.7    1e-13    
ref|XP_003415506.2|  PREDICTED: importin subunit alpha-7 isoform X1   79.7    1e-13    
ref|XP_010593461.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
gb|ABO21639.1|  importin alpha-like protein                           79.7    1e-13    
ref|XP_005896920.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_009702207.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
ref|XP_007119831.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_010371541.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
gb|KFP10882.1|  Importin subunit alpha-7                              79.7    1e-13    
ref|XP_008565970.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_003566399.1|  PREDICTED: importin subunit alpha-1a             79.7    1e-13    
ref|NP_001234006.1|  importin subunit alpha                           79.7    1e-13    
ref|XP_004372064.1|  PREDICTED: importin subunit alpha-7 isoform 2    79.7    1e-13    
ref|XP_005551718.1|  PREDICTED: importin subunit alpha-6 isoform X3   79.7    1e-13    
ref|XP_006645862.1|  PREDICTED: importin subunit alpha-1b-like        79.7    1e-13    
dbj|BAO39187.1|  importin subunit alpha                               79.7    1e-13    
ref|XP_006205748.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_008005430.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_005551716.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_009702206.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.7    1e-13    
ref|XP_010371540.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_001252156.2|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_003554623.1|  PREDICTED: importin subunit alpha-1-like         79.7    1e-13    
gb|ACF86631.1|  unknown                                               77.0    1e-13    
ref|XP_005684588.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_006862231.1|  PREDICTED: importin subunit alpha-7              79.7    1e-13    
ref|XP_007948647.1|  PREDICTED: importin subunit alpha-7 isoform X2   79.7    1e-13    
ref|XP_009450159.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_005551717.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
ref|XP_003521670.1|  PREDICTED: importin subunit alpha-1-like         79.7    1e-13    
ref|XP_004011225.1|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_009450162.1|  PREDICTED: importin subunit alpha-6 isoform X3   79.7    1e-13    
ref|XP_002746940.2|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_004315192.1|  PREDICTED: importin subunit alpha-1              78.2    1e-13    
ref|XP_002924143.2|  PREDICTED: importin subunit alpha-6              79.7    1e-13    
ref|XP_004665333.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.3    1e-13    
ref|XP_004467218.1|  PREDICTED: importin subunit alpha-1 isoform 3    78.2    1e-13    
ref|XP_008005431.1|  PREDICTED: importin subunit alpha-6 isoform X2   79.7    1e-13    
ref|XP_003781663.1|  PREDICTED: importin subunit alpha-6              79.3    1e-13    
gb|KHN03948.1|  Importin subunit alpha                                79.3    1e-13    
ref|XP_005267021.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.3    1e-13    
pdb|4U2X|D  Chain D, Ebola Virus Vp24 In Complex With Karyopherin...  75.9    1e-13    
ref|XP_006734617.1|  PREDICTED: importin subunit alpha-6              79.3    1e-13    
gb|KDP23371.1|  hypothetical protein JCGZ_23204                       79.3    1e-13    
ref|XP_004740120.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.7    1e-13    
ref|XP_008766936.1|  PREDICTED: importin subunit alpha-5 isoform X2   79.3    1e-13    
ref|XP_008936591.1|  PREDICTED: importin subunit alpha-7              79.3    1e-13    
ref|XP_518711.3|  PREDICTED: importin subunit alpha-6 isoform X2      79.3    1e-13    
ref|XP_003938682.1|  PREDICTED: importin subunit alpha-6              79.3    1e-13    
gb|AAC51868.1|  importin alpha 6                                      79.3    1e-13    
ref|XP_006655009.1|  PREDICTED: importin subunit alpha-1b-like        79.3    1e-13    
ref|XP_008066018.1|  PREDICTED: importin subunit alpha-6              79.3    2e-13    
ref|NP_002260.2|  importin subunit alpha-6                            79.3    2e-13    
ref|XP_002590287.1|  hypothetical protein BRAFLDRAFT_279360           79.3    2e-13    
ref|XP_004398003.1|  PREDICTED: importin subunit alpha-6              79.3    2e-13    
emb|CEG62929.1|  hypothetical protein RMATCC62417_00160               79.3    2e-13    
gb|EFB21424.1|  hypothetical protein PANDA_013420                     79.3    2e-13    
ref|XP_003255663.2|  PREDICTED: importin subunit alpha-6              79.3    2e-13    
ref|NP_001008018.1|  karyopherin alpha 6 (importin alpha 7)           79.3    2e-13    
ref|XP_004642996.1|  PREDICTED: importin subunit alpha-7 isoform X1   79.3    2e-13    
ref|XP_007454989.1|  PREDICTED: importin subunit alpha-6 isoform X1   79.3    2e-13    
ref|XP_007031101.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...  79.3    2e-13    
ref|XP_003275572.1|  PREDICTED: importin subunit alpha-1 isoform 3    77.8    2e-13    



>ref|XP_009608295.1| PREDICTED: importin subunit alpha-2-like [Nicotiana tomentosiformis]
Length=265

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            T ITN VLVAG+EIT   +QA VKCLK EHRILKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  75   THITNVVLVAGHEITGNAVQALVKCLKGEHRILKKEAAWVLSNIAAGSVEHKRLIYSSEA  134

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            +A+LLHLLSTA FDIKKEVAYVLGN+CVAP +GSG P +IL+HLV+LV  GCL+GF+DLV
Sbjct  135  MALLLHLLSTAAFDIKKEVAYVLGNICVAPAEGSGRPNVILDHLVNLVRGGCLTGFLDLV  194

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF+ELVLRGMPN EGPKLVE+EDGIEA+ERYQFHENEELR MANEL+D
Sbjct  195  RSADVEAARLGLQFIELVLRGMPNGEGPKLVEREDGIEAMERYQFHENEELRSMANELVD  254

Query  174  KYYGDEYGLEE  142
            KY+G+EYGL++
Sbjct  255  KYFGEEYGLDD  265



>ref|XP_009783203.1| PREDICTED: importin subunit alpha-2 [Nicotiana sylvestris]
Length=520

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            T ITN VLVAG+EITD  IQA VKCLK EHRILKKEAAWVLSN+AAGS EHK+LI SS+A
Sbjct  330  THITNVVLVAGHEITDNAIQALVKCLKGEHRILKKEAAWVLSNIAAGSVEHKRLIFSSEA  389

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            +A+LLHLLSTA FDIKKEVAYVLGN+CVAP +GSG P +IL+HLV+LV  GCL+GF+DLV
Sbjct  390  MALLLHLLSTAAFDIKKEVAYVLGNICVAPAEGSGRPNVILDHLVNLVRGGCLTGFLDLV  449

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF+ELVLRGMPN EGPKLVE+EDGIEA+ERYQFHENEELR MANEL+D
Sbjct  450  RSADVEAARLGLQFIELVLRGMPNGEGPKLVEREDGIEAMERYQFHENEELRSMANELVD  509

Query  174  KYYGDEYGLEE  142
            KY+G+EYGL+E
Sbjct  510  KYFGEEYGLDE  520



>ref|XP_011077370.1| PREDICTED: importin subunit alpha-2 [Sesamum indicum]
Length=519

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            ITN VLVAG EIT   IQA +KCLKSEHR+LKKE+AWVLSN+AAGS EHKK+IHSS+A++
Sbjct  331  ITNNVLVAGREITVNVIQALIKCLKSEHRVLKKESAWVLSNIAAGSVEHKKIIHSSEAVS  390

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+ LLST PFDI+KEVAYVLGNLCVAP +GSG P LI+EHLVSLVG GCL GF+DLVRS
Sbjct  391  LLMRLLSTGPFDIRKEVAYVLGNLCVAPAEGSGRPNLIVEHLVSLVGGGCLVGFIDLVRS  450

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D EAARLG+QFLELVLRGMPN EG KLVE EDGI+A+ER+QFHENE+LR MANEL+DKY
Sbjct  451  ADTEAARLGLQFLELVLRGMPNGEGQKLVEAEDGIDAMERFQFHENEDLRNMANELVDKY  510

Query  168  YGDEYGLE  145
            +G++YGL+
Sbjct  511  FGEDYGLD  518



>gb|KDP29087.1| hypothetical protein JCGZ_16476 [Jatropha curcas]
Length=518

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -3

Query  702  NAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVL  523
            +AVL+ G EITD  I+  VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A+ +L
Sbjct  332  SAVLLPGREITDNTIEVLVKCLKSEHRVLKKEAAWVLSNIAAGSVEHKRLIYSSEAVPLL  391

Query  522  LHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
            L LLSTAPFDI+KEVAYVLGNLCVAP +G+G P LILEHLVSLVGRGCL GF+D VRSVD
Sbjct  392  LRLLSTAPFDIRKEVAYVLGNLCVAPTEGNGKPGLILEHLVSLVGRGCLPGFIDFVRSVD  451

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRGMPN EGPKLVE+EDGIEA+ER+QFHENE+LR MAN L+D+Y+G
Sbjct  452  TEAARLGLQFMELVLRGMPNGEGPKLVEREDGIEAMERFQFHENEDLRNMANGLVDRYFG  511

Query  162  DEYGLE  145
            ++YGL+
Sbjct  512  EDYGLD  517



>ref|XP_007027272.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY07774.1| Importin alpha isoform 1 [Theobroma cacao]
Length=519

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +  T+ +LV G EITD  I+  VKCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI+SS+A
Sbjct  329  SHTTSTILVPGLEITDGVIKVLVKCLKSEHRVLKKEASWVLSNIAAGSVEHKQLIYSSEA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LLHLLSTAPFDI+KEVAYVLGNLCVAP  G G P LI EHLVSLV RGCLSGF+DLV
Sbjct  389  VPLLLHLLSTAPFDIRKEVAYVLGNLCVAPTGGDGKPNLIQEHLVSLVQRGCLSGFIDLV  448

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF+ELVLRGMP+ EGPKLVE+EDGI+A+ERYQFHENE+LR MAN L+D
Sbjct  449  RSADVEAARLGLQFMELVLRGMPSGEGPKLVEREDGIDAMERYQFHENEDLRNMANGLVD  508

Query  174  KYYGDEYGLEE  142
            KY+G++YG++E
Sbjct  509  KYFGEDYGVDE  519



>ref|XP_002525173.1| Importin alpha-2 subunit, putative [Ricinus communis]
 gb|EEF37139.1| Importin alpha-2 subunit, putative [Ricinus communis]
Length=517

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  702  NAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVL  523
            +AVL+ G EITD+ I   VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI+ S+A+ +L
Sbjct  328  SAVLLPGIEITDSIIAVLVKCLKSEHRVLKKEAAWVLSNIAAGSVEHKQLIYCSEAVPLL  387

Query  522  LHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
            L LLSTAPFD++KEVAYVLGNLCVAP +G+G P LILEHLVSLV RGCL GF+DLVRSVD
Sbjct  388  LRLLSTAPFDLRKEVAYVLGNLCVAPAEGTGKPDLILEHLVSLVSRGCLPGFIDLVRSVD  447

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRGMPN EGPKLVE+E+GIEA+ER+QFHENE+LR MAN L+D+Y+G
Sbjct  448  TEAARLGLQFIELVLRGMPNGEGPKLVEQENGIEAMERFQFHENEDLRNMANGLVDRYFG  507

Query  162  DEYGLEE  142
            ++YGL E
Sbjct  508  EDYGLTE  514



>ref|XP_008449813.1| PREDICTED: importin subunit alpha-2 isoform X2 [Cucumis melo]
Length=455

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +   +A+L+ G+EIT + ++  +KCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI++SDA
Sbjct  265  SHTISAILIPGSEITGSVVEVLIKCLKSEHRVLKKEASWVLSNIAAGSMEHKQLIYTSDA  324

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +L+ LLS+APFD++KEVAYVLGNLCVAP+D  G  KL++E+LVSLVGRGCL GF+DLV
Sbjct  325  VPLLIRLLSSAPFDVRKEVAYVLGNLCVAPNDSDGKAKLLVENLVSLVGRGCLVGFIDLV  384

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RSVD EAARLG QFLE+VLRGMPN EGP+LVE+EDGIEA+ER+QFHENEELR MAN L+D
Sbjct  385  RSVDTEAARLGFQFLEMVLRGMPNGEGPRLVEREDGIEAMERFQFHENEELRNMANCLVD  444

Query  174  KYYGDEYGLEE  142
            KY+G++YGL+E
Sbjct  445  KYFGEDYGLDE  455



>gb|KJB11224.1| hypothetical protein B456_001G248100 [Gossypium raimondii]
Length=519

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +  T+ VL+ G+EITD  I+A VKCLKS+HR+LKKEA+WVLSN+AAGS EHK+LI+SS+A
Sbjct  329  SHTTSTVLIPGHEITDGVIKALVKCLKSDHRVLKKEASWVLSNIAAGSIEHKQLIYSSEA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LL LLSTAPFDI+KEVAYVLGNLCV P  G G P LI EHLVSLV RGCLSGF+DLV
Sbjct  389  VPLLLRLLSTAPFDIRKEVAYVLGNLCVTPTGGDGKPNLIEEHLVSLVQRGCLSGFIDLV  448

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF+ELVLRGMPN +GPKLVE+EDGI+A+ERYQFHENE+LR MAN L+D
Sbjct  449  RSADIEAARLGLQFMELVLRGMPNGDGPKLVEQEDGIDAMERYQFHENEDLRNMANGLVD  508

Query  174  KYYGDEYGLEE  142
            KY+G+ YG++E
Sbjct  509  KYFGENYGIDE  519



>gb|KDO48092.1| hypothetical protein CISIN_1g0096472mg, partial [Citrus sinensis]
 gb|KDO48093.1| hypothetical protein CISIN_1g0096472mg, partial [Citrus sinensis]
Length=203

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  696  VLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLH  517
            VLV G+ ITD  I   VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LIHSS+ALA+LLH
Sbjct  19   VLVPGHGITDQVIAVLVKCLKSEHRVLKKEAAWVLSNIAAGSVEHKQLIHSSEALALLLH  78

Query  516  LLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAE  337
            LLST+PFDIKKEVAYVLGNLCV+P +G G PKLI EHLVSLVGRGCLSGF+DLVRS D E
Sbjct  79   LLSTSPFDIKKEVAYVLGNLCVSPTEGEGKPKLIQEHLVSLVGRGCLSGFIDLVRSADIE  138

Query  336  AARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
            AARLG+QF+ELVLRGMPN EG KLVE+EDGI+A+ER+QFHENE+LR MAN L+DKY+G++
Sbjct  139  AARLGLQFMELVLRGMPNHEGTKLVEREDGIDAMERFQFHENEDLRNMANGLVDKYFGED  198

Query  156  YGLEE  142
            YGL+E
Sbjct  199  YGLDE  203



>ref|XP_011006955.1| PREDICTED: importin subunit alpha-2 [Populus euphratica]
Length=519

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
            AVL+ G EITD  I+A V+CLKSEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A  +LL
Sbjct  334  AVLLPGCEITDNVIEALVRCLKSEHRVLKKEAAWVLSNIAAGSIEHKQLIYSSEAAPLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLSTAPFDI+KEVAYVLGNLCVAP +G G P LI E+LVSLVGRGCL GF+DLVRS D 
Sbjct  394  RLLSTAPFDIRKEVAYVLGNLCVAPTEGDGKPNLISENLVSLVGRGCLPGFIDLVRSADT  453

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENE+LR MAN L+D+Y+G+
Sbjct  454  EAARLGLQFMELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEDLRNMANALVDRYFGE  513

Query  159  EYGLEE  142
            +YGL+E
Sbjct  514  DYGLDE  519



>ref|XP_008449812.1| PREDICTED: importin subunit alpha-2 isoform X1 [Cucumis melo]
Length=517

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +   +A+L+ G+EIT + ++  +KCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI++SDA
Sbjct  327  SHTISAILIPGSEITGSVVEVLIKCLKSEHRVLKKEASWVLSNIAAGSMEHKQLIYTSDA  386

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +L+ LLS+APFD++KEVAYVLGNLCVAP+D  G  KL++E+LVSLVGRGCL GF+DLV
Sbjct  387  VPLLIRLLSSAPFDVRKEVAYVLGNLCVAPNDSDGKAKLLVENLVSLVGRGCLVGFIDLV  446

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RSVD EAARLG QFLE+VLRGMPN EGP+LVE+EDGIEA+ER+QFHENEELR MAN L+D
Sbjct  447  RSVDTEAARLGFQFLEMVLRGMPNGEGPRLVEREDGIEAMERFQFHENEELRNMANCLVD  506

Query  174  KYYGDEYGLEE  142
            KY+G++YGL+E
Sbjct  507  KYFGEDYGLDE  517



>ref|XP_002323457.1| hypothetical protein POPTR_0016s08790g [Populus trichocarpa]
 gb|EEF05218.1| hypothetical protein POPTR_0016s08790g [Populus trichocarpa]
Length=522

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
            AVL+ G EITD  I+  VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI+ S+A  +LL
Sbjct  334  AVLLPGCEITDNVIEVLVKCLKSEHRVLKKEAAWVLSNIAAGSIEHKQLIYYSEAAPLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLSTAPFDI+KEVAYVLGNLCVAP +G G P LI EHLVSLVGRGCL GF+DLVRS D 
Sbjct  394  RLLSTAPFDIRKEVAYVLGNLCVAPTEGDGKPNLISEHLVSLVGRGCLPGFIDLVRSADT  453

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENE+LR +AN L+D+Y+G+
Sbjct  454  EAARLGLQFMELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEDLRNLANALVDRYFGE  513

Query  159  EYGLEE  142
            +YGL+E
Sbjct  514  DYGLDE  519



>gb|KHG28931.1| hypothetical protein F383_14389 [Gossypium arboreum]
Length=519

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +  T+ VL+ G+EITD  I+  VKCLKS+HR+LKKEA+WVLSN+AAGS EHK+LI+SS+A
Sbjct  329  SHTTSTVLIPGHEITDGVIKVLVKCLKSDHRVLKKEASWVLSNIAAGSIEHKRLIYSSEA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LL LLSTAPFDI+KEVAYVLGNLCV P  G G P LI EHLVSLV RGCLSGF+DLV
Sbjct  389  VPLLLRLLSTAPFDIRKEVAYVLGNLCVTPTGGDGKPNLIEEHLVSLVQRGCLSGFIDLV  448

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAAR+G+QF+ELVLRGMPN +GPKLVE+EDGI+A+ERYQFHENE+LR MAN L+D
Sbjct  449  RSADIEAARVGLQFMELVLRGMPNGDGPKLVEQEDGIDAMERYQFHENEDLRNMANGLVD  508

Query  174  KYYGDEYGLEE  142
            KY+G+ YG++E
Sbjct  509  KYFGENYGIDE  519



>ref|XP_002279724.1| PREDICTED: importin subunit alpha-2 [Vitis vinifera]
 emb|CBI32701.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  702  NAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVL  523
              +LV G+E+TD FI A VKCL SEHR+LKKEAAWVLSN+AAGS EHKKLI+SS+A+ +L
Sbjct  331  TCILVVGHEMTDNFIAALVKCLGSEHRVLKKEAAWVLSNIAAGSIEHKKLIYSSEAVPLL  390

Query  522  LHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
            L LLSTAPFDI+KEVAY LGNLCV   +G G P LILEHLVSLVGRGCL GF+DLVRS D
Sbjct  391  LRLLSTAPFDIRKEVAYALGNLCVVSSEGGGKPALILEHLVSLVGRGCLLGFIDLVRSAD  450

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAA+LG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENE+LR MAN L+D Y+G
Sbjct  451  TEAAKLGLQFMELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEDLRNMANGLVDTYFG  510

Query  162  DEYGLEE  142
            +EYGL+E
Sbjct  511  EEYGLDE  517



>ref|XP_004249499.1| PREDICTED: importin subunit alpha-2 [Solanum lycopersicum]
Length=520

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            ITN VLVA + +T   IQA VKCLKSEHRIL KEAAWVLSN+AAGS EHK+LI+SS+A+ 
Sbjct  332  ITNFVLVARHALTGDAIQALVKCLKSEHRILNKEAAWVLSNIAAGSVEHKQLIYSSEAMP  391

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +LL+LLS A FDIKKEVAYVLGN+CVAP +GSG P +IL+HLV+LV  GCL+GF+DLVRS
Sbjct  392  LLLNLLSKAAFDIKKEVAYVLGNICVAPTEGSGRPNVILDHLVNLVRGGCLTGFLDLVRS  451

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D EAARLG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ERYQFHENEELR MANEL+D Y
Sbjct  452  ADVEAARLGLQFIELVLRGMPNGEGPKLVEREDGIDAMERYQFHENEELRSMANELVDSY  511

Query  168  YGDEYGLEE  142
            +G+EYGL+E
Sbjct  512  FGEEYGLDE  520



>ref|XP_010248168.1| PREDICTED: importin subunit alpha-2-like [Nelumbo nucifera]
Length=205

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T+ VL+AG +ITD  I A +KCLKSEHR+LKKEAAWVLSN+AAGS  HK+LIHSS+A
Sbjct  15   SQTTHVVLIAGQDITDNAISALIKCLKSEHRVLKKEAAWVLSNIAAGSLAHKQLIHSSEA  74

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LL LL TAPFDI+KE AY LGNLCVAP +G+G P +ILEHLVSLVGRGCL GF++LV
Sbjct  75   VPLLLRLLLTAPFDIRKEAAYALGNLCVAPMEGAGQPNVILEHLVSLVGRGCLPGFINLV  134

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D +AARLG+QFLELV+RGMPN EGPKLVE+EDGI+A+ER+QFHENE+LR MAN L+D
Sbjct  135  RSADIDAARLGLQFLELVMRGMPNGEGPKLVEREDGIDAMERFQFHENEDLRNMANGLVD  194

Query  174  KYYGDEYGLEE  142
            +Y+G+ YGL++
Sbjct  195  RYFGENYGLDD  205



>ref|XP_009358163.1| PREDICTED: importin subunit alpha-2-like [Pyrus x bretschneideri]
Length=521

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T AV+V G+EIT   I+  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  328  SQTTQAVIVPGHEITGNIIEVLVKCLNSEHRVLKKEAAWVLSNIAAGSVEHKQLIYSSEA  387

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAP---DDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + VLL LLSTAPFDI+KEVAYVLGNLCV+P    +G G P LILEHLVSLVGRGCL+GF+
Sbjct  388  VPVLLRLLSTAPFDIRKEVAYVLGNLCVSPISPTEGDGKPSLILEHLVSLVGRGCLAGFI  447

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV   D EAARLG+QF ELVLRGMPN EGPKLVEKE+GI+A+ER+QFHENE+LR MAN 
Sbjct  448  DLVNLADTEAARLGLQFTELVLRGMPNGEGPKLVEKENGIDAMERFQFHENEDLRNMANS  507

Query  183  LLDKYYGDEYGLEE  142
            L+DKY+G++YGL+E
Sbjct  508  LVDKYFGEDYGLDE  521



>ref|XP_010696399.1| PREDICTED: importin subunit alpha-2 [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            I + + VAGNE+TD  I A VKCL  EHR+LKKEAAWVLSN+AAGS EHK+L++SS+A+ 
Sbjct  330  IASTIFVAGNEVTDNVIAALVKCLGGEHRVLKKEAAWVLSNIAAGSIEHKRLLYSSEAVP  389

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L  LLSTAPFD++KEVAYVLGN+CVAP +GSG   LI+EHLVSL+ RGCL GF++LVRS
Sbjct  390  LLSRLLSTAPFDVRKEVAYVLGNICVAPTEGSGKSSLIVEHLVSLISRGCLPGFIELVRS  449

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D EAARLG+QF+ELVLRGMPN EGPKLVEKEDGIEA+ER+QFHENE+LR MAN L+D Y
Sbjct  450  ADVEAARLGLQFMELVLRGMPNGEGPKLVEKEDGIEAMERFQFHENEDLRNMANGLVDTY  509

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  510  FGEDYGLDE  518



>ref|XP_008239299.1| PREDICTED: importin subunit alpha-2 [Prunus mume]
Length=522

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T+AV+V G+E+T   I+  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS A
Sbjct  329  SQTTHAVIVPGHEVTGNIIEVLVKCLNSEHRVLKKEAAWVLSNIAAGSIEHKRLIYSSAA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAP---DDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + +LL LLSTAPFDI+KEVAYVLGNLCVAP    +G G P LILEHLVSLVGRGCL GF+
Sbjct  389  VPLLLRLLSTAPFDIRKEVAYVLGNLCVAPISPTEGDGKPNLILEHLVSLVGRGCLPGFI  448

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV S D EAARLG+QF ELVLRGMP+ EGPKLVEKE+GIEA+ER+QFHENE+LR MAN 
Sbjct  449  DLVNSADTEAARLGLQFTELVLRGMPHGEGPKLVEKENGIEAMERFQFHENEDLRNMANS  508

Query  183  LLDKYYGDEYGLEE  142
            L+DKY+G++YGL+E
Sbjct  509  LVDKYFGEDYGLDE  522



>gb|KEH42271.1| importin subunit alpha-like protein [Medicago truncatula]
Length=519

 Score =   294 bits (752),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAV  526
            T AVLV G E+TD  +QA +KCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+ L +
Sbjct  332  TYAVLVPGLEVTDTAMQALIKCLNSEHRVLKKEAAWVLSNIAAGSIEHKQLIYSSETLPL  391

Query  525  LLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSV  346
            LLHL S APFDI+KEVAY+LGN+CVAP  G  +P LILEHLVSLV +GCL GF+DLVRS 
Sbjct  392  LLHLFSAAPFDIRKEVAYILGNICVAPTKGDEIPNLILEHLVSLVEKGCLPGFIDLVRSA  451

Query  345  DAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYY  166
            D EAA+LG+QF+ELVLRGMPN +GPKLVE+EDGIEA+ER+QFHENE++R MAN L+DKY+
Sbjct  452  DIEAAKLGLQFIELVLRGMPNGKGPKLVEQEDGIEAMERFQFHENEDVRTMANSLVDKYF  511

Query  165  GDEYGLEE  142
            G++YGL+E
Sbjct  512  GEDYGLDE  519



>ref|XP_007204998.1| hypothetical protein PRUPE_ppa004234mg [Prunus persica]
 gb|EMJ06197.1| hypothetical protein PRUPE_ppa004234mg [Prunus persica]
Length=522

 Score =   294 bits (752),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T+AV+V G+E+T   I+  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  329  SQTTHAVIVPGHEVTGNIIEVLVKCLNSEHRVLKKEAAWVLSNIAAGSIEHKRLIYSSEA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAP---DDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + +LL LLSTAPFDI+KEVAYVLGNLCV+P    +G G P LILEHLVSLVGRGCL GF+
Sbjct  389  VPLLLRLLSTAPFDIRKEVAYVLGNLCVSPISPTEGDGKPNLILEHLVSLVGRGCLPGFI  448

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV S D EAARLG+QF ELVLRGMP+ EGPKLVEKE+GIEA+ER+QFHENE+LR MAN 
Sbjct  449  DLVNSADTEAARLGLQFTELVLRGMPHGEGPKLVEKENGIEAMERFQFHENEDLRNMANS  508

Query  183  LLDKYYGDEYGLEE  142
            L+DKY+G++YGL+E
Sbjct  509  LVDKYFGEDYGLDE  522



>ref|XP_004497474.1| PREDICTED: importin subunit alpha-2-like [Cicer arietinum]
Length=521

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAV  526
            T AVL  G EITD  IQ  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A+ +
Sbjct  333  TYAVLAPGLEITDNAIQVLVKCLSSEHRVLKKEAAWVLSNVAAGSVEHKRLIYSSEAMPL  392

Query  525  LLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSV  346
            LLHLLS APFDI+KEVAYVLGNLCVAP   +  P +ILEHLVSLVG+GCL GF+DLVRS 
Sbjct  393  LLHLLSAAPFDIRKEVAYVLGNLCVAPSKDNEKPSVILEHLVSLVGKGCLPGFIDLVRSA  452

Query  345  DAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYY  166
            D EAARLG+QFLELVLRG+PN +GP LVE+EDGIEA+ER+QFHENEE+R MAN L+DKY+
Sbjct  453  DIEAARLGLQFLELVLRGIPNGKGPNLVEQEDGIEAMERFQFHENEEVRTMANSLVDKYF  512

Query  165  GDEYGLEE  142
            G+ YGL+E
Sbjct  513  GENYGLDE  520



>ref|XP_004304406.1| PREDICTED: importin subunit alpha-9 [Fragaria vesca subsp. vesca]
Length=521

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T+A++V GN+IT   I+  VKCL+ EHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  328  SQTTHAIIVPGNDITGNIIEVLVKCLRGEHRVLKKEAAWVLSNIAAGSIEHKQLIYSSEA  387

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAP---DDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + +L+ LLSTAPFDI+KEVAYVLGNLCV+P    +G G P LILEHLVSLVGRGCL GF+
Sbjct  388  VPLLIRLLSTAPFDIRKEVAYVLGNLCVSPITPTEGDGKPTLILEHLVSLVGRGCLPGFI  447

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV SVD EAAR+G+QF+ELVLRGMPN EGPKLVE E+GIEA+ER+QFHENE+LR MAN 
Sbjct  448  DLVSSVDTEAARVGLQFMELVLRGMPNGEGPKLVENENGIEAMERFQFHENEDLRNMANT  507

Query  183  LLDKYYGDEYGLEE  142
            L+DKY+G++YGL++
Sbjct  508  LVDKYFGEDYGLDD  521



>ref|XP_008793530.1| PREDICTED: importin subunit alpha-2 [Phoenix dactylifera]
Length=520

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            IT+AVL+ G+ ITD  +   +KCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI SS A  
Sbjct  332  ITDAVLIVGHNITDQVLSGLMKCLKSEHRVLKKEAAWVLSNIAAGSFEHKELIFSSQATP  391

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLLS+APFDI+KEVAYVLGNLCVAP +G+G P +IL HLV+LV  GCL GF++LVRS
Sbjct  392  LLVHLLSSAPFDIRKEVAYVLGNLCVAPAEGAGQPSIILRHLVALVNHGCLPGFINLVRS  451

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENEE+R MAN L+DKY
Sbjct  452  ADIESARLGLQFLELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEEMRNMANGLVDKY  511

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  512  FGEDYGLDE  520



>ref|XP_006339060.1| PREDICTED: importin subunit alpha-2-like [Solanum tuberosum]
Length=520

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            ITN VLV  + +T   IQA VKCLKSEHRIL KEAAWVLSN+AAGS EHK+LI+SS+A+ 
Sbjct  332  ITNFVLVVRHALTGDAIQALVKCLKSEHRILNKEAAWVLSNIAAGSVEHKRLIYSSEAMP  391

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +LL+LLS A FDIKKEVAYVLGN+CVAP +GSG P +IL+HLV+LV  GCL+GF+DLVRS
Sbjct  392  LLLNLLSKAAFDIKKEVAYVLGNICVAPAEGSGRPNVILDHLVNLVHGGCLTGFLDLVRS  451

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D EAARLG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ERYQFHENEELR MANEL+D Y
Sbjct  452  ADVEAARLGLQFIELVLRGMPNGEGPKLVEREDGIDAMERYQFHENEELRSMANELVDSY  511

Query  168  YGDEYGLEE  142
            +G+EYGL+E
Sbjct  512  FGEEYGLDE  520



>ref|XP_009342579.1| PREDICTED: importin subunit alpha-2-like [Pyrus x bretschneideri]
Length=521

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T A++V  +EIT   I+  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SSDA
Sbjct  328  SQTTQALIVPAHEITGNIIEVLVKCLNSEHRVLKKEAAWVLSNIAAGSVEHKQLIYSSDA  387

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCV---APDDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + VLL LLSTAPFDI+KEVAYVLGNLCV   +P +  G P  ILEHLVSLVGRGCL+GF+
Sbjct  388  VPVLLRLLSTAPFDIRKEVAYVLGNLCVLPISPTECDGKPNFILEHLVSLVGRGCLAGFI  447

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV S D EAARLG+QF ELVLRGMPN EGPKLVEKE+GIEA+ER+QFHENE+LR MAN 
Sbjct  448  DLVNSADIEAARLGLQFTELVLRGMPNGEGPKLVEKENGIEAMERFQFHENEDLRNMANS  507

Query  183  LLDKYYGDEYGLEE  142
            L+DKY+G++YGL+E
Sbjct  508  LMDKYFGEDYGLDE  521



>gb|EYU38519.1| hypothetical protein MIMGU_mgv1a004564mg [Erythranthe guttata]
Length=520

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            + +T+ +LV GNEIT   IQA +KCL+SEHR+LKKE++WVLSN+AAGS EHKK+I+SS+ 
Sbjct  330  SHVTSHILVPGNEITVNAIQAMIKCLESEHRVLKKESSWVLSNIAAGSIEHKKMIYSSEV  389

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            +++L+ LLSTAPFDI+KEVAYVLGNLCVAP +GSG P LI EHL+SLVG+GCL+GFVDLV
Sbjct  390  VSLLVRLLSTAPFDIRKEVAYVLGNLCVAPAEGSGRPTLITEHLISLVGKGCLAGFVDLV  449

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS+D EAAR+G+QF+ELVLRGMPN EG KLVE EDGI+A+ER+QFHENEELR MANEL+D
Sbjct  450  RSIDTEAARVGLQFIELVLRGMPNGEGVKLVEAEDGIDAMERFQFHENEELRTMANELVD  509

Query  174  KYYGDEYGLE  145
             Y+G  Y L+
Sbjct  510  VYFGVNYRLD  519



>ref|XP_004142168.1| PREDICTED: importin subunit alpha-2-like [Cucumis sativus]
Length=518

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  702  NAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVL  523
            +A+L+ G+EIT + ++  +KCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI++SD + +L
Sbjct  332  SAILIPGSEITGSVLEVLIKCLKSEHRVLKKEASWVLSNIAAGSMEHKQLIYTSDVVPLL  391

Query  522  LHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
            + LLS+APFD++KEVAYVLGNLCVAP+D  G  KL++E+LVSLVGRGCL GF+DLVRS D
Sbjct  392  IRLLSSAPFDVRKEVAYVLGNLCVAPNDSDGKAKLLVENLVSLVGRGCLVGFIDLVRSAD  451

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG QFLE+VLRGMPN +GP+LVE+EDGIEA+ER+QFHENEELR MAN L+DKY+G
Sbjct  452  TEAARLGFQFLEMVLRGMPNGDGPRLVEREDGIEAMERFQFHENEELRNMANCLVDKYFG  511

Query  162  DEYGLEE  142
            ++YGL+E
Sbjct  512  EDYGLDE  518



>ref|XP_004162005.1| PREDICTED: importin subunit alpha-2-like [Cucumis sativus]
 gb|KGN54069.1| hypothetical protein Csa_4G280460 [Cucumis sativus]
Length=522

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  702  NAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVL  523
            +A+L+ G+EIT + ++  +KCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI++SD + +L
Sbjct  336  SAILIPGSEITGSVLEVLIKCLKSEHRVLKKEASWVLSNIAAGSMEHKQLIYTSDVVPLL  395

Query  522  LHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
            + LLS+APFD++KEVAYVLGNLCVAP+D  G  KL++E+LVSLVGRGCL GF+DLVRS D
Sbjct  396  IRLLSSAPFDVRKEVAYVLGNLCVAPNDSDGKAKLLVENLVSLVGRGCLVGFIDLVRSAD  455

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG QFLE+VLRGMPN +GP+LVE+EDGIEA+ER+QFHENEELR MAN L+DKY+G
Sbjct  456  TEAARLGFQFLEMVLRGMPNGDGPRLVEREDGIEAMERFQFHENEELRNMANCLVDKYFG  515

Query  162  DEYGLEE  142
            ++YGL+E
Sbjct  516  EDYGLDE  522



>ref|XP_008387624.1| PREDICTED: importin subunit alpha-2-like [Malus domestica]
 ref|XP_008359653.1| PREDICTED: importin subunit alpha-2-like [Malus domestica]
Length=521

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T A++V G+EIT   I+  VKCL SEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  328  SQTTQALIVPGHEITGNIIEVLVKCLNSEHRVLKKEAAWVLSNIAAGSVEHKQLIYSSEA  387

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCV---APDDGSGMPKLILEHLVSLVGRGCLSGFV  364
            + VLL LLSTAPFDI+KEVAYVLGNLCV   +P +  G P  ILEHLVSLVGRGCL+GF+
Sbjct  388  VLVLLRLLSTAPFDIRKEVAYVLGNLCVLPISPTERDGKPNFILEHLVSLVGRGCLAGFI  447

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            DLV S D EAARLG+QF ELVLRGMPN EGPKLVEKE+GIEA+ER+QFHENE+LR MAN 
Sbjct  448  DLVNSADTEAARLGLQFTELVLRGMPNGEGPKLVEKENGIEAMERFQFHENEDLRNMANS  507

Query  183  LLDKYYGDEYGLEE  142
            L+D Y+G++YGL+E
Sbjct  508  LVDTYFGEDYGLDE  521



>ref|XP_010920896.1| PREDICTED: importin subunit alpha-2 isoform X2 [Elaeis guineensis]
Length=496

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            IT+AVL+ G++ITD  +   VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI SS+A  
Sbjct  308  ITDAVLIVGHDITDQVLSGLVKCLKSEHRVLKKEAAWVLSNIAAGSFEHKELIFSSEASP  367

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL +APFDI+KEVAYVLGNLCVAP  G+G P +IL HLV+LV  GCL GF++LVRS
Sbjct  368  LLMHLLLSAPFDIRKEVAYVLGNLCVAPAKGAGQPSIILRHLVTLVNHGCLPGFINLVRS  427

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+A+LG+QFLELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENEE+R MAN L+DKY
Sbjct  428  ADIESAKLGLQFLELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEEMRNMANGLVDKY  487

Query  168  YGDEYGLEE  142
            +G++YG++E
Sbjct  488  FGEDYGVDE  496



>ref|XP_006428837.1| hypothetical protein CICLE_v10011496mg [Citrus clementina]
 ref|XP_006480649.1| PREDICTED: importin subunit alpha-2-like [Citrus sinensis]
 gb|ESR42077.1| hypothetical protein CICLE_v10011496mg [Citrus clementina]
Length=518

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  696  VLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLH  517
            VLV G+ ITD  I   VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LIHSS+ALA+LLH
Sbjct  334  VLVPGHGITDQVIAVLVKCLKSEHRVLKKEAAWVLSNIAAGSVEHKQLIHSSEALALLLH  393

Query  516  LLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAE  337
            LLST+PFDIKKEVAYVLGNLCV+P +G G PKLI EHLVSLVGRGCLSGF+DLVRS D E
Sbjct  394  LLSTSPFDIKKEVAYVLGNLCVSPTEGEGKPKLIQEHLVSLVGRGCLSGFIDLVRSADIE  453

Query  336  AARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
            AARLG+QF+ELVLRGMPN EG KLVE+EDGI+A+ER+QFHENE+LR MAN L+DKY+G++
Sbjct  454  AARLGLQFMELVLRGMPNHEGTKLVEREDGIDAMERFQFHENEDLRNMANGLVDKYFGED  513

Query  156  YGLEE  142
            YGL+E
Sbjct  514  YGLDE  518



>ref|XP_010920895.1| PREDICTED: importin subunit alpha-2 isoform X1 [Elaeis guineensis]
Length=523

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            IT+AVL+ G++ITD  +   VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI SS+A  
Sbjct  335  ITDAVLIVGHDITDQVLSGLVKCLKSEHRVLKKEAAWVLSNIAAGSFEHKELIFSSEASP  394

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL +APFDI+KEVAYVLGNLCVAP  G+G P +IL HLV+LV  GCL GF++LVRS
Sbjct  395  LLMHLLLSAPFDIRKEVAYVLGNLCVAPAKGAGQPSIILRHLVTLVNHGCLPGFINLVRS  454

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+A+LG+QFLELVLRGMPN EGPKLVE+EDGI+A+ER+QFHENEE+R MAN L+DKY
Sbjct  455  ADIESAKLGLQFLELVLRGMPNGEGPKLVEREDGIDAMERFQFHENEEMRNMANGLVDKY  514

Query  168  YGDEYGLEE  142
            +G++YG++E
Sbjct  515  FGEDYGVDE  523



>ref|XP_010543379.1| PREDICTED: importin subunit alpha-2 [Tarenaya hassleriana]
Length=517

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            ++ T+A++V   E TD  I   VKCLKSEHR+LKKEAAWVLSN+AAGS EHKK+IHSS+A
Sbjct  327  SQTTSAIIVPAQETTDNIIGVLVKCLKSEHRVLKKEAAWVLSNIAAGSIEHKKMIHSSEA  386

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
              +LL LLSTAPFD++KE AY LGNLCV P +G+  P L+ EHLVSLV  GCL+G++DLV
Sbjct  387  TPLLLRLLSTAPFDVRKEAAYALGNLCVGPAEGNTKPTLLQEHLVSLVRGGCLTGYIDLV  446

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF+ELVLRG+PN EGPKLVE+EDGI+A+ER+QFHENEELR MAN L+D
Sbjct  447  RSADIEAARLGLQFIELVLRGIPNGEGPKLVEREDGIDAMERFQFHENEELRVMANSLVD  506

Query  174  KYYGDEYGLEE  142
            +Y+G++YG+EE
Sbjct  507  RYFGEDYGIEE  517



>ref|XP_007144541.1| hypothetical protein PHAVU_007G164500g [Phaseolus vulgaris]
 gb|ESW16535.1| hypothetical protein PHAVU_007G164500g [Phaseolus vulgaris]
Length=519

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +R  NAVL+ G EI    I   VKCL  ++R+LKKEAAWVLSN+AAGS EHK+LI+SS+ 
Sbjct  329  SRAINAVLIPGREIAGNAIDVLVKCLNCQNRVLKKEAAWVLSNIAAGSVEHKQLIYSSET  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LL LLS APFDI+KEVAYVLGNLCVAP  G G P LI+EH+VSLV +GCL GF+DL+
Sbjct  389  VPLLLQLLSAAPFDIRKEVAYVLGNLCVAPTKGDGNPSLIVEHMVSLVEKGCLPGFIDLI  448

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QF ELVLRGMPN EGPKLVE+EDGIEA+ER+QFHENE+LR MAN L+D
Sbjct  449  RSADTEAARLGLQFTELVLRGMPNGEGPKLVEQEDGIEAMERFQFHENEDLRTMANTLVD  508

Query  174  KYYGDEYGLE  145
            KY+G++YGL+
Sbjct  509  KYFGEDYGLD  518



>emb|CDP06714.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + + VLV G  ITD+ + A +KCL+SEHR+LKKEAAWVLSN+AAGS EHKKL+++S+A+ 
Sbjct  348  VASTVLVIGQSITDSILPALIKCLESEHRVLKKEAAWVLSNIAAGSVEHKKLVYASEAVP  407

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +LL LL TAPFDI+KEVAYV+GNLCVAP +GSG PKLI +HLV LV +GCL GF+DLVRS
Sbjct  408  LLLRLLVTAPFDIRKEVAYVIGNLCVAPSEGSGRPKLIADHLVFLVSKGCLPGFIDLVRS  467

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D EAA+LG+QF+ELVLRGMP+  GPKLVEK DGI+A+ER+QFHENEELR MA +L+DKY
Sbjct  468  ADVEAAKLGLQFIELVLRGMPSGSGPKLVEKADGIDAMERFQFHENEELRCMATKLVDKY  527

Query  168  YGDEYGLEE  142
            +G +YG+++
Sbjct  528  FGVDYGVDD  536



>emb|CAN61727.1| hypothetical protein VITISV_032422 [Vitis vinifera]
Length=530

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = -3

Query  693  LVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL  514
            LV G+E+T A     VKCL SEHR+LKKEAAWVLSN+AAGS EHKKLI+SS+A+ +LL L
Sbjct  351  LVVGHEMTAAL----VKCLGSEHRVLKKEAAWVLSNIAAGSIEHKKLIYSSEAVPLLLRL  406

Query  513  LSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEA  334
            LSTAPFDI+KEVAY LGNLCV   +G G P LILEHLVSLVGRGCL GF+DLVRS D EA
Sbjct  407  LSTAPFDIRKEVAYALGNLCVVSSEGGGKPALILEHLVSLVGRGCLPGFIDLVRSADTEA  466

Query  333  ARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEY  154
            A+LG+QF+ELVLRGMPN EGPKLVE+EDGI+A+ER+QFHEN +LR MAN L+D Y+G+EY
Sbjct  467  AKLGLQFMELVLRGMPNGEGPKLVEREDGIDAMERFQFHENXDLRNMANGLVDTYFGEEY  526

Query  153  GLEE  142
            GL+E
Sbjct  527  GLDE  530



>ref|XP_003542502.1| PREDICTED: importin subunit alpha-2-like isoformX1 [Glycine max]
Length=517

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  690  VAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLL  511
            + G  ITD  IQ  VKCL  E+R+LKKEA+WVLSN+AAGS EHK+LI+SS+A+ VLL L 
Sbjct  335  IPGLGITDNVIQVLVKCLNCENRVLKKEASWVLSNIAAGSVEHKQLIYSSEAVPVLLRLF  394

Query  510  STAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAA  331
            S APFDI+KEVAYVLGNLCV+P  G   P LILEHLVSLV +GCL GF+DLVRS D EAA
Sbjct  395  SAAPFDIRKEVAYVLGNLCVSPTKGDDKPSLILEHLVSLVEKGCLPGFIDLVRSADIEAA  454

Query  330  RLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEYG  151
            RLG+QF+ELVLRGMPN +GPKLVE+EDGIEA+ER+QFHENE+LR MAN L+DKY+G++YG
Sbjct  455  RLGLQFIELVLRGMPNGKGPKLVEQEDGIEAMERFQFHENEDLRTMANTLVDKYFGEDYG  514

Query  150  LEE  142
            L+E
Sbjct  515  LDE  517



>ref|XP_010037940.1| PREDICTED: importin subunit alpha-2 [Eucalyptus grandis]
 gb|KCW49716.1| hypothetical protein EUGRSUZ_K03215 [Eucalyptus grandis]
Length=530

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            T  T+ +L+ G+E+TD  ++  VKCLKSEHR+LKKEAAWVLSN+AAGS EHK+LI+SS+A
Sbjct  337  TNTTHTLLLPGSEVTDGVVKVVVKCLKSEHRVLKKEAAWVLSNIAAGSVEHKRLIYSSEA  396

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            L  L+ L+S+APFD++KEVAYVLGNLCV P +G   P LI EHLVSLVG GCLSGF+DLV
Sbjct  397  LPWLIRLVSSAPFDVRKEVAYVLGNLCVGPTEGDARPYLIQEHLVSLVGGGCLSGFIDLV  456

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAAR+G+QF+ELVLRGMPN EG KLVE+EDGIEA+ER+QFHENE+LR MAN L+D
Sbjct  457  RSADIEAARVGLQFIELVLRGMPNGEGLKLVEREDGIEAMERFQFHENEDLRNMANGLVD  516

Query  174  KYYGDEYGLEE  142
            KY+G++YG +E
Sbjct  517  KYFGEDYGDDE  527



>ref|XP_003542503.1| PREDICTED: importin subunit alpha-2-like isoformX2 [Glycine max]
Length=522

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  675  ITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPF  496
             +D  IQ  VKCL  E+R+LKKEA+WVLSN+AAGS EHK+LI+SS+A+ VLL L S APF
Sbjct  345  FSDNVIQVLVKCLNCENRVLKKEASWVLSNIAAGSVEHKQLIYSSEAVPVLLRLFSAAPF  404

Query  495  DIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQ  316
            DI+KEVAYVLGNLCV+P  G   P LILEHLVSLV +GCL GF+DLVRS D EAARLG+Q
Sbjct  405  DIRKEVAYVLGNLCVSPTKGDDKPSLILEHLVSLVEKGCLPGFIDLVRSADIEAARLGLQ  464

Query  315  FLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
            F+ELVLRGMPN +GPKLVE+EDGIEA+ER+QFHENE+LR MAN L+DKY+G++YGL+E
Sbjct  465  FIELVLRGMPNGKGPKLVEQEDGIEAMERFQFHENEDLRTMANTLVDKYFGEDYGLDE  522



>emb|CDX70330.1| BnaA10g26790D [Brassica napus]
Length=261

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+ G    ++ I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++A+ +L+
Sbjct  76   TILIGGKNTEESVIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEAMPLLI  135

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLST+PFDI+KEVAYVLGNLCV   +G   P++I EHLVS+V  GCL GF++LVRS D 
Sbjct  136  GLLSTSPFDIRKEVAYVLGNLCVESAEGDTKPRIIQEHLVSIVSGGCLPGFINLVRSPDI  195

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPNREG K+VE EDGI+A+ER+QFHENEELR MAN L+DKY+G+
Sbjct  196  EAARLGLQFIELVLRGMPNREGSKIVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGE  255

Query  159  EYGLEE  142
            +YG+ E
Sbjct  256  DYGINE  261



>ref|XP_009125477.1| PREDICTED: importin subunit alpha-2-like [Brassica rapa]
Length=521

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +LV G    +  I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHSS+A+ +LL
Sbjct  335  TILVGGQNTEENVINVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSSEAMPLLL  394

Query  519  HLLSTAPFDIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
             LLST+PFDIKKEVAYVLGNLCV + + G   P++I EHLVS+V  GCL GF+DLVRS D
Sbjct  395  RLLSTSPFDIKKEVAYVLGNLCVESAEGGDARPRIIQEHLVSIVSGGCLRGFIDLVRSPD  454

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G
Sbjct  455  IEAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFG  514

Query  162  DEYGLEE  142
            ++YG++E
Sbjct  515  EDYGIDE  521



>emb|CDY55698.1| BnaC02g03390D [Brassica napus]
Length=520

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+ G    +  I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHSS+A+ +LL
Sbjct  335  TILIGGQNTEENAINVLGKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRVIHSSEAMPLLL  394

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLST+PFDIKKEVAYVLGNLCV   +G   P++I EHLVS+V  GCL GF+DLVRS D 
Sbjct  395  RLLSTSPFDIKKEVAYVLGNLCVESAEGDARPRIIQEHLVSIVSGGCLRGFIDLVRSPDI  454

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G+
Sbjct  455  EAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGE  514

Query  159  EYGLEE  142
            +YG+ E
Sbjct  515  DYGINE  520



>ref|XP_009421388.1| PREDICTED: importin subunit alpha-2 [Musa acuminata subsp. malaccensis]
Length=521

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            +T+ VLV G+  TD  +   +KCLKSEHR+LKKEAAWVLSN+AAGS  HK+LI SS+A  
Sbjct  333  MTDMVLVVGHNTTDQILLGLIKCLKSEHRVLKKEAAWVLSNIAAGSVGHKELIFSSEATP  392

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +++HLLS+APFDI+KEVAY LGNLCVAP   +  P +I+ HLV+LV R C+S F+ LVRS
Sbjct  393  LMIHLLSSAPFDIRKEVAYTLGNLCVAPAKNAEQPSIIVHHLVALVNRECISAFIHLVRS  452

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D ++A+LG+QFLELV+RGMPN EGPKLVE+EDGI+A+ER+QFHENEE+R MAN L+DKY
Sbjct  453  ADIQSAKLGLQFLELVMRGMPNGEGPKLVEREDGIDAMERFQFHENEEMRNMANGLVDKY  512

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  513  FGEDYGLDE  521



>gb|KFK24759.1| hypothetical protein AALP_AA8G021400 [Arabis alpina]
Length=519

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -3

Query  693  LVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL  514
            L+ G    D+ I    KCL+SEHR+LKKEAAWVLSN+A GS EHKK+IHS++A+ +LL L
Sbjct  336  LIRGQNTKDSVIGVLAKCLRSEHRVLKKEAAWVLSNIATGSVEHKKMIHSTEAMPLLLRL  395

Query  513  LSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEA  334
            LST+PFDI++EVAYVLGNLCV   +G   P++I EHLVS+V  GCLSGF+DLVRS D EA
Sbjct  396  LSTSPFDIRREVAYVLGNLCVESVEGDTKPRIIQEHLVSIVRAGCLSGFIDLVRSPDIEA  455

Query  333  ARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEY  154
            ARLG+QF+ELVLRGMPN EGPKLVE  DGI+A+ER+QFHENEELR MAN L+DKY+G++Y
Sbjct  456  ARLGLQFIELVLRGMPNGEGPKLVEGGDGIDAMERFQFHENEELRVMANSLVDKYFGEDY  515

Query  153  GLEE  142
            G++E
Sbjct  516  GIDE  519



>emb|CDY04878.1| BnaAnng00600D [Brassica napus]
Length=521

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +LV G    +  I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHSS+A+ +LL
Sbjct  335  TILVGGQNTEENIINVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSSEAMPLLL  394

Query  519  HLLSTAPFDIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
             LLST+PFDIKKEVAYVLGNLCV + + G   P++I EHLVS+V  GCL GF+DLVRS D
Sbjct  395  RLLSTSPFDIKKEVAYVLGNLCVESAEGGDARPRIIQEHLVSIVSGGCLRGFIDLVRSPD  454

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRGMPN EG KLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G
Sbjct  455  IEAARLGLQFIELVLRGMPNGEGSKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFG  514

Query  162  DEYGLEE  142
            ++YG++E
Sbjct  515  EDYGIDE  521



>ref|XP_006398757.1| hypothetical protein EUTSA_v10013263mg [Eutrema salsugineum]
 gb|ESQ40210.1| hypothetical protein EUTSA_v10013263mg [Eutrema salsugineum]
Length=519

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+ G+   ++ I    KCL+SEHR+LKKEAAWVLSN+AAGS EHKKLIHS++A+ +LL
Sbjct  334  TILIRGHNTEESVICVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKKLIHSTEAMPLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLST+PFDI+KEVAYVLGNLCV   +G    ++I EHLVS+V  GCL GF++LVRS D 
Sbjct  394  RLLSTSPFDIRKEVAYVLGNLCVESAEGDTKARIIQEHLVSIVSGGCLRGFIELVRSPDM  453

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G+
Sbjct  454  EAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGE  513

Query  159  EYGLEE  142
             YG++E
Sbjct  514  NYGIDE  519



>emb|CAB86074.1| importin alpha-like protein [Arabidopsis thaliana]
Length=483

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  672  TDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFD  493
            T + +Q  + CL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ + +LL +LST+PFD
Sbjct  307  TSSSLQLLIPCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMPLLLRILSTSPFD  366

Query  492  IKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQF  313
            I+KEVAYVLGNLCV   +G   P++I EHLVS+V  GCL GF++LVRS D EAARLG+QF
Sbjct  367  IRKEVAYVLGNLCVESAEGDRKPRIIQEHLVSIVSGGCLRGFIELVRSPDIEAARLGLQF  426

Query  312  LELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
            +ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G++YG++E
Sbjct  427  IELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGEDYGIDE  483



>ref|NP_195927.2| importin alpha isoform 9 [Arabidopsis thaliana]
 sp|F4KF65.1|IMPA9_ARATH RecName: Full=Importin subunit alpha-9; Short=IMPa-9 [Arabidopsis 
thaliana]
 gb|AED90553.1| importin alpha isoform 9 [Arabidopsis thaliana]
Length=519

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+      ++ I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ + +LL
Sbjct  334  TILIREQNTEESIIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMPLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             +LST+PFDI+KEVAYVLGNLCV   +G   P++I EHLVS+V  GCL GF++LVRS D 
Sbjct  394  RILSTSPFDIRKEVAYVLGNLCVESAEGDRKPRIIQEHLVSIVSGGCLRGFIELVRSPDI  453

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G+
Sbjct  454  EAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGE  513

Query  159  EYGLEE  142
            +YG++E
Sbjct  514  DYGIDE  519



>ref|XP_010107576.1| Importin subunit alpha-2 [Morus notabilis]
 gb|EXC16258.1| Importin subunit alpha-2 [Morus notabilis]
Length=475

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  633  SEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLC  454
            S  ++L  EAAWVLSN+AAGS EHK+LI+SS+A+ +LL LLSTAPFDI+KEVAYVLGNLC
Sbjct  312  SSLQLLIPEAAWVLSNIAAGSIEHKQLIYSSEAVPLLLRLLSTAPFDIRKEVAYVLGNLC  371

Query  453  VAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREG  274
            VAP    G P LILEHLVSLVGRGCLSGF+DLVRS D EAARLG+QF+ELVLRGMPN EG
Sbjct  372  VAPTGSDGKPNLILEHLVSLVGRGCLSGFIDLVRSADIEAARLGLQFMELVLRGMPNGEG  431

Query  273  PKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
            PKLVE EDGI+A+ER+QFHENE+LR MAN L+DKY+G+EYGL+E
Sbjct  432  PKLVEHEDGIDAMERFQFHENEDLRNMANGLVDKYFGEEYGLDE  475



>ref|XP_002873075.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49334.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+      ++ I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ + +LL
Sbjct  334  TILIREQNTEESIIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMPLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLST+PFDI+KEVAYVLGNLCV   +G   P +I EHLVS+V  GCL GF++LVRS D 
Sbjct  394  RLLSTSPFDIRKEVAYVLGNLCVESAEGDRKPGIIQEHLVSIVRGGCLPGFIELVRSPDI  453

Query  339  EAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G+
Sbjct  454  EAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFGE  513

Query  159  EYGLEE  142
            +YG++E
Sbjct  514  DYGIDE  519



>ref|XP_006594124.1| PREDICTED: importin subunit alpha-2-like isoform X3 [Glycine 
max]
Length=510

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  690  VAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLL  511
            + G  ITD  IQ  VKCL  E+R+LKKEA+WVLSN+AAGS EHK+LI+SS+A+ VLL L 
Sbjct  335  IPGLGITDNVIQVLVKCLNCENRVLKKEASWVLSNIAAGSVEHKQLIYSSEAVPVLLRLF  394

Query  510  STAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAA  331
            S APFDI+KEVAYVLGNLCV+P  G   P LILEHLVSLV +GCL GF+DLVRS D EAA
Sbjct  395  SAAPFDIRKEVAYVLGNLCVSPTKGDDKPSLILEHLVSLVEKGCLPGFIDLVRSADIEAA  454

Query  330  RLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RLG+QF+ELVLRGMPN +GPKLVE+EDGIEA+ER+QFHENE+LR MAN L+D
Sbjct  455  RLGLQFIELVLRGMPNGKGPKLVEQEDGIEAMERFQFHENEDLRTMANTLVD  506



>ref|XP_006836482.1| hypothetical protein AMTR_s00108p00104150, partial [Amborella 
trichopoda]
 gb|ERM99335.1| hypothetical protein AMTR_s00108p00104150, partial [Amborella 
trichopoda]
Length=532

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            + + + VL AG   TD  + A VKCL S+HR+LKKEAAWVLSN+AAGS  HK+LI+ SDA
Sbjct  340  SHVADEVLAAGYGTTDNVMGALVKCLSSDHRVLKKEAAWVLSNIAAGSLAHKQLIYFSDA  399

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            L +LLHLLSTAPFDI+KEVAY LGN+CV   +GS  P LIL+HLVSLV RGCL GF+ LV
Sbjct  400  LPLLLHLLSTAPFDIRKEVAYALGNVCVVQSEGSHQPNLILDHLVSLVDRGCLPGFISLV  459

Query  354  RSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLD  175
            RS D EAARLG+QFLE+V+RG+PN  GPKLVE+EDGI+A+ER+QFHENE LR MANEL+D
Sbjct  460  RSPDLEAARLGLQFLEMVMRGLPNGRGPKLVEREDGIDAMERFQFHENEHLRSMANELVD  519

Query  174  KYYGDEYG  151
            KY+G+++G
Sbjct  520  KYFGEDHG  527



>dbj|BAJ94044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + N++L+ GN ITD  + + +KCLKS++R+L+KEA+W LSN+AAGS EHKKLI +S+A  
Sbjct  243  MVNSILIVGNSITDQALSSLIKCLKSDNRVLRKEASWALSNIAAGSFEHKKLIFTSEATP  302

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
             L+HLL++A FDI+KE AY LGNLCV P   +  P +I EHLVS++  G L GF++LVRS
Sbjct  303  SLIHLLTSAQFDIRKEAAYTLGNLCVVPAGSTEPPNIITEHLVSIINGGALPGFINLVRS  362

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GP+LVE+ DGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  363  ADIESARLGLQFLELVMRGYPNGQGPQLVERGDGIEAMERFQFHENEAMRNMANGLVDKY  422

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  423  FGEDYGLE  430



>emb|CDY10407.1| BnaCnng03080D [Brassica napus]
Length=494

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
            A+L+ G    D  I    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++A+ +L+
Sbjct  307  AILIGGKNTEDYVIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEAMPLLI  366

Query  519  HLLSTAP--FDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSV  346
             LLST+P  FDI+KEVAYVLGN+CV   +G   PK+I E LVS+V  GCL GF++LVRS 
Sbjct  367  GLLSTSPSPFDIRKEVAYVLGNVCVESAEGDTKPKIIQEQLVSIVSGGCLPGFINLVRSP  426

Query  345  DAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYY  166
            D EAARLG+QF+ELVLRGMPN EG K+VE EDGI+A+ER+QFHENEELR +AN L+DKY+
Sbjct  427  DIEAARLGLQFIELVLRGMPNVEGSKIVEGEDGIDAMERFQFHENEELRVIANSLVDKYF  486

Query  165  GDEYGLEE  142
            G++YG+ E
Sbjct  487  GEDYGINE  494



>ref|XP_004968263.1| PREDICTED: importin subunit alpha-2-like [Setaria italica]
Length=527

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  GN ITD  + + +KCLKS++R+LKKEA+W +SN+AAGS EHKKLI +S+A+ 
Sbjct  340  MVDSVLTVGNSITDQALSSLIKCLKSDNRVLKKEASWAMSNIAAGSFEHKKLIFASEAMT  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL+TA FDI++E AY LGN+CV P   +  P +I++HLV++V  G L GF++LVRS
Sbjct  400  LLMHLLTTAQFDIRREAAYTLGNMCVVPAGNAAPPNIIVDHLVAIVNGGALPGFINLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GPKLVE EDGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  460  ADIESARLGLQFLELVMRGYPNGQGPKLVESEDGIEAMERFQFHENELMRNMANGLVDKY  519

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  520  FGEDYGLE  527



>ref|NP_001147773.1| importin alpha-2 subunit [Zea mays]
 gb|ACG28682.1| importin alpha-2 subunit [Zea mays]
Length=526

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL+ GN +TD  + + +KCLKS+HR+LKKEA+W +SN+AAGS EHKKLI +S+A  
Sbjct  340  MVDSVLIVGNSVTDQALSSLIKCLKSDHRVLKKEASWAMSNIAAGSFEHKKLIFASEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL TA FDI++E AY LGNLCV P      P +I+EHLV++V  G L GF++LVRS
Sbjct  400  LLMHLLRTAQFDIRREAAYTLGNLCVVPAGSGNPPSIIVEHLVAIVDGGALPGFINLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG P+ +GPKLVE EDGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  460  ADIESARLGLQFLELVMRGYPDSQGPKLVETEDGIEAMERFQFHENEMMRNMANGLVDKY  519

Query  168  YGDEYGL  148
            +G++YGL
Sbjct  520  FGEDYGL  526



>gb|ACN31641.1| unknown [Zea mays]
 gb|AFW80076.1| importin alpha-2 subunit [Zea mays]
Length=526

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL+ GN +TD  + + +KCLKS+HR+LKKEA+W +SN+AAGS EHKKLI  S+A  
Sbjct  340  MVDSVLIVGNSVTDQALSSLIKCLKSDHRVLKKEASWAMSNIAAGSFEHKKLIFGSEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL TA FDI++E AY LGNLCV P      P +I+EHLV++V  G L GF++LVRS
Sbjct  400  LLMHLLRTAQFDIRREAAYTLGNLCVVPAGSGNPPTIIVEHLVAIVDGGALPGFINLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG P+ +GPKLVE EDGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  460  ADIESARLGLQFLELVMRGYPDSQGPKLVETEDGIEAMERFQFHENEMMRNMANGLVDKY  519

Query  168  YGDEYGL  148
            +G++YGL
Sbjct  520  FGEDYGL  526



>emb|CDM81997.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + +++L+ GN ITD  + + +KCLKS++R+L+KEA+W LSN+AAGS EHKKLI +S+A  
Sbjct  337  MVDSILIVGNSITDQALSSLIKCLKSDNRVLRKEASWALSNIAAGSFEHKKLIFTSEATP  396

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
             L+HLL++A FDI+KE AY LGNLCV P   +  P +I EHLVS++  G L GF++LVRS
Sbjct  397  SLIHLLTSAQFDIRKEAAYTLGNLCVVPAGSTEPPNIITEHLVSIINGGALPGFINLVRS  456

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GP+LVE+ DGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  457  ADIESARLGLQFLELVMRGYPNGQGPQLVERGDGIEAMERFQFHENEAMRNMANGLVDKY  516

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  517  FGEDYGLE  524



>ref|XP_002457309.1| hypothetical protein SORBIDRAFT_03g005380 [Sorghum bicolor]
 gb|EES02429.1| hypothetical protein SORBIDRAFT_03g005380 [Sorghum bicolor]
Length=565

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  GN +TD  + + +KCLKS++R+LKKEA+W +SN+AAGS EHKKLI +S+A  
Sbjct  378  MVDSVLTVGNSVTDQALASLIKCLKSDNRVLKKEASWAMSNVAAGSFEHKKLIFASEATP  437

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HLL TA FDI++E AY LGNLCV P      P +I++HLV++V  G L GF++LVRS
Sbjct  438  LLMHLLRTAQFDIRREAAYTLGNLCVVPAGSGNPPNIIVDHLVAIVDGGGLPGFINLVRS  497

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GPKLVE+EDGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  498  ADIESARLGLQFLELVMRGYPNNQGPKLVEREDGIEAMERFQFHENEVMRNMANGLVDKY  557

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  558  FGEDYGLE  565



>gb|EMT10396.1| Importin subunit alpha-2 [Aegilops tauschii]
Length=571

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + +++L+ GN ITD  + + +KCLKS++R+L+KEA+W LSN+AAGS EHKKLI +S+A  
Sbjct  384  MVDSILIVGNSITDQALSSLIKCLKSDNRVLRKEASWALSNIAAGSFEHKKLIFTSEATP  443

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
             L+HLL++A FDI+KE AY LGNLCV P   +  P +I EHLVS++  G L GF++LVRS
Sbjct  444  SLIHLLTSAQFDIRKEAAYTLGNLCVVPAGSTEPPNIITEHLVSIINGGALPGFINLVRS  503

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GP+LVE+ DGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  504  ADIESARLGLQFLELVMRGYPNGQGPQLVERGDGIEAMERFQFHENEAMRNMANGLVDKY  563

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  564  FGEDYGLE  571



>gb|EMS52684.1| Importin subunit alpha-2 [Triticum urartu]
Length=571

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + +++L+ GN ITD  + + +KCLKS++R+L+KEA+W LSN+AAGS EHKKLI +S+A  
Sbjct  384  MVDSILIVGNSITDQALSSLIKCLKSDNRVLRKEASWALSNIAAGSFEHKKLIFTSEATP  443

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
             L+HLL++A FDI+KE AY LGNLCV P   +  P +I EHLVS++  G L GF++LVRS
Sbjct  444  SLIHLLTSAQFDIRKEAAYTLGNLCVVPAGSTEPPNIITEHLVSIINGGALPGFINLVRS  503

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLELV+RG PN +GP+LVE+ DGIEA+ER+QFHENE +R MAN L+DKY
Sbjct  504  ADIESARLGLQFLELVMRGYPNGQGPQLVERGDGIEAMERFQFHENEAMRNMANGLVDKY  563

Query  168  YGDEYGLE  145
            +G++YGLE
Sbjct  564  FGEDYGLE  571



>ref|XP_003567730.1| PREDICTED: importin subunit alpha-2 [Brachypodium distachyon]
Length=527

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + +++L+ GN ITD  + + +KCL+S++R+L+KEA+WVLSN+AAGS EHKKLI +S+A  
Sbjct  340  MVDSILIVGNNITDQALSSLIKCLRSDNRVLRKEASWVLSNIAAGSFEHKKLIFTSEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            VL+HLL+ A +DI+KE AY LGNLCV P   S  P +I+EHLVS++  G L GF++L+RS
Sbjct  400  VLIHLLNNAQYDIRKEAAYTLGNLCVVPAGSSEPPNIIVEHLVSIINSGALPGFINLLRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D E+ARLG+QFLEL +RG P+ +GP LVE+EDGIEA+ER+QFHEN+ +R MAN L+DKY
Sbjct  460  ADIESARLGLQFLELAMRGYPDGQGPNLVEREDGIEAMERFQFHENDVMRNMANGLVDKY  519

Query  168  YGDEYGLE  145
            +G++YG+E
Sbjct  520  FGEDYGVE  527



>ref|XP_006289370.1| hypothetical protein CARUB_v10002864mg [Capsella rubella]
 gb|EOA22268.1| hypothetical protein CARUB_v10002864mg [Capsella rubella]
Length=519

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 10/199 (5%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQ----------VKCLKSEHRILKKEAAWVLSNLAAGSAEHK  559
            + N V V    I   FI+ Q           KCL+SEHR+LKKEAAWVLSN+AAG  EHK
Sbjct  321  VGNFVAVDPKAILTIFIREQNTEESIVGVLAKCLRSEHRVLKKEAAWVLSNIAAGPIEHK  380

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            ++IHS++ +++LL LLST+PFDI+KE+AYVLGNLCV   +G   P++I EHLVS+V  GC
Sbjct  381  RMIHSTEVMSLLLRLLSTSPFDIRKEIAYVLGNLCVESAEGDTKPRIIQEHLVSIVSGGC  440

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELR  199
            L GF++LVRS D EAARLG+QF+ELVLRGMPN EGPKLVE EDGI+A+ER+QFHENEELR
Sbjct  441  LPGFIELVRSPDIEAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFHENEELR  500

Query  198  GMANELLDKYYGDEYGLEE  142
             MAN L+DKY+G++YG++E
Sbjct  501  VMANSLVDKYFGEDYGIDE  519



>gb|EEC69979.1| hypothetical protein OsI_00484 [Oryza sativa Indica Group]
Length=528

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  GN I D  +   +KCLKS++R+L+KE++W LSN+AAGS EHKKLI +S+A  
Sbjct  340  MVDSVLTVGNNIIDQALSGLIKCLKSDNRVLRKESSWALSNIAAGSFEHKKLIFASEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            VL+ L+++A FDI++E AY LGNLCV P     +PK+I+EHLV++V  G L GF+ LVRS
Sbjct  400  VLIRLVTSAQFDIRREAAYTLGNLCVVPTGNCELPKIIVEHLVAIVDGGALPGFIHLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D + A LG+QFLELV+RG PN++GPKLVE EDGIEA+ER+QFHENE++R MAN L+D+Y
Sbjct  460  ADVDTAGLGLQFLELVMRGYPNKQGPKLVEMEDGIEAMERFQFHENEQMRNMANGLVDEY  519

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  520  FGEDYGLDE  528



>dbj|BAA31220.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  GN I D  +   +KCLKS++R+L+KE++W LSN+AAGS EHKKLI +S+A  
Sbjct  340  MVDSVLTVGNNIIDQALSGLIKCLKSDNRVLRKESSWALSNIAAGSFEHKKLIFASEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            VL+ L+++A FDI++E AY LGNLCV P     +PK+I+EHLV++V  G L GF+ LVRS
Sbjct  400  VLIRLVTSAQFDIRREAAYTLGNLCVVPTGNCELPKIIVEHLVAIVDGGALPGFIHLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D + A LG+QFLELV+RG PN++GPKLVE EDGIEA+ER+QFHENE++R MAN L+D+Y
Sbjct  460  ADVDTAGLGLQFLELVMRGYPNKQGPKLVEMEDGIEAMERFQFHENEQMRNMANGLVDEY  519

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  520  FGEDYGLDE  528



>ref|XP_006643773.1| PREDICTED: importin subunit alpha-2-like [Oryza brachyantha]
Length=528

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL+ GN I D  +   +KCLKS++R+L+KEA+W LSN+AAGS EHKKLI  S+A  
Sbjct  340  MVDSVLLVGNNIIDQALSGLIKCLKSDNRVLRKEASWALSNIAAGSFEHKKLIFVSEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            +L+HL+++A FDI++E AY LGNLCV P     +P +I+EHLV++V  G L GF+ LVRS
Sbjct  400  LLIHLITSAQFDIRREAAYTLGNLCVVPTGNCELPTIIVEHLVAIVDGGALPGFIHLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D + A LG+QFLELV+RG PN++GPKLVE EDGIEA+ER+QFH+NE++R MAN L+D+Y
Sbjct  460  ADVDTAGLGLQFLELVMRGYPNKQGPKLVEMEDGIEAMERFQFHDNEQMRNMANGLVDEY  519

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  520  FGEDYGLDE  528



>ref|XP_010423779.1| PREDICTED: importin subunit alpha-2-like [Camelina sativa]
Length=520

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+      ++ +    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ +++LL
Sbjct  334  TILIREQNTEESIVGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMSLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
             LLST+PFDI+KEVAYVLGNLCV + + G   P++I EHLVS+V  GCL GF++LVRS D
Sbjct  394  RLLSTSPFDIRKEVAYVLGNLCVESAEGGDTKPRIIQEHLVSIVRGGCLPGFIELVRSPD  453

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRG+PN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G
Sbjct  454  IEAARLGLQFIELVLRGIPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFG  513

Query  162  DEYGLEE  142
            + YG++E
Sbjct  514  ENYGIDE  520



>ref|XP_010452168.1| PREDICTED: importin subunit alpha-2-like [Camelina sativa]
Length=520

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+      ++ +    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ +++LL
Sbjct  334  TILIREQNTEESIVGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMSLLL  393

Query  519  HLLSTAPFDIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVD  343
             LLST+PFDI+KEVAYVLGNLCV + + G   P++I +HLVS+V  GCL GF++LVRS D
Sbjct  394  RLLSTSPFDIRKEVAYVLGNLCVESAEGGDTKPRIIQDHLVSIVRGGCLPGFIELVRSPD  453

Query  342  AEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
             EAARLG+QF+ELVLRG+PN EGPKLVE EDGI+A+ER+QFHENEELR MAN L+DKY+G
Sbjct  454  IEAARLGLQFIELVLRGIPNGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYFG  513

Query  162  DEYGLEE  142
            ++YG++E
Sbjct  514  EDYGIDE  520



>gb|EAZ10619.1| hypothetical protein OsJ_00451 [Oryza sativa Japonica Group]
Length=504

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  G+ I D  +   +KCLKS++R+L+KE++W LSN+AAGS EHKKLI +S+A  
Sbjct  316  MVDSVLTVGHNIIDQALSGLIKCLKSDNRVLRKESSWALSNIAAGSFEHKKLIFASEATP  375

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            VL+ L+++  FDI++E AY LGNLCV P     +PK+I+EHLV++V  G L GF+ LVRS
Sbjct  376  VLIRLVTSMQFDIRREAAYTLGNLCVVPTGNCELPKIIVEHLVAIVDGGALPGFIHLVRS  435

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D + A LG+QFLELV+RG PN++GPKLVE EDGIEA+ER+QFHENE++R MAN L+D+Y
Sbjct  436  ADVDTAGLGLQFLELVMRGYPNKQGPKLVEMEDGIEAMERFQFHENEQMRNMANGLVDEY  495

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  496  FGEDYGLDE  504



>ref|NP_001042074.1| Os01g0158000 [Oryza sativa Japonica Group]
 sp|Q9FYP9.1|IMA2_ORYSJ RecName: Full=Importin subunit alpha-2 [Oryza sativa Japonica 
Group]
 dbj|BAA31222.1| importin alpha [Oryza sativa Japonica Group]
 dbj|BAB08186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAB64664.1| SRP1 protein homolog [Oryza sativa Japonica Group]
 dbj|BAF03988.1| Os01g0158000 [Oryza sativa Japonica Group]
 dbj|BAG95907.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALA  529
            + ++VL  G+ I D  +   +KCLKS++R+L+KE++W LSN+AAGS EHKKLI +S+A  
Sbjct  340  MVDSVLTVGHNIIDQALSGLIKCLKSDNRVLRKESSWALSNIAAGSFEHKKLIFASEATP  399

Query  528  VLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRS  349
            VL+ L+++  FDI++E AY LGNLCV P     +PK+I+EHLV++V  G L GF+ LVRS
Sbjct  400  VLIRLVTSMQFDIRREAAYTLGNLCVVPTGNCELPKIIVEHLVAIVDGGALPGFIHLVRS  459

Query  348  VDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKY  169
             D + A LG+QFLELV+RG PN++GPKLVE EDGIEA+ER+QFHENE++R MAN L+D+Y
Sbjct  460  ADVDTAGLGLQFLELVMRGYPNKQGPKLVEMEDGIEAMERFQFHENEQMRNMANGLVDEY  519

Query  168  YGDEYGLEE  142
            +G++YGL+E
Sbjct  520  FGEDYGLDE  528



>ref|XP_010490774.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-2-like 
[Camelina sativa]
Length=520

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  693  LVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL  514
            L+      ++ +    KCL+SEHR+LKKEAAWVLSN+AAGS EHK++IHS++ +++LL L
Sbjct  336  LIREQNTEESIVGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEVMSLLLRL  395

Query  513  LSTAPFDIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAE  337
            LST+PFDI+KEVAYVLGNLCV + + G   P++I +HLVS+V  GCL GF++LVRS D E
Sbjct  396  LSTSPFDIRKEVAYVLGNLCVESAEGGDTKPRIIQDHLVSIVRGGCLPGFIELVRSPDIE  455

Query  336  AARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
            AARLG+QF+ELVLRG+PN EGPKLVE ED I+A+ER+QFHENEELR MAN L+DKY+G++
Sbjct  456  AARLGLQFIELVLRGIPNGEGPKLVEGEDXIDAMERFQFHENEELRVMANSLVDKYFGED  515

Query  156  YGLEE  142
            YG++E
Sbjct  516  YGIDE  520



>gb|EPS72639.1| hypothetical protein M569_02116, partial [Genlisea aurea]
Length=494

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSS-DAL  532
            + N V   GNEIT   ++A  KCLK E+  L+KE+AWVLSNLAAGS +HK+LIHSS +A+
Sbjct  315  VANTVFAPGNEITVNAVEAITKCLKFENHALQKESAWVLSNLAAGSLDHKRLIHSSVEAM  374

Query  531  AVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVR  352
              L+ LLS APFD++KE AYVLGN+CV  D+ +    +I+EHL+S+VGRGCLSGFV+LVR
Sbjct  375  DSLIVLLSAAPFDVRKEAAYVLGNICVVSDERA---NVIIEHLISIVGRGCLSGFVNLVR  431

Query  351  SVDAEAARLGMQFLELVLRGMPNREGPKLVEKED-GIEALERYQFHENEELRGMANELLD  175
            S D EAA +G+QF+ELVLR MP+ EG K+VE  D GIEA+ER+QFHENE LR MANEL D
Sbjct  432  SPDTEAAMMGLQFMELVLREMPDLEGVKIVEDLDGGIEAVERFQFHENEVLRNMANELAD  491

Query  174  KYY  166
            KY+
Sbjct  492  KYF  494



>ref|XP_007027273.1| Importin subunit alpha-2 isoform 2 [Theobroma cacao]
 gb|EOY07775.1| Importin subunit alpha-2 isoform 2 [Theobroma cacao]
Length=483

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
            +  T+ +LV G EITD  I+  VKCLKSEHR+LKKEA+WVLSN+AAGS EHK+LI+SS+A
Sbjct  329  SHTTSTILVPGLEITDGVIKVLVKCLKSEHRVLKKEASWVLSNIAAGSVEHKQLIYSSEA  388

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLV  355
            + +LLHLLSTAPFDI+KEVAYVLGNLCVAP  G G P LI EHLVSLV RGCLSGF+DLV
Sbjct  389  VPLLLHLLSTAPFDIRKEVAYVLGNLCVAPTGGDGKPNLIQEHLVSLVQRGCLSGFIDLV  448

Query  354  RSVDAEAARLGMQFLELVLRG  292
            RS D EAARLG+QF+ELV  G
Sbjct  449  RSADVEAARLGLQFMELVDMG  469



>ref|XP_001758629.1| predicted protein [Physcomitrella patens]
 gb|EDQ76607.1| predicted protein, partial [Physcomitrella patens]
Length=495

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  645  KCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVL  466
            + L++EHR L+KEAAWV+SNLAAGS  HK+ + +  A++ LL+LL+T+ FD++KE AY L
Sbjct  303  RILETEHRTLQKEAAWVVSNLAAGSILHKRAVFNGGAVSPLLYLLATSTFDVRKEAAYAL  362

Query  465  GNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMP  286
            GNLCVAP D     K ILEHL  LV RGCL GF+ LV+S D E+ARLG+QFLELV+R +P
Sbjct  363  GNLCVAPRDQGEEGKPILEHLNVLVDRGCLMGFIALVKSPDLESARLGLQFLELVMRALP  422

Query  285  NREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
            + +GPKLVEK DGI A+E  QFH NEELR M+N L+D+Y+G++YGLEE
Sbjct  423  DGKGPKLVEKLDGIAAMEELQFHANEELRIMSNMLIDQYFGEDYGLEE  470



>ref|XP_001775435.1| predicted protein [Physcomitrella patens]
 gb|EDQ59764.1| predicted protein [Physcomitrella patens]
Length=515

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -3

Query  609  EAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSG  430
            EAAWV+SNLAAGS  HK  +     +  LLHLL+T+ FD++KE AY LGNLCVAP +   
Sbjct  335  EAAWVVSNLAAGSISHKVAVFKGGVVPPLLHLLATSAFDVRKEAAYALGNLCVAPREQGA  394

Query  429  MPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKED  250
              K ILEHL  LV RGCL GF+ LV+S D EAA+LG+QFLELV+R +PN +GPKLVEKED
Sbjct  395  EGKPILEHLTVLVDRGCLMGFIALVKSPDLEAAKLGLQFLELVMRALPNGKGPKLVEKED  454

Query  249  GIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
            GI A+E  QFH+NEELR M+N L+D+Y+G++YG EE
Sbjct  455  GIAAMEELQFHDNEELRIMSNILVDQYFGEDYGFEE  490



>ref|XP_009122933.1| PREDICTED: importin subunit alpha-2-like [Brassica rapa]
Length=332

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLL  520
             +L+ G    ++ I    KCL+S+HR+LKKEAAWVLSN+AAGS EHK++IHS++A+ +L+
Sbjct  198  TILIGGKNTEESVIGVLAKCLRSDHRVLKKEAAWVLSNIAAGSIEHKRMIHSTEAMPLLI  257

Query  519  HLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDA  340
             LLST+PFDI+KEVAYVLGNLCV   +G   P++I EHLVS+V  GCL GF++LVRS D 
Sbjct  258  GLLSTSPFDIRKEVAYVLGNLCVESAEGDTKPRIIQEHLVSIVSGGCLPGFINLVRSPDI  317

Query  339  EAARLGMQFLELV  301
            EAARLG+QF+ELV
Sbjct  318  EAARLGLQFIELV  330



>ref|XP_002985897.1| hypothetical protein SELMODRAFT_123107, partial [Selaginella 
moellendorffii]
 gb|EFJ13074.1| hypothetical protein SELMODRAFT_123107, partial [Selaginella 
moellendorffii]
Length=512

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
             ++++ V+ AG+ +    + A V+CL++ HR L+KEAAWV+SNLAAGS +HK+ +    A
Sbjct  318  NKMSDGVIAAGSTVPGGVVGALVRCLQTNHRALQKEAAWVISNLAAGSMQHKEHVFPV-A  376

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSG---MPKLILEHLVSLVGRGCLSGFV  364
               L++LL+TA FD+KKE  Y LGNLCV P + +      + I  HL +L   GC++ FV
Sbjct  377  CGPLVNLLATASFDVKKEAVYALGNLCVMPKEATAAQTASQPIHAHLSALAQSGCVAEFV  436

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            +LV+S D E ++LG+QFLELV+R + N  G KLVE  DG+ A+E   FHEN+ELR MAN 
Sbjct  437  NLVKSPDPEGSKLGLQFLELVMRCLQN--GTKLVEGCDGMLAIEMLHFHENDELRNMANH  494

Query  183  LLDKYYGD  160
            LLD Y+G 
Sbjct  495  LLDTYFGS  502



>ref|XP_002976434.1| hypothetical protein SELMODRAFT_105015 [Selaginella moellendorffii]
 gb|EFJ22694.1| hypothetical protein SELMODRAFT_105015 [Selaginella moellendorffii]
Length=532

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDA  535
             ++++ V+ AG+ +    + A V+CL++ HR L+KEAAWV+SNLAAGS +HK+ +    A
Sbjct  339  NKMSDGVIAAGSTVPGGVVGALVRCLQTNHRALQKEAAWVISNLAAGSMQHKEHVFPV-A  397

Query  534  LAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSG---MPKLILEHLVSLVGRGCLSGFV  364
               L++LL+TA FD+KKE  Y LGNLCV P + +      + I  HL +L   GC++ FV
Sbjct  398  CGPLVNLLATASFDVKKEAVYALGNLCVMPKEATAAQTASQPIHAHLSALAQSGCVAEFV  457

Query  363  DLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANE  184
            +LV+S D E ++LG+QFLELV+R + N  G KLVE  DG+ A+E   FHEN+ELR MAN 
Sbjct  458  NLVKSPDPEGSKLGLQFLELVMRCLQN--GTKLVEACDGMLAIEMLHFHENDELRNMANH  515

Query  183  LLDKYYGD  160
            LLD Y+G 
Sbjct  516  LLDTYFGS  523



>ref|XP_010107579.1| hypothetical protein L484_024435 [Morus notabilis]
 gb|EXC16261.1| hypothetical protein L484_024435 [Morus notabilis]
Length=91

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  405  LVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERY  226
                V  GCLSGF+DLVRS D EAARL +QF+ELVLRGMPN EGPKLVE EDGI+A+ER+
Sbjct  4    FTEFVVLGCLSGFIDLVRSADIEAARLVLQFMELVLRGMPNGEGPKLVEHEDGIDAMERF  63

Query  225  QFHENEELRGMANELLDKYYGDEYGLEE  142
            QFHENE+LR MAN L+DKY+G+EYGL+E
Sbjct  64   QFHENEDLRNMANGLVDKYFGEEYGLDE  91



>ref|XP_004353002.1| Armadillo/betacatenin-like repeat domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR23474.1| Armadillo/betacatenin-like repeat domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=474

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 103/191 (54%), Gaps = 19/191 (10%)
 Frame = -3

Query  711  RITNAVLVAGNEITD------AFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLI  550
            R+   ++   N  TD       F+     C+ SE R ++KEA WV+SNL+ G+ EH + I
Sbjct  294  RVFGNLISRSNAYTDVLLSYPPFLPFLAHCIGSETRPVRKEATWVISNLSGGTPEHVQAI  353

Query  549  HSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSG  370
              S    +++    T PFDIKKE  + L N+     +           L+SLV  G L  
Sbjct  354  LQSGLGDLIVKTFKTQPFDIKKEAGFALMNIASEKRN-----------LISLVKGGVLPE  402

Query  369  FVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMA  190
            F+ L+++ D E   +G+ FL +VL   P+  G  LVE+EDG+E LE  Q+++NE +   A
Sbjct  403  FISLLKAPDLEVVVMGLDFLAMVLDHHPD--GALLVEEEDGLETLENLQYNQNEVIASKA  460

Query  189  NELLDKYYGDE  157
             +L+ KYYGDE
Sbjct  461  TQLVRKYYGDE  471



>ref|XP_005846007.1| hypothetical protein CHLNCDRAFT_58379 [Chlorella variabilis]
 gb|EFN53905.1| hypothetical protein CHLNCDRAFT_58379 [Chlorella variabilis]
Length=784

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 97/171 (57%), Gaps = 12/171 (7%)
 Frame = -3

Query  660  IQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHK-KLIHSSDALAVLLHLLSTAPFDIKK  484
            +QA V C  S H  L+KEA WVLSN+A        + + ++ A+  L+ LL  APF ++K
Sbjct  350  LQALVTCAGSHHHGLQKEACWVLSNIAGMPGRGGIEALKAAGAVPALMCLLKDAPFHVRK  409

Query  483  EVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQ----  316
            E A+ L N+C     G+G P+ +  + +    R  +   + L+RS D +AARLG+Q    
Sbjct  410  EAAFALANICADGGGGTGNPETL--NWLFAADREAMRAMLSLMRSADMDAARLGLQARRC  467

Query  315  --FLELVLRGMPNREGPKLVEKEDGIEALERYQFHE-NEELRGMANELLDK  172
              F E+VLR + N  G + VE+ DGI+A+E  QF     EL+ MA  L+DK
Sbjct  468  LPFTEMVLRLLDN--GEQAVEEADGIDAMEAVQFGAVPPELQRMAAALVDK  516



>emb|CCA14786.1| importin alpha 1 subunitlike protein putative [Albugo laibachii 
Nc14]
Length=523

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 103/204 (50%), Gaps = 26/204 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLKS----EHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   IQ Q+       +CL++      R ++KEA W LSN+ AG+    
Sbjct  300  TPALRTVGNIVTGDDIQTQIIINFSALRCLRALLDNPRRAIRKEACWTLSNITAGNQAQI  359

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +   D   +L+  LSTA FDI+KE A+ + N   A   GS       E ++ LV  GC
Sbjct  360  QAVVKEDIFPILIRFLSTAEFDIQKEAAWAVSN---ATSGGSD------EQIMHLVTLGC  410

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREGPKLVEKEDGIEALERYQFH  217
            +    DL+   DA+ A + ++ LE +L      +     E   L+++ DG+  ++  Q+H
Sbjct  411  IKPLCDLLEVNDAKLAMVALEGLENILKVGEKQKTSEQNEVATLIDEVDGVTKIQSLQYH  470

Query  216  ENEELRGMANELLDKYYGDEYGLE  145
            +NEE+   + ++++ Y+  E   E
Sbjct  471  QNEEIYRKSLQIVEVYFNGEEDAE  494



>gb|ETI56772.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK96557.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM02992.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM56238.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO85504.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=470

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 106/205 (52%), Gaps = 26/205 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLK----SEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV        CL+    S  + ++KEA W LSN+ AG+ E  
Sbjct  245  TPALRTVGNIVTGDDLQTQVIINLNALPCLRALLESPKKGIRKEACWTLSNITAGNQEQI  304

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + I  +D    L++ LSTA FDI+KE A+ + N   A   GS       E ++ LV  GC
Sbjct  305  QFIIEADIFPSLINFLSTAEFDIRKEAAWAVSN---ATSGGSA------EQIMHLVSLGC  355

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREG------PKLVEKEDGIEALERYQFH  217
            +    DL+   DA+   + ++ LE +LR   +++         ++++ DG+  ++  Q+H
Sbjct  356  IKPLCDLLEVKDAKVVIVALEGLENILRAGESQKTNDINDVATMIDEADGVTKIQALQYH  415

Query  216  ENEELRGMANELLDKYYGDEYGLEE  142
             NE++   + +++++Y+  E   E+
Sbjct  416  ANEDIYLKSMKIVEQYFNGEEDAED  440



>dbj|GAN02228.1| importin subunit alpha-2-like [Mucor ambiguus]
Length=517

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 103/180 (57%), Gaps = 18/180 (10%)
 Frame = -3

Query  669  DAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL---LSTAP  499
            +AF+   V  +KS+ R++KKEA WVLSN+   S++  ++I   + L V+ HL   +    
Sbjct  352  EAFLPTVVSLIKSDQRVVKKEALWVLSNIT--SSQDPEIIQKLEELDVIKHLSELVVRGA  409

Query  498  FDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM  319
            FDI+K  AY + N+    + GS       EHL  L  +  L  F+DLV+S DA+  RLG+
Sbjct  410  FDIRKGAAYCIMNIA---NHGS-------EHLDKLSHKQLLPAFLDLVKSQDADMIRLGL  459

Query  318  QFLELVLRGMPNREGPKLVEK-EDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
             ++EL+L   P  +G ++++   D +EAL       + EL   AN+L+D+Y+G+   ++E
Sbjct  460  GYIELLLTQSP--KGKEIIDNVPDCMEALAAVAPAPDPELFAFANKLVDQYFGESPEMQE  517



>ref|XP_008890414.1| hypothetical protein PPTG_00708 [Phytophthora parasitica INRA-310]
 gb|ETI56771.1| hypothetical protein F443_00829 [Phytophthora parasitica P1569]
 gb|ETK96556.1| hypothetical protein L915_00780 [Phytophthora parasitica]
 gb|ETL49909.1| hypothetical protein L916_00773 [Phytophthora parasitica]
 gb|ETM02991.1| hypothetical protein L917_00744 [Phytophthora parasitica]
 gb|ETM56237.1| hypothetical protein L914_00760 [Phytophthora parasitica]
 gb|ETN24341.1| hypothetical protein PPTG_00708 [Phytophthora parasitica INRA-310]
 gb|ETO85503.1| hypothetical protein F444_00848 [Phytophthora parasitica P1976]
 gb|ETP26541.1| hypothetical protein F441_00822 [Phytophthora parasitica CJ01A1]
 gb|ETP54514.1| hypothetical protein F442_00793 [Phytophthora parasitica P10297]
Length=532

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 106/205 (52%), Gaps = 26/205 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLK----SEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV        CL+    S  + ++KEA W LSN+ AG+ E  
Sbjct  307  TPALRTVGNIVTGDDLQTQVIINLNALPCLRALLESPKKGIRKEACWTLSNITAGNQEQI  366

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + I  +D    L++ LSTA FDI+KE A+ + N   A   GS       E ++ LV  GC
Sbjct  367  QFIIEADIFPSLINFLSTAEFDIRKEAAWAVSN---ATSGGSA------EQIMHLVSLGC  417

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREG------PKLVEKEDGIEALERYQFH  217
            +    DL+   DA+   + ++ LE +LR   +++         ++++ DG+  ++  Q+H
Sbjct  418  IKPLCDLLEVKDAKVVIVALEGLENILRAGESQKTNDINDVATMIDEADGVTKIQALQYH  477

Query  216  ENEELRGMANELLDKYYGDEYGLEE  142
             NE++   + +++++Y+  E   E+
Sbjct  478  ANEDIYLKSMKIVEQYFNGEEDAED  502



>emb|CCI11425.1| unnamed protein product [Albugo candida]
Length=504

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 100/204 (49%), Gaps = 26/204 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLKS----EHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q Q+       +CL++      R ++KE  W LSN+ AG+    
Sbjct  281  TPALRTVGNIVTGDDVQTQIIINFSALRCLRALLENPRRAIRKETCWTLSNITAGNQAQI  340

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +   D    L+ LLSTA FDI+KE A+ + N      D   M      HLV+L   GC
Sbjct  341  QAVVDEDIFPTLIRLLSTAEFDIQKEAAWAVSNATSGGTDEQIM------HLVTL---GC  391

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR------GMPNREGPKLVEKEDGIEALERYQFH  217
            +    DL+   DA+ A + ++ LE VLR           E   L+++ DG+  ++  Q+H
Sbjct  392  IKPLCDLLEVNDAKLAMVALEGLENVLRVGEKLKTSEQNEVATLIDEVDGVSKIQSLQYH  451

Query  216  ENEELRGMANELLDKYYGDEYGLE  145
            +NEE+   + E++  Y+  E   E
Sbjct  452  QNEEIYRKSLEIVAVYFHGEEDAE  475



>tpg|DAA38992.1| TPA: hypothetical protein ZEAMMB73_042843 [Zea mays]
Length=612

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -3

Query  684  GNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLST  505
            GN I D  + + +K LKS+ R+LKKE +W +SN+AA S EHKK I +S+A  +L+HLL T
Sbjct  470  GNPIIDQALSSLIKRLKSDSRVLKKEESWAMSNIAASSFEHKKRICASEATLLLMHLLRT  529

Query  504  APFDIKKEVAYVLGNLCVAPDDGSGMPKLIL  412
              FDI +E AY LGNLCV P  GS  P  I+
Sbjct  530  TNFDIHREAAYTLGNLCVVP-VGSSNPLSII  559



>ref|XP_009523333.1| hypothetical protein PHYSODRAFT_354318 [Phytophthora sojae]
 gb|EGZ20616.1| hypothetical protein PHYSODRAFT_354318 [Phytophthora sojae]
Length=532

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 104/205 (51%), Gaps = 26/205 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLK----SEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV        CL+    S  + ++KEA W LSN+ AG+ E  
Sbjct  307  TPALRTVGNIVTGDDLQTQVIINLNALPCLRALLESPKKGIRKEACWTLSNITAGNQEQI  366

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + I  +D    L++ LSTA FDI+KE A+ + N   A   GS       E ++ LV  GC
Sbjct  367  QFIIEADIFPSLINFLSTAEFDIRKEAAWAVSN---ATSGGSA------EQIMHLVSLGC  417

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNREG-----PKLVEKEDGIEALERYQFH  217
            +    DL+   DA+   + ++ LE +LR G   +         ++++ DG+  ++  Q+H
Sbjct  418  IKPLCDLLEVKDAKVVIVALEGLENILRVGEQQKTNDINDVATMIDEADGVNKIQALQYH  477

Query  216  ENEELRGMANELLDKYYGDEYGLEE  142
             NE++   + ++++ Y+  E   E+
Sbjct  478  ANEDIYMKSMKIVEAYFNGEEDAED  502



>gb|EPB91411.1| hypothetical protein HMPREF1544_01733 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=514

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 102/180 (57%), Gaps = 18/180 (10%)
 Frame = -3

Query  669  DAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL---LSTAP  499
            +AF+   V  +KS+ R++KKEA WVLSN+   S++  ++I   + L V+ HL   +    
Sbjct  349  EAFLPKVVSLIKSDQRVVKKEALWVLSNIT--SSQDPEIIQKLEELDVIKHLSELVVRGA  406

Query  498  FDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM  319
            FDI+K  AY + N+    + G        EHL  L  +  L  F+DLV+S DA+  RLG+
Sbjct  407  FDIRKGAAYCIMNIA---NHGP-------EHLDKLSHKQLLPAFLDLVKSQDADMIRLGL  456

Query  318  QFLELVLRGMPNREGPKLVEK-EDGIEALERYQFHENEELRGMANELLDKYYGDEYGLEE  142
             ++EL+L   P  +G ++++   D +EAL       + EL   AN+L+D+Y+G+   ++E
Sbjct  457  GYIELLLTQSP--KGKEVIDNVPDCMEALAAVAPAPDPELFAFANKLVDQYFGESPEMQE  514



>ref|XP_002896684.1| importin alpha-2 subunit [Phytophthora infestans T30-4]
 gb|EEY66875.1| importin alpha-2 subunit [Phytophthora infestans T30-4]
Length=532

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 105/205 (51%), Gaps = 26/205 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCLK----SEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV        CL+    S  + ++KEA W LSN+ AG+ E  
Sbjct  307  TPALRTVGNIVTGDDLQTQVIINLNALPCLRALLESPKKGIRKEACWTLSNITAGNQEQI  366

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + I  ++    L+  LSTA FDI+KE A+ + N   A   GS       E ++ LV  GC
Sbjct  367  QFIIEAEIFPSLISFLSTAEFDIRKEAAWAVSN---ATSGGSA------EQIMHLVSLGC  417

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGP------KLVEKEDGIEALERYQFH  217
            +    DL+   DA+   + ++ LE +LR   +++         ++++ DG+  ++  Q+H
Sbjct  418  IKPLCDLLEEKDAKVVIVALEGLENILRAGESQKTSDINDVATMIDEADGVIKIQALQYH  477

Query  216  ENEELRGMANELLDKYYGDEYGLEE  142
             NE++   + +++++Y+  E   E+
Sbjct  478  ANEDIYLKSMKIVEQYFNGEEDAED  502



>gb|ELU07006.1| hypothetical protein CAPTEDRAFT_224969 [Capitella teleta]
Length=476

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 85/163 (52%), Gaps = 14/163 (9%)
 Frame = -3

Query  645  KCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVL  466
            K L S HR ++KE  W LSNL  G AE  KL   ++ +  L+ +L +   DIK EVAY +
Sbjct  322  KLLDSTHRHIRKETLWALSNLT-GHAEVCKLALEANLVKPLIEMLHSTQ-DIKHEVAYTM  379

Query  465  GNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMP  286
             NL     D       I +HL+     G L   V L++S D +   L + F ++VLR   
Sbjct  380  CNLAYHSTD-------ICQHLLD---SGALPAMVPLLKSTDTDTVHLALSFTDMVLRDTE  429

Query  285  NREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
            N  G +  E+  G+  LE  ++H+N+ LR   NE+LD Y+  E
Sbjct  430  N--GRQAFEEAQGLTFLEALEYHQNDTLRLQTNEILDNYFYKE  470



>emb|CEP10345.1| hypothetical protein [Parasitella parasitica]
Length=515

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 101/181 (56%), Gaps = 19/181 (10%)
 Frame = -3

Query  669  DAFIQAQVKCLKS-EHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHL---LSTA  502
            DAF+   V  +KS + R++KKEA WVLSN+   S++   +I   + L V+ HL   +   
Sbjct  349  DAFLPTVVNLIKSNQSRVVKKEALWVLSNIT--SSQDPDIIKKLEDLDVIQHLSELVVRG  406

Query  501  PFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLG  322
             FDI+K  AY + N+    + G        EHL  L  +  L  F+DLV+S DA+  RLG
Sbjct  407  AFDIRKGAAYCIMNIA---NHGP-------EHLDKLSHKQLLPAFLDLVKSQDADMIRLG  456

Query  321  MQFLELVLRGMPNREGPKLVEK-EDGIEALERYQFHENEELRGMANELLDKYYGDEYGLE  145
            + ++EL+L   P  +G ++++   D +EAL       + EL   AN+L+D+Y+G+   ++
Sbjct  457  LGYIELLLTQAP--KGKEIIDNVPDCMEALAAVTPTPDPELFAFANKLVDQYFGESPEMQ  514

Query  144  E  142
            E
Sbjct  515  E  515



>ref|WP_028833024.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=563

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 106/208 (51%), Gaps = 29/208 (14%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV   C         L S  + ++KEA W +SN+ AG+    
Sbjct  331  TPALRTVGNIVTGDDLQTQVIINCSALPCLLGLLNSAKKGIRKEACWTISNITAGNNLQI  390

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            K +  ++ +  L++LL  A FDIKKE A+ + N         G P    E +  LV +GC
Sbjct  391  KAVIEANVIPPLINLLKNAEFDIKKEAAWAISNAT-----SGGTP----EQINFLVEQGC  441

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR---GMP--NREGP--KLVEKEDGIEALERYQF  220
            +    DL+   DA+   + ++ LE +L+   GM   N E P    VE  +G++ ++  Q 
Sbjct  442  VPPLCDLLEVRDAKIVTVALEGLENILKIGDGMKDNNGENPHANTVELANGLDKIDELQN  501

Query  219  HENEELRGMANELLDKYYG--DEYGLEE  142
            HEN ++   A ++L+KY+G  DE G E+
Sbjct  502  HENNDIYERAVKILEKYFGAVDEEGGED  529



>ref|XP_005778844.1| hypothetical protein EMIHUDRAFT_421349 [Emiliania huxleyi CCMP1516]
 gb|EOD26415.1| hypothetical protein EMIHUDRAFT_421349 [Emiliania huxleyi CCMP1516]
Length=533

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 99/199 (50%), Gaps = 27/199 (14%)
 Frame = -3

Query  705  TNAVLVAGNEIT--DAFIQAQVKC---------LKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+  AGN +T  D   Q  + C         L S  + ++KEA W +SN+ AG+ E  
Sbjct  302  TPALRTAGNIVTGDDNQTQQVINCGALPRLLALLNSPKKGIRKEACWTISNITAGTREQI  361

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  S+ +  L+ LL+TA FDIKKE A+ + N   A   GS       + +  LV +GC
Sbjct  362  QAVIESNIIPPLVLLLATAEFDIKKEAAWSISN---ATSGGS------TDQIKYLVTQGC  412

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR-----GMPNREGP--KLVEKEDGIEALERYQF  220
            +    DL+   D     + ++ +E VL+     G      P    V++ DG+E LE+ Q 
Sbjct  413  IKPLCDLLICNDPRLVTVALEGIENVLKAGEQDGAATGTNPYASYVDEADGLEKLEKLQE  472

Query  219  HENEELRGMANELLDKYYG  163
            H NE++   A  +L+ Y+G
Sbjct  473  HNNEDVFKKAVHILESYFG  491


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = -3

Query  696  VLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLH  517
            V+ AG  +   F+Q  ++C   ++ +L+ E+AW L+N+A+G++EH +++ ++ A+ + + 
Sbjct  111  VIAAG--VVPRFVQF-LQC--GDNPMLQFESAWALTNIASGTSEHTRVVIANGAVPIFVQ  165

Query  516  LLSTAPFDIKKEVAYVLGNL  457
            LL +   D++++  + LGN+
Sbjct  166  LLMSPNDDVREQAVWALGNI  185



>ref|XP_005758728.1| hypothetical protein EMIHUDRAFT_460128, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD06299.1| hypothetical protein EMIHUDRAFT_460128, partial [Emiliania huxleyi 
CCMP1516]
Length=519

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 99/199 (50%), Gaps = 27/199 (14%)
 Frame = -3

Query  705  TNAVLVAGNEIT--DAFIQAQVKC---------LKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+  AGN +T  D   Q  + C         L S  + ++KEA W +SN+ AG+ E  
Sbjct  302  TPALRTAGNIVTGDDNQTQQVINCGALPRLLALLNSPKKGIRKEACWTISNITAGTREQI  361

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  S+ +  L+ LL+TA FDIKKE A+ + N   A   GS       + +  LV +GC
Sbjct  362  QAVIESNIIPPLVLLLATAEFDIKKEAAWSISN---ATSGGS------TDQIKYLVTQGC  412

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR-----GMPNREGP--KLVEKEDGIEALERYQF  220
            +    DL+   D     + ++ +E VL+     G      P    V++ DG+E LE+ Q 
Sbjct  413  IKPLCDLLICNDPRLVTVALEGIENVLKAGEQDGAATGTNPYASYVDEADGLEKLEKLQE  472

Query  219  HENEELRGMANELLDKYYG  163
            H NE++   A  +L+ Y+G
Sbjct  473  HNNEDVFKKAVHILESYFG  491


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = -3

Query  696  VLVAGNEITDAFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLH  517
            V+ AG  +   F+Q  ++C   ++ +L+ E+AW L+N+A+G++EH +++ ++ A+ + + 
Sbjct  111  VIAAG--VVPRFVQF-LQC--GDNPMLQFESAWALTNIASGTSEHTRVVIANGAVPIFVQ  165

Query  516  LLSTAPFDIKKEVAYVLGNL  457
            LL +   D++++  + LGN+
Sbjct  166  LLMSPNDDVREQAVWALGNI  185



>ref|XP_001713610.1| importin alpha [Guillardia theta]
 gb|AAK39905.1|AF165818_113 importin alpha [Guillardia theta]
Length=514

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 100/200 (50%), Gaps = 28/200 (14%)
 Frame = -3

Query  693  LVAGNEITDAFIQAQVKC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSS  541
            +  GN     FI   + C         LKS  + L++E+ WVLSN+ AG+    + +  +
Sbjct  302  ITTGNNFHTQFI---INCGSLPCLLYLLKSSKKTLRRESCWVLSNITAGTRSQIQQVIDA  358

Query  540  DALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVD  361
            + +  +L LL+ A  D+KKE A+ + N     D         +  +  +V  GC+   +D
Sbjct  359  NLIPPILELLANAEIDVKKEAAWAISNATSGGD---------IRQINYMVNNGCIKPMLD  409

Query  360  LVRSVDAEAARLGMQ----FLELVLRGMPNREGPKLVEK--EDGIEALERYQFHENEELR  199
            L+ S D    R+ ++     LE  ++ +  +E    ++K  E+G++ +E+ Q+H +E++ 
Sbjct  410  LLDSTDPRLIRVILEGIDNILEFGMKNVTKKEDNIYLQKIEENGLDKIEKLQYHNDEKIY  469

Query  198  GMANELLDKYY-GDEYGLEE  142
              + ++L KY+  D Y ++E
Sbjct  470  EYSKKILQKYFETDNYNVDE  489



>ref|XP_001698656.1| importin alpha [Chlamydomonas reinhardtii]
 gb|EDO99338.1| importin alpha [Chlamydomonas reinhardtii]
Length=555

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 101/210 (48%), Gaps = 35/210 (17%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q QV        CL      +  + +KKEA W +SN+ AG+ +  +
Sbjct  305  ALRTVGNIVTGNDMQTQVIINCGALACLHNLLMTNHKKSIKKEACWTVSNITAGTKDQIQ  364

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  S  +  L+ LL+TA FDIKKE A+ + N   A   GS       + +  LV +GC+
Sbjct  365  AVIDSGLIPPLIGLLATAEFDIKKEAAWAISN---ATSGGSN------DQIKYLVQQGCI  415

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREG----PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L      R MP   G     +++E  DG++ +E  
Sbjct  416  KPLCDLLTVADIRIITVALEGLENILKIGQQERSMPGSAGVNPYAQMIEDADGLDKVEHL  475

Query  225  QFHENEELRGMANELLDKYY----GDEYGL  148
            Q H NE+L   A  +L+ Y+    GD+  L
Sbjct  476  QDHPNEDLYEKAVHILETYFDVDEGDDQNL  505


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 67/141 (48%), Gaps = 16/141 (11%)
 Frame = -3

Query  618  LKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDD  439
            L+ EAAW L+N+A+G++EH K++   +A+ + + LL++   D++++  + LGN+     D
Sbjct  133  LQFEAAWALTNVASGTSEHTKVVIDHNAVPIFVQLLASPNDDVREQAVWALGNIA---GD  189

Query  438  GSGMPKLILEH--LVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKL  265
                   +L H  L  L+ +   +  + ++R+            L    RG P    P  
Sbjct  190  SPKCRDYVLGHNALPPLLEQLKENSKISMLRN--------ATWTLSNFCRGKP---APNF  238

Query  264  VEKEDGIEALERYQFHENEEL  202
            +     +  L R   H +EE+
Sbjct  239  IVTRQALPTLARLIHHSDEEV  259



>gb|KFH65960.1| hypothetical protein MVEG_08062 [Mortierella verticillata NRRL 
6337]
Length=560

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 103/174 (59%), Gaps = 22/174 (13%)
 Frame = -3

Query  663  FIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKK--LIHSSDA--LAVLLHLLSTAPF  496
            F+ + ++ ++S+ R +KKE+ W++SN+   +AEH+   LI   +A  + VL  + +   F
Sbjct  364  FLPSMLQFIQSDCRPVKKESLWLMSNI---TAEHQSTDLIKVIEAGFIPVLSKIATHENF  420

Query  495  DIKKEVAYVLGNLCV-APDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM  319
            DI+KE AY L NL +  PD        IL H      R  L GF+D +R+ D E  +LG+
Sbjct  421  DIRKEAAYSLINLALHGPDYAK-----ILPH------RELLPGFLDFLRTKDQELIQLGL  469

Query  318  QFLELVLR-GMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGD  160
            ++++L+L  G+P  +GP L+ + +G++ALE     ++ +   +A+ L+D Y+G+
Sbjct  470  RYVQLLLNSGIP--DGPALLSELNGVDALEEVILSDDRDQHRLASLLMDTYFGE  521



>ref|XP_005849695.1| hypothetical protein CHLNCDRAFT_30497 [Chlorella variabilis]
 gb|EFN57593.1| hypothetical protein CHLNCDRAFT_30497 [Chlorella variabilis]
Length=535

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 102/208 (49%), Gaps = 31/208 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q+        CL      S  + +KKEA W +SN+ AG+ E  +
Sbjct  303  ALRTVGNIVTGDDMQTQIIINCGALPCLLNLLTTSHKKSIKKEACWTISNITAGTKEQIQ  362

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +  L+HLL+TA FDIKKE A+ + N   A   G+       E +  LV +G +
Sbjct  363  TVVDAGIVPPLIHLLATAEFDIKKEAAWAISN---ATSGGTN------EQIKYLVSQGGI  413

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR--------GMPNREGP--KLVEKEDGIEALERY  226
                DL+   DA    + ++ LE +L+        G      P  +LV++ +G++ +E  
Sbjct  414  KPLCDLLSCSDARIVTVALEGLENILKVGEAEKELGGAAATNPFAQLVDEAEGLDKIEDL  473

Query  225  QFHENEELRGMANELLDKYYGDEYGLEE  142
            Q H NE++   A  +L+ Y+  E G EE
Sbjct  474  QNHSNEDIYEKAVAILEAYFDVEDGEEE  501



>ref|XP_002508520.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69778.1| predicted protein [Micromonas sp. RCC299]
Length=529

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 103/199 (52%), Gaps = 30/199 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHR-ILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T    Q Q+   C         L ++H+  +KKEA W +SN+ AG+ +  +
Sbjct  302  ALRTVGNIVTGDDYQTQIVINCRALPSLLALLTADHKKSIKKEACWTISNITAGNKDQIQ  361

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             I  ++ +  L++LL+ A FDIKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  362  AIVENNIVPPLVYLLAHAEFDIKKEAAWAISN---ATSGGTH------QQIKYLVEQGCI  412

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR--------GMPNREGPKLVEKEDGIEALERYQF  220
                DL+   DA    + ++ LE +L+        G PN+   + +++ +G+E +E  Q 
Sbjct  413  KPLCDLIVCSDARIVTVALEGLENILKVGEVDRMDGQPNQYA-QFIDEAEGLEKIENLQN  471

Query  219  HENEELRGMANELLDKYYG  163
            H N E+   A ++L++Y+G
Sbjct  472  HNNNEIYEKAMKILEEYFG  490



>ref|XP_011214471.1| PREDICTED: importin subunit alpha-7 [Bactrocera dorsalis]
Length=541

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 101/200 (51%), Gaps = 25/200 (13%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            +T A+   GN +T   +Q QV   C         L S++  +KKEA W +SN+AAG+ + 
Sbjct  321  VTAALRAVGNIVTGDDVQTQVILNCNALSCINDLLNSQYETIKKEACWTISNIAAGNRQQ  380

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ ++ +A F  KKE A+ + N   A   G+       E +  LV  G
Sbjct  381  IQAVIDANIFPVLITIMQSADFKTKKESAWAIAN---ATSSGTA------EQIRYLVHVG  431

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLRG---MPNREGPKLVEKED--GIEALERYQFH  217
            C++   D +  VD++  ++ +  LE +L+       R  P  +  E+  G++ +E  Q H
Sbjct  432  CIAPMCDFLTVVDSDIVQVALNALENILKAGEKFAARPNPYAIAIEECGGLDKIEYLQSH  491

Query  216  ENEELRGMANELLDKYYGDE  157
            EN ++   +  ++++Y+ +E
Sbjct  492  ENRDIYCKSFYIIEQYFNNE  511



>ref|XP_009401503.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=528

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 103/203 (51%), Gaps = 31/203 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  304  ALRTVGNIVTGDDMQTQYVIDHQALPCLLNLLTHNHKKSIKKEACWTISNITAGNKEQIQ  363

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + ++  +  L+HLL TA F+IKKE A+ + N   A   G+       E +  LV +GC+
Sbjct  364  AVIAAGIIGPLVHLLQTAEFEIKKEAAWAISN---ATSGGAH------EQIKYLVSQGCI  414

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR--------GMPNREGP--KLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+        G+P    P  +L+E  +G++ +E +
Sbjct  415  KPLCDLLLCPDPRIITVCLEGLENILKVGEAEKNLGVPGGTNPYAQLIEDAEGLDKIENF  474

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   + ++L+ Y+ +E
Sbjct  475  QSHDNTEIYEKSVKILETYWLEE  497


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  636  KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            + ++  L+ EAAW L+N+A+G++EH K++    A+ + + LLS+   D++++  + LGN+
Sbjct  126  REDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALGNV  185



>ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 103/204 (50%), Gaps = 33/204 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  305  ALRTVGNIVTGDDVQTQYVINHQALPCLLNLLTHNHKKSIKKEACWTISNITAGNKEQIQ  364

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + ++  +A L+HLL TA FDIKKE A+ + N   A   G+       + +  +VG+GC+
Sbjct  365  AVIAAGIIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------DQIKYIVGQGCI  415

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR-----------GMPNREGPKLVEKEDGIEALER  229
                DL+   D     + ++ LE +L+           G  N    +L+++ +G+E +E 
Sbjct  416  KPLCDLLVCPDPRIVTVCLEGLENILKIGEAEKNLGATGAVNSYA-QLIDEAEGLEKIEN  474

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q H+N E+   A ++L+ Y+ +E
Sbjct  475  LQSHDNTEIYEKAVKILETYWMEE  498



>gb|KDP27954.1| hypothetical protein JCGZ_19034 [Jatropha curcas]
Length=527

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 106/207 (51%), Gaps = 30/207 (14%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGS  571
            T +  A+  AGN +T    Q Q       + CL     ++  + +KKEA W +SN+ AG+
Sbjct  299  TVLVPALRTAGNIVTGDDAQTQCIIDNQGLPCLYQLLTQNYKKSIKKEACWTISNITAGN  358

Query  570  AEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLV  391
                + I  ++ +A L+HLL  A F++KKE A+ + N        SG  +  ++HLVS  
Sbjct  359  RNQIQAIIDANIIAPLVHLLQHAEFEVKKEAAWAISNAT------SGGTQEQIQHLVS--  410

Query  390  GRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNREGPK--------LVEKEDGIEA  238
             RGC+    DL+   D     + ++ LE +L+ G  ++E           ++E  DG++ 
Sbjct  411  -RGCIKPLCDLLACPDPRIITVCLEGLENILKIGETDKESGNTQVNVYRHMIEDCDGLDK  469

Query  237  LERYQFHENEELRGMANELLDKYYGDE  157
            +E  Q H+N+E+     ++L++Y+ +E
Sbjct  470  IENLQNHDNQEIYEKVVKILERYWIEE  496



>emb|CBN79488.1| conserved unknown protein [Ectocarpus siliculosus]
Length=556

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 97/203 (48%), Gaps = 29/203 (14%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-----------KCLKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV             L S  + ++KEA W +SN+ AG+ E  
Sbjct  319  TPALRTVGNIVTGDDLQTQVIINFNALPWLLNLLSSSKKGIRKEACWTISNITAGNKEQI  378

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  ++ +  L+ LLS A FDI+KE A+ + N         G P    E +  LV  GC
Sbjct  379  QAVIDANIIPPLIQLLSNAEFDIRKEAAWAISNAT-----SGGKP----EQIKYLVTEGC  429

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALERY  226
            +    DL+   DA+   + ++ LE +L+         G    +    + +  G+E +E+ 
Sbjct  430  IPPLSDLLEVHDAKIVTVALEGLENILKTGDTEAKAQGQEINQMATYIMECGGMERIEQL  489

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N  +   A +LL++Y+G E
Sbjct  490  QMHDNNNIYNKALKLLERYFGVE  512



>ref|XP_010152917.1| PREDICTED: importin subunit alpha-7, partial [Eurypyga helias]
 gb|KFW08050.1| Importin subunit alpha-7, partial [Eurypyga helias]
Length=286

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 99/201 (49%), Gaps = 29/201 (14%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  65   ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  124

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F ++KE A+ + N   A   G+      LE +  LV  GC+ 
Sbjct  125  VIDANIFPVLIEILQKAEFRMRKEAAWAITN---ATSGGT------LEQIRYLVNLGCIK  175

Query  372  GFVDLVRSVDAEAARLGMQFLELVLR---GMPNREGP------KLVEKEDGIEALERYQF  220
               DL+  +D++  ++ +  LE +LR      N+ G        L+E+  G++ +E  Q 
Sbjct  176  PLCDLLTVMDSKIVQMALNGLENILRLGEQEANQSGTGINPYCSLIEEAYGLDKIEFLQS  235

Query  219  HENEELRGMANELLDKYYGDE  157
            HEN+E+   A +L++ Y+G E
Sbjct  236  HENQEIYQKAFDLIEHYFGVE  256



>ref|XP_008137233.1| PREDICTED: importin subunit alpha-6 isoform X2 [Eptesicus fuscus]
Length=531

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGVNPYCSLIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  477  LQSHENQEIYQKAFDLIEHYFGEE  500



>ref|XP_008137225.1| PREDICTED: importin subunit alpha-6 isoform X1 [Eptesicus fuscus]
Length=536

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGVNPYCSLIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  482  LQSHENQEIYQKAFDLIEHYFGEE  505



>ref|XP_011193831.1| PREDICTED: importin subunit alpha-7 [Bactrocera cucurbitae]
Length=541

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 99/200 (50%), Gaps = 25/200 (13%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            +T A+   GN +T   +Q QV   C         L S    +KKEA W +SN+AAG+ + 
Sbjct  321  VTAALRAVGNIVTGDDVQTQVILNCNALSCISVLLNSPFETIKKEACWTISNIAAGNRQQ  380

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  S+   VL+ ++ +A F  KKE A+ + N   A   G+       E +  LV  G
Sbjct  381  IQAVIDSNIFPVLITIMQSADFKTKKESAWAIAN---ATSSGTA------EQIRYLVHVG  431

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLRG---MPNREGPKLVEKED--GIEALERYQFH  217
            C++   D +  VD++  ++ +  LE +L+       R  P  +  E+  G++ +E  Q H
Sbjct  432  CIAPMCDFLTVVDSDIVQVALNALENILKAGEKFAARPNPYAIAIEECGGLDKIEYLQSH  491

Query  216  ENEELRGMANELLDKYYGDE  157
            EN ++   +  ++++Y+ +E
Sbjct  492  ENRDIYCKSFYIIEQYFNNE  511



>gb|EPQ03176.1| Importin subunit alpha-6 [Myotis brandtii]
Length=517

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  292  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  351

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  352  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIKYLVALG  402

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  403  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  462

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  463  LQSHENQEIYQKAFDLIEHYFGEE  486



>gb|AFW79686.1| importin alpha-1b subunit, mRNA [Zea mays]
Length=328

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 90/170 (53%), Gaps = 19/170 (11%)
 Frame = -3

Query  636  KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            ++  + +KKEA W +SN+ AG+ +  + + S+  +A LL LL TA FDIKKE A+ + N 
Sbjct  135  QNHKKSIKKEACWTISNITAGNKDQIQAVISAGIIAPLLQLLQTAEFDIKKEAAWAISN-  193

Query  456  CVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNR  280
              A   GS       E +  LV  GC+    DL+   D     + ++ LE +L+ G  ++
Sbjct  194  --ATSGGSH------EQIKYLVSEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGQHDK  245

Query  279  EG---------PKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
                        +++++ +G+E +E  Q H+N E+   A +LL+ Y+ +E
Sbjct  246  TMGATGDTNVLAQMIDEAEGLEKIENLQSHDNNEIYEKAVKLLETYWMEE  295



>ref|XP_010649543.1| PREDICTED: importin subunit alpha-1 isoform X2 [Vitis vinifera]
Length=509

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 33/204 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCLKS-----EHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   IQ Q       + CL S       + +KKEA W +SN+ AG+ E  +
Sbjct  284  ALRTVGNIVTGDDIQTQSIINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQ  343

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL TA FDIKKE A+ + N   A   G+       E +  LV +GC+
Sbjct  344  AVIEAGVIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------EQIKYLVSQGCI  394

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR-----------GMPNREGPKLVEKEDGIEALER  229
                DL+   D     + ++ LE +L+           G  N    +L++  +G+E +E 
Sbjct  395  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKTLGNSGDVNYYA-QLIDDAEGLEKIEN  453

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q H+N E+   A ++L+ Y+ +E
Sbjct  454  LQSHDNNEIYEKAVKILETYWLEE  477



>ref|XP_005858982.1| PREDICTED: importin subunit alpha-6 isoform X2 [Myotis brandtii]
Length=531

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  477  LQSHENQEIYQKAFDLIEHYFGEE  500



>ref|XP_005858981.1| PREDICTED: importin subunit alpha-6 isoform X1 [Myotis brandtii]
Length=536

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  482  LQSHENQEIYQKAFDLIEHYFGEE  505



>ref|XP_006089255.1| PREDICTED: importin subunit alpha-6 isoform X1 [Myotis lucifugus]
Length=536

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  482  LQSHENQEIYQKAFDLIEHYFGEE  505



>ref|XP_004977076.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Setaria 
italica]
Length=530

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 103/203 (51%), Gaps = 32/203 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  307  ALRTVGNIVTGDDLQTQCVIDHQALPCLLNLLTTNHKKSIKKEACWTISNITAGNREQIQ  366

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + +++ +A L+HLL TA FDIKKE A+ + N   A   G+       + +  LVG+GC+
Sbjct  367  AVINANIIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTN------DQIKYLVGQGCI  417

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR----------GMPNREGPKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+          G  N    +L++  +G++ +E  
Sbjct  418  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNVYA-QLIDDAEGLDKIENL  476

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A ++L+ Y+ +E
Sbjct  477  QSHDNTEIYEKAVKMLESYWLEE  499


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 75/150 (50%), Gaps = 22/150 (15%)
 Frame = -3

Query  636  KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            + +H  L+ EAAW L+N+A+G++E+ K++  S A+ + + LL++   D++++  + LGN+
Sbjct  129  REDHPQLQFEAAWALTNIASGTSENTKVVVESGAVPIFVKLLNSHSEDVREQAVWALGNV  188

Query  456  CVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM-----QFLELVLRG  292
                 D      L+L H           G   L++ ++ E A+L M       L    RG
Sbjct  189  A---GDSPKCRDLVLGH----------GGLFPLLQQLN-EHAKLSMLRNATWTLSNFCRG  234

Query  291  MPNREGPKLVEKEDGIEALERYQFHENEEL  202
             P    P   + +  + AL+R    ++EE+
Sbjct  235  KPQ---PNFDQVKPALSALQRLIHSQDEEV  261



>gb|EAX07569.1| karyopherin alpha 6 (importin alpha 7), isoform CRA_b [Homo sapiens]
Length=311

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 102/204 (50%), Gaps = 31/204 (15%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHK  559
            + A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    
Sbjct  87   SPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQI  146

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC
Sbjct  147  QAVIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GC  197

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALER  229
            +    DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E 
Sbjct  198  IKPLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEF  256

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G E
Sbjct  257  LQSHENQEIYQKAFDLIEHYFGVE  280



>ref|XP_010147047.1| PREDICTED: importin subunit alpha-6-like, partial [Eurypyga helias]
Length=232

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  7    VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNTAQ  66

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  67   IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  117

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         G+       L+E+  G++ +E 
Sbjct  118  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGLGINPYCALIEEAYGLDKIEF  177

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  178  LQRHENQEIYQKAFELIEHYFGVE  201



>ref|XP_003057280.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58925.1| predicted protein [Micromonas pusilla CCMP1545]
Length=532

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 105/208 (50%), Gaps = 35/208 (17%)
 Frame = -3

Query  711  RITNAVLVA-----GNEITDAFIQAQV--KC---------LKSEHR-ILKKEAAWVLSNL  583
            R T +VL+      GN +T    Q Q+   C         L ++H+  +KKEA W +SN+
Sbjct  296  RPTPSVLIPALRTVGNIVTGDDYQTQIIINCRALPSLLALLTTDHKKSIKKEACWTISNI  355

Query  582  AAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHL  403
             AG+ +  + I  S+ +  L++LL  A FDIKKE A+ + N   A   G+       + +
Sbjct  356  TAGNKDQIQAIIESNIIPPLVYLLQHAEFDIKKEAAWAISN---ATSGGTH------QQI  406

Query  402  VSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLR--------GMPNREGPKLVEKEDG  247
              LV +G +    DL+   DA    + ++ LE +L+        G PN+   + +++ DG
Sbjct  407  KYLVEQGAIKPLCDLIVCSDARIVTVALEGLENILKVGEAMKTEGSPNQFA-QFIDEADG  465

Query  246  IEALERYQFHENEELRGMANELLDKYYG  163
            +E +E  Q H N ++   A ++L++Y+G
Sbjct  466  LEKIENLQNHNNNDIYDKAMKILEEYFG  493



>ref|XP_006089256.1| PREDICTED: importin subunit alpha-6 isoform X2 [Myotis lucifugus]
Length=531

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G+E
Sbjct  477  LQSHENQEIYQKAFDLIEHYFGEE  500



>ref|XP_009796205.1| PREDICTED: importin subunit alpha-1 [Nicotiana sylvestris]
Length=531

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 105/208 (50%), Gaps = 31/208 (15%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGS  571
            T +  A+  AGN +T    Q Q       + CL     ++  + +KKEA W +SN+ AG+
Sbjct  299  TVLIPALRTAGNIVTGDDAQTQFVIDNQVLPCLCQLLTQNHKKSIKKEACWTISNITAGN  358

Query  570  AEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLV  391
                + +  ++ +  L+HLL +A FDIKKE A+ + N   A   GS       + +  L 
Sbjct  359  KAQIQAVIEANIIPPLVHLLQSAEFDIKKEAAWAISN---ATSGGS------YDQIRFLA  409

Query  390  GRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNREG---------PKLVEKEDGIE  241
             +GC+    DL+   D     + ++ LE +L+ G  ++E           +++++ DG++
Sbjct  410  SQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEMDKEAGMNGGINLYAQMIDECDGLD  469

Query  240  ALERYQFHENEELRGMANELLDKYYGDE  157
             +E  Q H+N E+   A ++L+KY+ +E
Sbjct  470  KIENLQTHDNNEIYEKAVKILEKYWAEE  497


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  618  LKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            L+ EAAW L+N+A+G++EH +++    A+   + LLS+A  D++++  + LGN+
Sbjct  132  LQFEAAWALTNVASGTSEHTRIVIDHGAVPKFVQLLSSASDDVREQAVWALGNV  185



>ref|XP_010281281.1| PREDICTED: importin subunit alpha-6, partial [Phaethon lepturus]
Length=350

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  125  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  184

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  185  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  235

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  236  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  295

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  296  LQRHENQEIYQKAFELIEHYFGVE  319



>emb|CEF99159.1| Armadillo-type fold [Ostreococcus tauri]
Length=531

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 85/161 (53%), Gaps = 16/161 (10%)
 Frame = -3

Query  624  RILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAP  445
            + +KKEA W +SN+ AG+ +  + I     +  L+ LL+ A FDIKKE A+ + N     
Sbjct  349  KSIKKEACWTISNITAGNKDQIQSIIDEQIVPPLIELLANAEFDIKKEAAWAISNAT---  405

Query  444  DDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNR--EG  274
               SG     +++LVS    GC+    DL+   DA    + ++ LE +L+ G  +R  E 
Sbjct  406  ---SGGTHQQIKYLVSC---GCIKPLCDLINCSDARIVTVALEGLENILKVGEADRTDEA  459

Query  273  PKL----VEKEDGIEALERYQFHENEELRGMANELLDKYYG  163
            P L    V++ DG+E +E  Q H N ++   A  LL+ Y+G
Sbjct  460  PNLFAQYVDEADGLEKIESLQNHTNNDIYEKAMRLLETYFG  500



>gb|KFQ71708.1| Importin subunit alpha-6, partial [Phaethon lepturus]
Length=351

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  126  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  185

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  186  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  236

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  237  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  296

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  297  LQRHENQEIYQKAFELIEHYFGVE  320



>ref|XP_008870934.1| hypothetical protein H310_07333 [Aphanomyces invadans]
 gb|ETW00799.1| hypothetical protein H310_07333 [Aphanomyces invadans]
Length=526

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 96/203 (47%), Gaps = 30/203 (15%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-------KCL----KSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   IQ QV        CL     S  + ++KEA W +SN+ AG+ +  
Sbjct  298  TPALRAVGNIVTGDDIQTQVMLNLNILPCLVALLHSPKKGIRKEACWTVSNITAGNPQQI  357

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + I   D   +LL  L+TA FDIKKE A+ + N        SG P    E +  LV  GC
Sbjct  358  QTIFDHDIFLILLDYLATAEFDIKKEAAWAVSNAT------SGTP----EQIRQLVHLGC  407

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVLRGMPNR---------EGPKLVEKEDGIEALERY  226
            +    +L+   + +   + ++ LE +L    N+         E   +VE  DG+  +E  
Sbjct  408  IPPLCNLLEVSEPKLITVALEGLENILVAGENQGLADGTHVNEYVTVVEDCDGVTKIENL  467

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q+HE  E+   +  L+++++  E
Sbjct  468  QYHEQTEIYNKSLGLIERFFQGE  490



>ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 ref|XP_010649542.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 emb|CBI22923.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 33/204 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCLKS-----EHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   IQ Q       + CL S       + +KKEA W +SN+ AG+ E  +
Sbjct  304  ALRTVGNIVTGDDIQTQSIINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQ  363

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL TA FDIKKE A+ + N   A   G+       E +  LV +GC+
Sbjct  364  AVIEAGVIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------EQIKYLVSQGCI  414

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR-----------GMPNREGPKLVEKEDGIEALER  229
                DL+   D     + ++ LE +L+           G  N    +L++  +G+E +E 
Sbjct  415  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKTLGNSGDVNYYA-QLIDDAEGLEKIEN  473

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q H+N E+   A ++L+ Y+ +E
Sbjct  474  LQSHDNNEIYEKAVKILETYWLEE  497



>ref|XP_008350735.1| PREDICTED: importin subunit alpha-1b-like, partial [Malus domestica]
Length=239

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 96/200 (48%), Gaps = 31/200 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q QV        CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  13   ALRTVGNIVTGDDMQTQVIIQHQALPCLLNLLTNNYKKSIKKEACWTISNITAGNKEQIR  72

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  ++ +  L++LL  A FDIKKE A+ + N   A   GS       E +  LV +GC+
Sbjct  73   AVVEANIIGPLVNLLQNAEFDIKKEAAWAISN---ATSGGSH------EQIKFLVSQGCI  123

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREGPKL----VEKEDGIEALERY  226
                DL+   D     + ++ LE +L      + +    G  L    +E  DG+E +E  
Sbjct  124  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESL  183

Query  225  QFHENEELRGMANELLDKYY  166
            Q H+N E+   A ++L+ Y+
Sbjct  184  QSHDNTEIYEKAVKMLETYW  203



>ref|XP_006778476.1| PREDICTED: importin subunit alpha-6 [Myotis davidii]
Length=536

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQSVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIKYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CIKPLCDLLTVMDSKVVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G++
Sbjct  482  LQSHENQEIYQKAFDLIEHYFGED  505



>ref|XP_009204486.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-6-like 
[Papio anubis]
Length=332

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 97/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  107  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  166

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  167  IQAVIDANXFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  217

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         G+       L+E+  G++ +E 
Sbjct  218  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGVNPYCALIEEAYGLDKIEF  277

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G E
Sbjct  278  LQSHENQEIYQKAFDLIEHYFGVE  301



>gb|KFK43224.1| hypothetical protein AALP_AA1G096500 [Arabis alpina]
Length=539

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 91/170 (54%), Gaps = 19/170 (11%)
 Frame = -3

Query  636  KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            ++  + +KKEA W +SN+ AG+    + +  +  +  L+HLL TA FDIKKE A+ + N 
Sbjct  344  QNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIILPLVHLLQTAEFDIKKEAAWAISN-  402

Query  456  CVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNR  280
              A   GS       E +  LV +GC+    DL+   D     + ++ LE +L+ G  ++
Sbjct  403  --ATSGGSH------EQIQYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEADK  454

Query  279  EG---------PKLVEKEDGIEALERYQFHENEELRGMANELLDKYYGDE  157
            E           +L+E+ DG++ +E  Q H+N E+   A ++L++Y+ +E
Sbjct  455  EMGLNDGVNLYAQLIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEE  504


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  636  KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            + +H  L+ EAAW L+N+A+G+++H +++    A+ + + LLS+A  D++++  + LGN+
Sbjct  133  RQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVELLSSASDDVREQAVWALGNV  192



>ref|XP_009606138.1| PREDICTED: importin subunit alpha [Nicotiana tomentosiformis]
Length=530

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 105/212 (50%), Gaps = 36/212 (17%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   IQ QV        CL     ++  + +KKEA W +SN+ AGS    +
Sbjct  305  ALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGSRNQIQ  364

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL  A F+IKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  365  AVIEAGIIAPLVHLLQNAEFEIKKEAAWAISN---ATSGGNQ------DQIKFLVSQGCI  415

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREG----PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L      + + N EG     +L+++ +G+E +E  
Sbjct  416  KPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENL  475

Query  225  QFHENEELRGMANELLDKYYGDEYGLEE*KEQ  130
            Q H+N E+   A ++L+ Y+     LEE  EQ
Sbjct  476  QSHDNTEIYEKAVKILETYW-----LEEDDEQ  502



>ref|XP_009592620.1| PREDICTED: importin subunit alpha-1 [Nicotiana tomentosiformis]
Length=531

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 105/208 (50%), Gaps = 31/208 (15%)
 Frame = -3

Query  714  TRITNAVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGS  571
            T +  A+  AGN +T    Q Q       + CL     ++  + +KKEA W +SN+ AG+
Sbjct  299  TVLIPALRTAGNIVTGDDAQTQYVIDNQVLPCLCQLLTQNHKKSIKKEACWTISNITAGN  358

Query  570  AEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLV  391
                + +  ++ +  L+HLL +A FDIKKE A+ + N   A   GS       + +  L 
Sbjct  359  KAQIQAVIEANIIPPLVHLLQSAEFDIKKEAAWAISN---ATSGGS------YDQIRFLA  409

Query  390  GRGCLSGFVDLVRSVDAEAARLGMQFLELVLR-GMPNREG---------PKLVEKEDGIE  241
             +GC+    DL+   D     + ++ LE +L+ G  ++E           +++++ DG++
Sbjct  410  SQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEVDKEAGMNGGINLYAQMMDECDGLD  469

Query  240  ALERYQFHENEELRGMANELLDKYYGDE  157
             +E  Q H+N E+   A ++L+KY+ +E
Sbjct  470  KIENLQTHDNNEIYEKAVKILEKYWAEE  497


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  618  LKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNL  457
            L+ EAAW L+N+A+G++EH +++    A+   + LLS+A  D++++  + LGN+
Sbjct  132  LQFEAAWALTNVASGTSEHTRIVIDHGAVPKFVQLLSSASDDVREQAVWALGNV  185



>ref|XP_010129497.1| PREDICTED: importin subunit alpha-6, partial [Buceros rhinoceros 
silvestris]
Length=394

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  169  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  228

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  229  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  279

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  280  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  339

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  340  LQRHENQEIYQKAFELIEHYFGVE  363



>gb|EXX74289.1| Srp1p [Rhizophagus irregularis DAOM 197198w]
Length=496

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 96/167 (57%), Gaps = 13/167 (8%)
 Frame = -3

Query  663  FIQAQVKCLKSEHRILKKEAAWVLSNL-AAGSAEHKKLIHSSDALAVLLHLLSTAPFDIK  487
            F+   ++ ++S+ R +KKE+ WV+SN+ AA   +    + ++  + +L  + + + FDI+
Sbjct  328  FLPTMIEFIQSDCRPVKKESLWVMSNITAARRPDVLDKVFNTGFIPILSIIATHSNFDIR  387

Query  486  KEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLE  307
            KE AY L N+      G+       E + SL  +  L GF++ +RS D +  RLG+ ++E
Sbjct  388  KEAAYGLINIA---SHGA-------EFMRSLPHQELLPGFLEYIRSQDFDLIRLGLGYIE  437

Query  306  LVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYY  166
            ++L  + N  G +L+E   GI+ALE     E++ LR  A+ L+D+Y+
Sbjct  438  MLLTQVQN--GKQLMESMQGIDALESVTLIEDQLLRNSASRLMDQYF  482



>gb|KFO86679.1| Importin subunit alpha-6, partial [Buceros rhinoceros silvestris]
 gb|KFQ84891.1| Importin subunit alpha-6, partial [Phoenicopterus ruber ruber]
Length=395

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  170  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  229

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  230  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  280

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  281  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  340

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  341  LQRHENQEIYQKAFELIEHYFGVE  364



>gb|EKC27679.1| Importin subunit alpha-2 [Crassostrea gigas]
Length=505

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 82/166 (49%), Gaps = 19/166 (11%)
 Frame = -3

Query  645  KCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAP--FDIKKEVAY  472
            K L S+ R  +KE  WVLSN+       K++        +L H+L   P  FDIK E  Y
Sbjct  344  KFLSSDLRHARKETLWVLSNMTGDIDVCKEVTFG----PILSHVLEQVPAAFDIKSEALY  399

Query  471  VLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRG  292
            +L NL    +D       I  HLV       L   V ++++ D E   L +   E+ +R 
Sbjct  400  LLCNLACHGED-------ICTHLVE---SKMLQAVVPVLKTHDVEVLNLALALCEMAIRM  449

Query  291  MPNREGPKLVEKE-DGIEALERYQFHENEELRGMANELLDKYYGDE  157
             PN  G  + EKE +G+  LE  ++H NE +R  AN +LD YYGD+
Sbjct  450  TPN--GKNIFEKECEGMAKLEALEYHSNEAIRTAANHILDMYYGDK  493



>ref|XP_011445049.1| PREDICTED: importin subunit alpha-9-like [Crassostrea gigas]
Length=505

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 82/166 (49%), Gaps = 19/166 (11%)
 Frame = -3

Query  645  KCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAP--FDIKKEVAY  472
            K L S+ R  +KE  WVLSN+       K++        +L H+L   P  FDIK E  Y
Sbjct  349  KFLSSDLRHARKETLWVLSNMTGDIDVCKEVTFG----PILSHVLEQVPAAFDIKSEALY  404

Query  471  VLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLELVLRG  292
            +L NL    +D       I  HLV       L   V ++++ D E   L +   E+ +R 
Sbjct  405  LLCNLACHGED-------ICTHLVE---SKMLQAVVPVLKTHDVEVLNLALALCEMAIRM  454

Query  291  MPNREGPKLVEKE-DGIEALERYQFHENEELRGMANELLDKYYGDE  157
             PN  G  + EKE +G+  LE  ++H NE +R  AN +LD YYGD+
Sbjct  455  TPN--GKNIFEKECEGMAKLEALEYHSNEAIRTAANHILDMYYGDK  498



>ref|XP_009789105.1| PREDICTED: importin subunit alpha [Nicotiana sylvestris]
Length=532

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 105/212 (50%), Gaps = 36/212 (17%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   IQ QV        CL     ++  + +KKEA W +SN+ AGS    +
Sbjct  306  ALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGSRNQIQ  365

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL  A F+IKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  366  AVIEAGIIAPLVHLLQNAEFEIKKEAAWAISN---ATSGGNH------DQIKFLVSQGCI  416

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREG----PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L      + + N EG     +L+++ +G+E +E  
Sbjct  417  KPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENL  476

Query  225  QFHENEELRGMANELLDKYYGDEYGLEE*KEQ  130
            Q H+N E+   A ++L+ Y+     LEE  EQ
Sbjct  477  QSHDNTEIYEKAVKILETYW-----LEEDDEQ  503



>ref|XP_009817162.1| PREDICTED: importin subunit alpha-6, partial [Gavia stellata]
Length=425

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  200  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  259

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  260  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  310

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  311  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  370

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  371  LQRHENQEIYQKAFELIEHYFGVE  394


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  15   VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  74

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  75   QAVWALGNI  83



>gb|KFV45640.1| Importin subunit alpha-6, partial [Gavia stellata]
Length=426

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  201  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  260

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  261  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  311

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  312  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  371

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  372  LQRHENQEIYQKAFELIEHYFGVE  395


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  16   VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  75

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  76   QAVWALGNI  84



>ref|XP_004526135.1| PREDICTED: importin subunit alpha-7-like [Ceratitis capitata]
Length=547

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 25/200 (13%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            +T A+   GN +T   +Q QV   C         L S+   +KKEA W +SN+AAG+ + 
Sbjct  327  VTAALRAVGNIVTGDDVQTQVILNCNALSCINMLLNSQFETIKKEACWTISNVAAGNRQQ  386

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ ++  A F  KKE A+ + N   A   G+       E +  LV  G
Sbjct  387  IQAVIDANIFPVLITIMQNADFKTKKEAAWAITN---ATSSGTA------EQIRYLVHVG  437

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLRG---MPNREGPKLVEKED--GIEALERYQFH  217
            C+    D +  VD++  ++ +  LE +L+       R  P  +  E+  G++ +E  Q H
Sbjct  438  CIPPMCDFLTVVDSDIVQVALNALENILKAGEKFAARPNPYAIAIEECGGLDKIEYLQSH  497

Query  216  ENEELRGMANELLDKYYGDE  157
            EN ++   +  ++++Y+ +E
Sbjct  498  ENRDIYYKSFYIIEQYFNNE  517



>gb|ERZ95887.1| hypothetical protein GLOINDRAFT_340985 [Rhizophagus irregularis 
DAOM 181602]
Length=523

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 96/167 (57%), Gaps = 13/167 (8%)
 Frame = -3

Query  663  FIQAQVKCLKSEHRILKKEAAWVLSNL-AAGSAEHKKLIHSSDALAVLLHLLSTAPFDIK  487
            F+   ++ ++S+ R +KKE+ WV+SN+ AA   +    + ++  + +L  + + + FDI+
Sbjct  355  FLPTMIEFIQSDCRPVKKESLWVMSNITAARRPDVLDKVFNTGFIPILSIIATHSNFDIR  414

Query  486  KEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGMQFLE  307
            KE AY L N+      G+       E + SL  +  L GF++ +RS D +  RLG+ ++E
Sbjct  415  KEAAYGLINIA---SHGA-------EFMRSLPHQELLPGFLEYIRSQDFDLIRLGLGYIE  464

Query  306  LVLRGMPNREGPKLVEKEDGIEALERYQFHENEELRGMANELLDKYY  166
            ++L  + N  G +L+E   GI+ALE     E++ LR  A+ L+D+Y+
Sbjct  465  MLLTQVQN--GKQLMESMQGIDALESVTLIEDQLLRNSASRLMDQYF  509



>ref|XP_009643521.1| PREDICTED: importin subunit alpha-6 isoform X2 [Egretta garzetta]
Length=531

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMSINPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  477  LQRHENQEIYQKAFELIEHYFGVE  500


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  121  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  180

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  181  QAVWALGNI  189



>ref|XP_010003132.1| PREDICTED: importin subunit alpha-6 isoform X1 [Chaetura pelagica]
Length=539

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  314  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  373

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  374  IQAVTDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  424

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  425  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  484

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  485  LQRHENQEIYQKAFELIEHYFGVE  508


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  129  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  188

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  189  QAVWALGNI  197



>ref|XP_009643520.1| PREDICTED: importin subunit alpha-6 isoform X1 [Egretta garzetta]
Length=536

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMSINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  482  LQRHENQEIYQKAFELIEHYFGVE  505


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  126  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  185

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  186  QAVWALGNI  194



>ref|XP_005820010.1| hypothetical protein GUITHDRAFT_148189 [Guillardia theta CCMP2712]
 gb|EKX33030.1| hypothetical protein GUITHDRAFT_148189 [Guillardia theta CCMP2712]
Length=327

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 85/168 (51%), Gaps = 21/168 (13%)
 Frame = -3

Query  711  RITNAVLVAGNEITDAFIQAQVKCLKSEHRILK-------KEAAWVLSNLAAGSAEHKKL  553
            R    ++   +EITD  + +   CLK  H +L+       KEA WVLSN+AAG A H+  
Sbjct  130  RCIGNMICGPDEITDHLL-SHPACLKQLHVMLQTGNKGLMKEATWVLSNIAAGKANHRAA  188

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +      A L+ +L T+ FDI+KE A+ L +L     D +  P L    L         +
Sbjct  189  MMEEGVHASLIVILKTSHFDIRKEAAFALFHLL---HDPAYTPTLFTPELA--------T  237

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPKLVEKEDGIEALER  229
             FV L+R+ D +   + +   E +L  M    GP+L E+ DGI+ALE+
Sbjct  238  EFVGLLRAPDPQVVDMALTVAERILATMEG--GPRLFEEADGIDALEQ  283



>ref|XP_010003142.1| PREDICTED: importin subunit alpha-6 isoform X2 [Chaetura pelagica]
Length=536

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQAVTDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  482  LQRHENQEIYQKAFELIEHYFGVE  505


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  126  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  185

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  186  QAVWALGNI  194



>gb|KFU84641.1| Importin subunit alpha-6, partial [Chaetura pelagica]
Length=539

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  314  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  373

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  374  IQAVTDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  424

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  425  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  484

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  485  LQRHENQEIYQKAFELIEHYFGVE  508


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  129  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  188

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  189  QAVWALGNI  197



>gb|ABM05487.1| Impa1 [Nicotiana benthamiana]
Length=532

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 105/212 (50%), Gaps = 36/212 (17%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV-------KCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   IQ QV        CL     ++  + +KKEA W +SN+ AGS    +
Sbjct  306  ALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGSRNQIQ  365

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL  A F+IKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  366  AVIEAGIIAPLVHLLQNAEFEIKKEAAWAISN---ATSGGNH------DQIKFLVSQGCI  416

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREG----PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L      + + N EG     +L+++ +G+E +E  
Sbjct  417  KPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENL  476

Query  225  QFHENEELRGMANELLDKYYGDEYGLEE*KEQ  130
            Q H+N E+   A ++L+ Y+     LEE  EQ
Sbjct  477  QSHDNTEIYEKAVKILETYW-----LEEDDEQ  503



>ref|XP_001500078.2| PREDICTED: importin subunit alpha-7 isoform X1 [Equus caballus]
 ref|XP_008520108.1| PREDICTED: importin subunit alpha-7 isoform X2 [Equus przewalskii]
Length=536

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_006994430.1| PREDICTED: importin subunit alpha-7 isoform X2 [Peromyscus maniculatus 
bairdii]
 ref|XP_006994431.1| PREDICTED: importin subunit alpha-7 isoform X3 [Peromyscus maniculatus 
bairdii]
 ref|XP_007639595.1| PREDICTED: importin subunit alpha-7 isoform X2 [Cricetulus griseus]
 ref|XP_007637075.1| PREDICTED: importin subunit alpha-7 isoform X2 [Cricetulus griseus]
 gb|AAX07457.1| karyopherin alpha 6 [Rattus norvegicus]
Length=533

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_006026210.1| PREDICTED: importin subunit alpha-6 isoform X1 [Alligator sinensis]
Length=478

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  253  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  312

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  313  IQTVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  363

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  364  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  423

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  424  LQRHENQEIYQKAFELIEHYFGVE  447



>gb|KFO34425.1| Importin subunit alpha-7 [Fukomys damarensis]
Length=523

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  301  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  360

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  361  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  411

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  412  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  470

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  471  SHENQEIYQKAFDLIEHYFGVE  492



>ref|XP_005079689.1| PREDICTED: importin subunit alpha-7 [Mesocricetus auratus]
Length=520

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  298  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  357

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  358  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  408

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  409  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  467

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  468  SHENQEIYQKAFDLIEHYFGVE  489



>gb|KFP21239.1| Importin subunit alpha-6, partial [Egretta garzetta]
Length=539

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  314  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  373

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  374  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  424

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  425  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMSINPYCALIEEAYGLDKIEF  484

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  485  LQRHENQEIYQKAFELIEHYFGVE  508


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  129  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  188

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  189  QAVWALGNI  197



>gb|KFO76871.1| Importin subunit alpha-7, partial [Cuculus canorus]
Length=535

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 97/201 (48%), Gaps = 29/201 (14%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N  +      G P    E +  LV  GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNATLG-----GTP----EQIRYLVNLGCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLR---GMPNREGP------KLVEKEDGIEALERYQF  220
               DL+  +D++  ++ +  LE +LR      N+ G        L+E+  G++ +E  Q 
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILRLGEQEANQSGTGINPYCSLIEEAYGLDKIEFLQS  484

Query  219  HENEELRGMANELLDKYYGDE  157
            HEN+E+   A +L++ Y+G E
Sbjct  485  HENQEIYQKAFDLIEHYFGSE  505



>ref|XP_005607308.1| PREDICTED: importin subunit alpha-7 isoform X3 [Equus caballus]
 ref|XP_008520109.1| PREDICTED: importin subunit alpha-7 isoform X3 [Equus przewalskii]
Length=533

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_003356325.2| PREDICTED: importin subunit alpha-7 isoform X1 [Sus scrofa]
Length=533

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_010619871.1| PREDICTED: importin subunit alpha-7 isoform X1 [Fukomys damarensis]
Length=560

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  338  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  397

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  398  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  448

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  449  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  507

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  508  SHENQEIYQKAFDLIEHYFGVE  529



>ref|XP_007170659.1| PREDICTED: importin subunit alpha-7 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=533

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_005607307.1| PREDICTED: importin subunit alpha-7 isoform X2 [Equus caballus]
 ref|XP_008520107.1| PREDICTED: importin subunit alpha-7 isoform X1 [Equus przewalskii]
Length=541

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_008846287.1| PREDICTED: importin subunit alpha-7 isoform X1 [Nannospalax galili]
Length=545

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  323  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  382

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  383  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  433

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  434  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  492

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  493  SHENQEIYQKAFDLIEHYFGVE  514



>gb|ELR48730.1| Importin subunit alpha-7, partial [Bos mutus]
Length=535

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  313  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  372

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  373  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  423

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  424  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  482

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  483  SHENQEIYQKAFDLIEHYFGVE  504



>ref|XP_004900261.1| PREDICTED: importin subunit alpha-7 isoform X3 [Heterocephalus 
glaber]
Length=533

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_010619874.1| PREDICTED: importin subunit alpha-7 isoform X3 [Fukomys damarensis]
Length=541

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>pdb|4UAD|A Chain A, Importin Alpha 7 Delta Ibb In Complex With Influenza 
Pb2 Nuclear Localization Domain
Length=479

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  257  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  316

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  317  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  367

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  368  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  426

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  427  SHENQEIYQKAFDLIEHYFGVE  448



>ref|XP_004266579.1| PREDICTED: importin subunit alpha-7 isoform 2 [Orcinus orca]
 ref|XP_004318266.1| PREDICTED: importin subunit alpha-7 isoform 2 [Tursiops truncatus]
 ref|XP_007468727.1| PREDICTED: importin subunit alpha-7 isoform X3 [Lipotes vexillifer]
Length=537

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>ref|XP_004425941.1| PREDICTED: importin subunit alpha-7 isoform 1 [Ceratotherium 
simum simum]
Length=541

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_003500689.1| PREDICTED: importin subunit alpha-7 isoform X1 [Cricetulus griseus]
 ref|XP_005353236.1| PREDICTED: importin subunit alpha-7 [Microtus ochrogaster]
 ref|XP_006994429.1| PREDICTED: importin subunit alpha-7 isoform X1 [Peromyscus maniculatus 
bairdii]
 ref|XP_007637074.1| PREDICTED: importin subunit alpha-7 isoform X1 [Cricetulus griseus]
 gb|EGW00118.1| Importin subunit alpha-7 [Cricetulus griseus]
Length=536

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|NP_001069422.1| importin subunit alpha-7 [Bos taurus]
 ref|XP_005676772.1| PREDICTED: importin subunit alpha-7 [Capra hircus]
 ref|XP_005959581.1| PREDICTED: importin subunit alpha-7 [Pantholops hodgsonii]
 ref|XP_006054676.1| PREDICTED: importin subunit alpha-7 isoform X2 [Bubalus bubalis]
 ref|XP_010835202.1| PREDICTED: importin subunit alpha-7 [Bison bison bison]
 sp|Q0V7M0.1|IMA7_BOVIN RecName: Full=Importin subunit alpha-7; AltName: Full=Karyopherin 
subunit alpha-6 [Bos taurus]
 gb|ABH06337.1| karyopherin alpha 6 [Bos taurus]
Length=536

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_010619873.1| PREDICTED: importin subunit alpha-7 isoform X2 [Fukomys damarensis]
Length=555

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  333  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  392

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  393  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  443

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  444  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  502

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  503  SHENQEIYQKAFDLIEHYFGVE  524



>ref|XP_006176257.1| PREDICTED: importin subunit alpha-7 isoform X3 [Camelus ferus]
Length=537

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>ref|XP_004850892.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-7 [Heterocephalus 
glaber]
Length=534

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  312  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  371

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  372  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  422

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  423  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  481

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  482  SHENQEIYQKAFDLIEHYFGVE  503



>ref|XP_007125169.1| PREDICTED: importin subunit alpha-7 [Physeter catodon]
Length=536

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_005317796.1| PREDICTED: importin subunit alpha-7 isoform X1 [Ictidomys tridecemlineatus]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>tpg|DAA33092.1| TPA: importin subunit alpha-7 [Bos taurus]
Length=534

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_007663330.1| PREDICTED: importin subunit alpha-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=549

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 97/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  324  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  383

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  384  IQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  434

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  435  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQGGMGINPYCALIEEAYGLDKIEF  494

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G E
Sbjct  495  LQSHENQEIYQKAFDLIEHYFGVE  518



>ref|XP_009864307.1| PREDICTED: importin subunit alpha-6 isoform X2 [Apaloderma vittatum]
Length=531

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  477  LQRHENQEIYQKAFELIEHYFGVE  500


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  121  VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  180

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  181  QAVWALGNI  189



>ref|NP_001015029.2| importin subunit alpha-7 [Rattus norvegicus]
 gb|AAI05814.1| Karyopherin alpha 6 (importin alpha 7) [Rattus norvegicus]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_004266578.1| PREDICTED: importin subunit alpha-7 isoform 1 [Orcinus orca]
 ref|XP_004318265.1| PREDICTED: importin subunit alpha-7 isoform 1 [Tursiops truncatus]
 ref|XP_006176255.1| PREDICTED: importin subunit alpha-7 isoform X1 [Camelus ferus]
 ref|XP_006196981.1| PREDICTED: importin subunit alpha-7 isoform X1 [Vicugna pacos]
 ref|XP_007468726.1| PREDICTED: importin subunit alpha-7 isoform X2 [Lipotes vexillifer]
 ref|XP_010950478.1| PREDICTED: importin subunit alpha-7 isoform X1 [Camelus bactrianus]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_004005080.1| PREDICTED: importin subunit alpha-7 isoform 1 [Ovis aries]
 ref|XP_006054675.1| PREDICTED: importin subunit alpha-7 isoform X1 [Bubalus bubalis]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_005906256.1| PREDICTED: importin subunit alpha-7 isoform X1 [Bos mutus]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_006196983.1| PREDICTED: importin subunit alpha-7 isoform X3 [Vicugna pacos]
Length=538

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  316  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  375

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  376  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  426

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  427  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  485

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  486  SHENQEIYQKAFDLIEHYFGVE  507



>ref|XP_004425942.1| PREDICTED: importin subunit alpha-7 isoform 2 [Ceratotherium 
simum simum]
Length=536

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_004266580.1| PREDICTED: importin subunit alpha-7 isoform 3 [Orcinus orca]
 ref|XP_006176256.1| PREDICTED: importin subunit alpha-7 isoform X2 [Camelus ferus]
 ref|XP_006196982.1| PREDICTED: importin subunit alpha-7 isoform X2 [Vicugna pacos]
 ref|XP_007170658.1| PREDICTED: importin subunit alpha-7 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007468728.1| PREDICTED: importin subunit alpha-7 isoform X4 [Lipotes vexillifer]
 ref|XP_010950479.1| PREDICTED: importin subunit alpha-7 isoform X2 [Camelus bactrianus]
 ref|XP_010974388.1| PREDICTED: importin subunit alpha-7 [Camelus dromedarius]
Length=536

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_010684628.1| PREDICTED: importin subunit alpha [Beta vulgaris subsp. vulgaris]
Length=531

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 99/203 (49%), Gaps = 31/203 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL     +S  + +KKEA W +SN+ AG+ E  +
Sbjct  306  ALRTVGNIVTGDDMQTQCIIEHQALPCLLNLLNQSYKKSIKKEACWTISNITAGTKEQIQ  365

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             +  +  +A L+HLL  A FDIKKE A+ + N         G P    + +  LV +GC+
Sbjct  366  AVIEAGIIAPLVHLLQNAEFDIKKEAAWAISNAT-----SGGSP----DQIKFLVSQGCI  416

Query  375  SGFVDLVRSVDAEAARLGMQFLELVL------RGMPNREG----PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L      + +    G     ++VE  +G++ +E  
Sbjct  417  KPLCDLLVCPDPRIVTVCLEGLENILKIGEAEKNLGTSGGINVYAQMVEDAEGLDKIENL  476

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A ++L+ Y+ D+
Sbjct  477  QSHDNNEIYEKAVKILETYWVDD  499



>ref|XP_007170657.1| PREDICTED: importin subunit alpha-7 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=543

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  321  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  380

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  381  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  431

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  432  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  490

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  491  SHENQEIYQKAFDLIEHYFGVE  512



>ref|XP_004967840.1| PREDICTED: importin subunit alpha-1a-like [Setaria italica]
Length=523

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 102/203 (50%), Gaps = 31/203 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL     ++  + +KKEA W +SN+ AG+ +  +
Sbjct  301  ALRTVGNIVTGDDLQTQCIIDHQALPCLLNLLTQNHKKSIKKEACWTISNITAGNKDQIQ  360

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + ++  +A LL LL TA FDIKKE A+ + N   A   GS       E +  LV  GC+
Sbjct  361  AVINAGIIAPLLQLLQTAEFDIKKEAAWAISN---ATSGGSH------EQIKYLVSEGCI  411

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR-GMPNREG---------PKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+ G  ++            +++++ +G+E +E  
Sbjct  412  KPLCDLLVCPDPRIVTVCLEGLENILKVGEHDKTAGATGDINVFAQMIDEHEGLEKIENL  471

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A +LL+ Y+ +E
Sbjct  472  QSHDNNEIYEKAVKLLEAYWMEE  494



>ref|XP_005665232.1| PREDICTED: importin subunit alpha-7 isoform X2 [Sus scrofa]
Length=537

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>ref|XP_003769440.1| PREDICTED: importin subunit alpha-6 [Sarcophilus harrisii]
Length=560

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 97/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  335  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  394

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  395  IQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  445

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C+    DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  446  CIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEARQNGMGINPYCALIEEAYGLDKIEF  505

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A +L++ Y+G E
Sbjct  506  LQSHENQEIYQKAFDLIEHYFGVE  529



>ref|XP_008271998.1| PREDICTED: importin subunit alpha-7 isoform X3 [Oryctolagus cuniculus]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_004900259.1| PREDICTED: importin subunit alpha-7 isoform X1 [Heterocephalus 
glaber]
Length=544

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  322  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  381

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  382  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  432

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  433  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  491

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  492  SHENQEIYQKAFDLIEHYFGVE  513



>dbj|BAA88950.1| importin alpha 1b [Oryza sativa Japonica Group]
Length=534

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 102/203 (50%), Gaps = 32/203 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  310  ALRTVGNIVTGDDMQTQCVIDHQALPCLLNLLTNNHKKSIKKEACWTISNITAGNREQIQ  369

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + +++ +A L+HLL TA FDIKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  370  AVINANIIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------DQIKYLVAQGCI  420

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR----------GMPNREGPKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+          G  N    ++++  +G+E +E  
Sbjct  421  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNSYA-QMIDDAEGLEKIENL  479

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A ++L+ Y+ +E
Sbjct  480  QSHDNTEIYEKAVKMLESYWLEE  502


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 81/160 (51%), Gaps = 28/160 (18%)
 Frame = -3

Query  666  AFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIK  487
            AF+Q      + ++  L+ EAAW L+N+A+G++++ K++  S A+ + + LLS+   D++
Sbjct  128  AFLQ------REDYPQLQFEAAWALTNIASGTSDNTKVVVESGAVPIFVKLLSSPSEDVR  181

Query  486  KEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM----  319
            ++  + LGN  VA D     PK     LV   G     G   L++ ++ E A+L M    
Sbjct  182  EQAVWALGN--VAGDS----PK--CRDLVLASG-----GLYPLLQQLN-EHAKLSMLRNA  227

Query  318  -QFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEEL  202
               L    RG P    P   + +  + AL+R    ++EE+
Sbjct  228  TWTLSNFCRGKPQ---PNFEQVKPALSALQRLIHSQDEEV  264



>ref|XP_006026212.1| PREDICTED: importin subunit alpha-6 isoform X3 [Alligator sinensis]
Length=531

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQTVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  477  LQRHENQEIYQKAFELIEHYFGVE  500



>ref|XP_010211331.1| PREDICTED: importin subunit alpha-7 [Tinamus guttatus]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 97/201 (48%), Gaps = 29/201 (14%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+AAG+    + 
Sbjct  312  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNIAAGNRAQIQA  371

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  GC+ 
Sbjct  372  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVNLGCIK  422

Query  372  GFVDLVRSVDAEAARLGMQFLELVLR---GMPNREGP------KLVEKEDGIEALERYQF  220
               DL+  +D++  ++ +  LE +LR      N+ G        L+E+  G++ +E  Q 
Sbjct  423  PLCDLLTVMDSKIVQVALNGLENILRLGEQEANQSGTGINPYCSLIEEAYGLDKIEFLQS  482

Query  219  HENEELRGMANELLDKYYGDE  157
            HEN+E+   A +L++ Y+G E
Sbjct  483  HENQEIYQKAFDLIEHYFGVE  503



>ref|XP_003801323.1| PREDICTED: importin subunit alpha-7 [Otolemur garnettii]
Length=476

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  254  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  313

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  314  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  364

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  365  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  423

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  424  SHENQEIYQKAFDLIEHYFGVE  445



>ref|XP_009864306.1| PREDICTED: importin subunit alpha-6 isoform X1 [Apaloderma vittatum]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  482  LQRHENQEIYQKAFELIEHYFGVE  505


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  126  VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  185

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  186  QAVWALGNI  194



>ref|XP_009560128.1| PREDICTED: importin subunit alpha-7 [Cuculus canorus]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 97/201 (48%), Gaps = 29/201 (14%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  312  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  371

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N  +      G P    E +  LV  GC+ 
Sbjct  372  VIDANIFPVLIEILQKAEFRTRKEAAWAITNATLG-----GTP----EQIRYLVNLGCIK  422

Query  372  GFVDLVRSVDAEAARLGMQFLELVLR---GMPNREGP------KLVEKEDGIEALERYQF  220
               DL+  +D++  ++ +  LE +LR      N+ G        L+E+  G++ +E  Q 
Sbjct  423  PLCDLLTVMDSKIVQVALNGLENILRLGEQEANQSGTGINPYCSLIEEAYGLDKIEFLQS  482

Query  219  HENEELRGMANELLDKYYGDE  157
            HEN+E+   A +L++ Y+G E
Sbjct  483  HENQEIYQKAFDLIEHYFGSE  503



>ref|XP_004005081.1| PREDICTED: importin subunit alpha-7 isoform 2 [Ovis aries]
 ref|XP_005906257.1| PREDICTED: importin subunit alpha-7 isoform X2 [Bos mutus]
Length=537

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>gb|EEC78554.1| hypothetical protein OsI_18524 [Oryza sativa Indica Group]
Length=502

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 102/203 (50%), Gaps = 32/203 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  278  ALRTVGNIVTGDDMQTQCVIDHQALPCLLNLLTNNHKKSIKKEACWTISNITAGNREQIQ  337

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + +++ +A L+HLL TA FDIKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  338  AVINANIIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------DQIKYLVAQGCI  388

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR----------GMPNREGPKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+          G  N    ++++  +G+E +E  
Sbjct  389  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNAYA-QMIDDAEGLEKIENL  447

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A ++L+ Y+ +E
Sbjct  448  QSHDNTEIYEKAVKMLESYWLEE  470


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 81/160 (51%), Gaps = 28/160 (18%)
 Frame = -3

Query  666  AFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIK  487
            AF+Q      + ++  L+ EAAW L+N+A+G++++ K++  S A+ + + LLS+   D++
Sbjct  96   AFLQ------REDYPQLQFEAAWALTNIASGTSDNTKVVVESGAVPIFVKLLSSPSEDVR  149

Query  486  KEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM----  319
            ++  + LGN  VA D     PK     LV   G     G   L++ ++ E A+L M    
Sbjct  150  EQAVWALGN--VAGDS----PK--CRDLVLASG-----GLYPLLQQLN-EHAKLSMLRNA  195

Query  318  -QFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEEL  202
               L    RG P    P   + +  + AL+R    ++EE+
Sbjct  196  TWTLSNFCRGKPQ---PNFEQVKPALSALQRLIHSQDEEV  232



>ref|XP_448210.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG61161.1| unnamed protein product [Candida glabrata]
Length=543

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  705  TNAVLVAGNEIT--DAFIQAQVKC---------LKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T  D   Q  + C         L S    ++KEA W +SN+ AG+ E  
Sbjct  318  TPALRAVGNIVTGNDLHTQVVINCGVLSALRNLLSSPKESIRKEACWTISNITAGNTEQI  377

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  ++ +  L+ LL TA + IKKE  + + N   A   G   P++I      +V +GC
Sbjct  378  QAVVDANLIPPLIKLLETAEYKIKKEACWAISN---ASSGGLQRPEIIR----YMVSQGC  430

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVL---------RGMPNREGPKLVEKEDGIEALERY  226
            +    DL+   D     + +  LE +L         RG+   E   L+EK  G+E +   
Sbjct  431  IKPLCDLLEIADNRIIEVTLDALENILKMGETDKEARGLAINENADLIEKAGGMEKIFNC  490

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q +EN+ +   A ++++ Y+G+E
Sbjct  491  QQNENDRIYEKAYKIIETYFGEE  513



>ref|XP_004178435.1| hypothetical protein TBLA_0B00730 [Tetrapisispora blattae CBS 
6284]
 emb|CCH58916.1| hypothetical protein TBLA_0B00730 [Tetrapisispora blattae CBS 
6284]
Length=540

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 95/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-----------KCLKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T ++   GN +T   +Q QV             L S    +KKE  W +SN+ AG+ +  
Sbjct  315  TPSLRAVGNIVTGNDLQTQVVINCGVLPALRNTLNSPKESIKKETCWTISNITAGNTDQI  374

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  +D +  L+ LL TA +  KKE  + + N   A   G   P++I      LV +GC
Sbjct  375  QAVIDADIIPSLIKLLETAEYKTKKEACWAISN---ASSGGLSRPEIIR----YLVSQGC  427

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVL---------RGMPNREGPKLVEKEDGIEALERY  226
            +    DL+   D +   + +  LE +L         RG+   E  + +EK  G+E +   
Sbjct  428  IKPLCDLLEIADTKIIEVTLDALENILKAGENDKEVRGLNFNEFAEYIEKAGGMENIFNC  487

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q +ENE++   A  +++ Y+G+E
Sbjct  488  QQNENEKIYDKAYRIIETYFGEE  510



>ref|XP_008271999.1| PREDICTED: importin subunit alpha-7 isoform X4 [Oryctolagus cuniculus]
 ref|XP_008272000.1| PREDICTED: importin subunit alpha-7 isoform X4 [Oryctolagus cuniculus]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>gb|KGL76141.1| Importin subunit alpha-7, partial [Tinamus guttatus]
Length=535

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 97/201 (48%), Gaps = 29/201 (14%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+AAG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNIAAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVNLGCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLR---GMPNREGP------KLVEKEDGIEALERYQF  220
               DL+  +D++  ++ +  LE +LR      N+ G        L+E+  G++ +E  Q 
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILRLGEQEANQSGTGINPYCSLIEEAYGLDKIEFLQS  484

Query  219  HENEELRGMANELLDKYYGDE  157
            HEN+E+   A +L++ Y+G E
Sbjct  485  HENQEIYQKAFDLIEHYFGVE  505



>ref|XP_008846295.1| PREDICTED: importin subunit alpha-7 isoform X2 [Nannospalax galili]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>gb|ELK02023.1| Importin subunit alpha-7 [Pteropus alecto]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_007468725.1| PREDICTED: importin subunit alpha-7 isoform X1 [Lipotes vexillifer]
Length=543

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  321  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  380

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  381  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  431

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  432  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  490

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  491  SHENQEIYQKAFDLIEHYFGVE  512



>ref|XP_005317797.1| PREDICTED: importin subunit alpha-7 isoform X2 [Ictidomys tridecemlineatus]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>gb|KFP74630.1| Importin subunit alpha-6, partial [Apaloderma vittatum]
Length=539

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  314  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  373

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   VL+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  374  IQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  424

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  425  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  484

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  485  LQRHENQEIYQKAFELIEHYFGVE  508


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  129  VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  188

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  189  QAVWALGNI  197



>gb|EFB27376.1| hypothetical protein PANDA_010861 [Ailuropoda melanoleuca]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_006026211.1| PREDICTED: importin subunit alpha-6 isoform X2 [Alligator sinensis]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  311  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  370

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  371  IQTVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  421

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  422  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  481

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  482  LQRHENQEIYQKAFELIEHYFGVE  505



>ref|XP_004900260.1| PREDICTED: importin subunit alpha-7 isoform X2 [Heterocephalus 
glaber]
Length=544

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  322  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQA  381

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  382  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  432

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  433  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  491

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  492  SHENQEIYQKAFDLIEHYFGVE  513



>ref|NP_001054692.1| Os05g0155500 [Oryza sativa Japonica Group]
 sp|Q9SLX0.2|IMA1B_ORYSJ RecName: Full=Importin subunit alpha-1b [Oryza sativa Japonica 
Group]
 dbj|BAF16606.1| Os05g0155500 [Oryza sativa Japonica Group]
 gb|EEE62387.1| hypothetical protein OsJ_17176 [Oryza sativa Japonica Group]
 gb|AGW80665.1| hypothetical protein [Oryza sativa Japonica Group]
Length=534

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 102/203 (50%), Gaps = 32/203 (16%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQ-------VKCL-----KSEHRILKKEAAWVLSNLAAGSAEHKK  556
            A+   GN +T   +Q Q       + CL      +  + +KKEA W +SN+ AG+ E  +
Sbjct  310  ALRTVGNIVTGDDMQTQCVIDHQALPCLLNLLTNNHKKSIKKEACWTISNITAGNREQIQ  369

Query  555  LIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCL  376
             + +++ +A L+HLL TA FDIKKE A+ + N   A   G+       + +  LV +GC+
Sbjct  370  AVINANIIAPLVHLLQTAEFDIKKEAAWAISN---ATSGGTH------DQIKYLVAQGCI  420

Query  375  SGFVDLVRSVDAEAARLGMQFLELVLR----------GMPNREGPKLVEKEDGIEALERY  226
                DL+   D     + ++ LE +L+          G  N    ++++  +G+E +E  
Sbjct  421  KPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLGAGDVNSYA-QMIDDAEGLEKIENL  479

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q H+N E+   A ++L+ Y+ +E
Sbjct  480  QSHDNTEIYEKAVKMLESYWLEE  502


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 81/160 (51%), Gaps = 28/160 (18%)
 Frame = -3

Query  666  AFIQAQVKCLKSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIK  487
            AF+Q      + ++  L+ EAAW L+N+A+G++++ K++  S A+ + + LLS+   D++
Sbjct  128  AFLQ------REDYPQLQFEAAWALTNIASGTSDNTKVVVESGAVPIFVKLLSSPSEDVR  181

Query  486  KEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLSGFVDLVRSVDAEAARLGM----  319
            ++  + LGN  VA D     PK     LV   G     G   L++ ++ E A+L M    
Sbjct  182  EQAVWALGN--VAGDS----PK--CRDLVLASG-----GLYPLLQQLN-EHAKLSMLRNA  227

Query  318  -QFLELVLRGMPNREGPKLVEKEDGIEALERYQFHENEEL  202
               L    RG P    P   + +  + AL+R    ++EE+
Sbjct  228  TWTLSNFCRGKPQ---PNFEQVKPALSALQRLIHSQDEEV  264



>ref|XP_009914620.1| PREDICTED: importin subunit alpha-6 isoform X2 [Haliaeetus albicilla]
 ref|XP_010571723.1| PREDICTED: importin subunit alpha-6 isoform X2 [Haliaeetus leucocephalus]
Length=478

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  253  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  312

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  313  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  363

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  364  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  423

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  424  LQRHENQEIYQKAFELIEHYFGVE  447


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L ++E+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  68   VQRFVKFLERNENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  127

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  128  QAVWALGNI  136



>ref|XP_008692699.1| PREDICTED: importin subunit alpha-7 isoform X2 [Ursus maritimus]
 ref|XP_011226584.1| PREDICTED: importin subunit alpha-7 isoform X2 [Ailuropoda melanoleuca]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_004591683.1| PREDICTED: importin subunit alpha-7 isoform X1 [Ochotona princeps]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_006924365.1| PREDICTED: importin subunit alpha-7 [Pteropus alecto]
 ref|XP_011356133.1| PREDICTED: importin subunit alpha-7 [Pteropus vampyrus]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_006258983.1| PREDICTED: importin subunit alpha-6 isoform X2 [Alligator mississippiensis]
Length=478

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  253  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  312

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  313  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  363

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  364  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  423

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  424  LQRHENQEIYQKAFELIEHYFGVE  447



>ref|XP_004406508.1| PREDICTED: importin subunit alpha-7 [Odobenus rosmarus divergens]
Length=505

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  283  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  342

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  343  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  393

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  394  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  452

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  453  SHENQEIYQKAFDLIEHYFGVE  474



>ref|XP_008999056.1| PREDICTED: importin subunit alpha-7 isoform X2 [Callithrix jacchus]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>dbj|BAK62519.1| importin alpha-7 subunit [Pan troglodytes]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>dbj|BAE00657.1| unnamed protein product [Macaca fascicularis]
Length=554

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_008951744.1| PREDICTED: importin subunit alpha-7 isoform X3 [Pan paniscus]
 ref|XP_009202055.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009202060.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009202066.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009202071.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009202073.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009202075.1| PREDICTED: importin subunit alpha-7 isoform X3 [Papio anubis]
 ref|XP_009450624.1| PREDICTED: importin subunit alpha-7 isoform X2 [Pan troglodytes]
 ref|XP_009450629.1| PREDICTED: importin subunit alpha-7 isoform X2 [Pan troglodytes]
 ref|XP_009450633.1| PREDICTED: importin subunit alpha-7 isoform X2 [Pan troglodytes]
 ref|XP_009450637.1| PREDICTED: importin subunit alpha-7 isoform X2 [Pan troglodytes]
 ref|XP_010346441.1| PREDICTED: importin subunit alpha-7 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_003989858.1| PREDICTED: importin subunit alpha-7 isoform X1 [Felis catus]
 ref|XP_005617710.1| PREDICTED: importin subunit alpha-7 isoform X1 [Canis lupus familiaris]
 ref|XP_006734215.1| PREDICTED: importin subunit alpha-7 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_007092467.1| PREDICTED: importin subunit alpha-7 isoform X1 [Panthera tigris 
altaica]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>dbj|BAE01108.1| unnamed protein product [Macaca fascicularis]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_004678794.1| PREDICTED: importin subunit alpha-7 isoform X1 [Condylura cristata]
 ref|XP_005617711.1| PREDICTED: importin subunit alpha-7 isoform X2 [Canis lupus familiaris]
 ref|XP_006934594.1| PREDICTED: importin subunit alpha-7 isoform X2 [Felis catus]
 ref|XP_007092468.1| PREDICTED: importin subunit alpha-7 isoform X2 [Panthera tigris 
altaica]
 ref|XP_008576460.1| PREDICTED: importin subunit alpha-7 [Galeopterus variegatus]
 ref|XP_008692698.1| PREDICTED: importin subunit alpha-7 isoform X1 [Ursus maritimus]
 ref|XP_011226583.1| PREDICTED: importin subunit alpha-7 isoform X1 [Ailuropoda melanoleuca]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_004678795.1| PREDICTED: importin subunit alpha-7 isoform X2 [Condylura cristata]
Length=537

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>ref|NP_036448.1| importin subunit alpha-7 [Homo sapiens]
 ref|NP_001125426.1| importin subunit alpha-7 [Pongo abelii]
 ref|NP_001253921.1| importin subunit alpha-7 [Macaca mulatta]
 ref|NP_001258602.1| importin subunit alpha-7 [Pan troglodytes]
 ref|XP_003891547.1| PREDICTED: importin subunit alpha-7 isoform X2 [Papio anubis]
 ref|XP_005544176.1| PREDICTED: importin subunit alpha-7 isoform X2 [Macaca fascicularis]
 ref|XP_007977797.1| PREDICTED: importin subunit alpha-7 [Chlorocebus sabaeus]
 ref|XP_008951743.1| PREDICTED: importin subunit alpha-7 isoform X2 [Pan paniscus]
 ref|XP_010352195.1| PREDICTED: importin subunit alpha-7 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010346440.1| PREDICTED: importin subunit alpha-7 isoform X1 [Saimiri boliviensis 
boliviensis]
 sp|O60684.1|IMA7_HUMAN RecName: Full=Importin subunit alpha-7; AltName: Full=Karyopherin 
subunit alpha-6 [Homo sapiens]
 sp|Q5RBV0.1|IMA7_PONAB RecName: Full=Importin subunit alpha-7; AltName: Full=Karyopherin 
subunit alpha-6 [Pongo abelii]
 gb|AAC15233.1| importin alpha 7 subunit [Homo sapiens]
 gb|AAH20520.1| Karyopherin alpha 6 (importin alpha 7) [Homo sapiens]
 gb|AAP88845.1| karyopherin alpha 6 (importin alpha 7) [Homo sapiens]
 emb|CAH90760.1| hypothetical protein [Pongo abelii]
 gb|AAX41800.1| karyopherin alpha 6 [synthetic construct]
 gb|AAX41801.1| karyopherin alpha 6 [synthetic construct]
 gb|AAX41802.1| karyopherin alpha 6 [synthetic construct]
 gb|AAX41803.1| karyopherin alpha 6 [synthetic construct]
 gb|EAX07567.1| karyopherin alpha 6 (importin alpha 7), isoform CRA_a [Homo sapiens]
 gb|EAX07568.1| karyopherin alpha 6 (importin alpha 7), isoform CRA_a [Homo sapiens]
 gb|ABM82513.1| karyopherin alpha 6 (importin alpha 7) [synthetic construct]
 gb|ABM85707.1| karyopherin alpha 6 (importin alpha 7) [synthetic construct]
 dbj|BAG37874.1| unnamed protein product [Homo sapiens]
 dbj|BAI45425.1| karyopherin alpha 6 [synthetic construct]
 gb|AIC51005.1| KPNA6, partial [synthetic construct]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_009950957.1| PREDICTED: importin subunit alpha-6 isoform X3 [Leptosomus discolor]
Length=497

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  272  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  331

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  332  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNA-----TSGGTP----EQIRYLVALG  382

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  383  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGVNPYCALIEEAYGLDKIEF  442

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  443  LQRHENQEIYQKAFELIEHYFGVE  466


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  87   VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  146

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  147  QAVWALGNI  155



>dbj|BAG63185.1| unnamed protein product [Homo sapiens]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_007538559.1| PREDICTED: importin subunit alpha-7 isoform X2 [Erinaceus europaeus]
Length=536

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  314  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  373

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  374  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  424

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  425  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  483

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  484  SHENQEIYQKAFDLIEHYFGVE  505



>ref|XP_008999057.1| PREDICTED: importin subunit alpha-7 isoform X3 [Callithrix jacchus]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>ref|XP_006734216.1| PREDICTED: importin subunit alpha-7 isoform X2 [Leptonychotes 
weddellii]
Length=537

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  315  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  374

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  375  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  425

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  426  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  484

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  485  SHENQEIYQKAFDLIEHYFGVE  506



>ref|XP_007538558.1| PREDICTED: importin subunit alpha-7 isoform X1 [Erinaceus europaeus]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_004603617.1| PREDICTED: importin subunit alpha-7 isoform X2 [Sorex araneus]
Length=538

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  316  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  375

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  376  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  426

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  427  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  485

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  486  SHENQEIYQKAFDLIEHYFGVE  507



>ref|XP_004591684.1| PREDICTED: importin subunit alpha-7 isoform X2 [Ochotona princeps]
Length=539

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  317  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  376

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  377  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  427

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  428  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  486

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  487  SHENQEIYQKAFDLIEHYFGVE  508



>ref|XP_006158180.1| PREDICTED: importin subunit alpha-7 isoform X1 [Tupaia chinensis]
Length=533

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  311  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  370

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  371  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  421

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  422  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  480

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  481  SHENQEIYQKAFDLIEHYFGVE  502



>gb|ELW48631.1| Importin subunit alpha-7 [Tupaia chinensis]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_004940344.1| PREDICTED: importin subunit alpha-6 isoform X9 [Gallus gallus]
Length=497

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  272  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  331

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  332  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  382

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  383  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGINPYCALIEEAYGLDKIEF  442

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  443  LQRHENQEIYQKAFELIEHYFGVE  466


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  87   VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  146

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  147  QAVWALGNI  155



>ref|XP_002720679.1| PREDICTED: importin subunit alpha-7 isoform X2 [Oryctolagus cuniculus]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_003891548.1| PREDICTED: importin subunit alpha-7 isoform X1 [Papio anubis]
 ref|XP_005544175.1| PREDICTED: importin subunit alpha-7 isoform X1 [Macaca fascicularis]
Length=566

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  344  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  403

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  404  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  454

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  455  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  513

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  514  SHENQEIYQKAFDLIEHYFGVE  535



>ref|XP_010352204.1| PREDICTED: importin subunit alpha-7 isoform X2 [Rhinopithecus 
roxellana]
Length=530

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  308  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  367

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  368  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  418

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  419  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  477

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  478  SHENQEIYQKAFDLIEHYFGVE  499



>ref|XP_004603616.1| PREDICTED: importin subunit alpha-7 isoform X1 [Sorex araneus]
Length=541

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  319  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  378

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  379  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  429

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  430  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  488

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  489  SHENQEIYQKAFDLIEHYFGVE  510



>ref|XP_008271996.1| PREDICTED: importin subunit alpha-7 isoform X1 [Oryctolagus cuniculus]
Length=558

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  336  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  395

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  396  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  446

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  447  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  505

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  506  SHENQEIYQKAFDLIEHYFGVE  527



>ref|XP_004784121.1| PREDICTED: importin subunit alpha-7 [Mustela putorius furo]
Length=487

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  265  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAPVRA  324

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  325  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  375

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  376  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  434

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  435  SHENQEIYQKAFDLIEHYFGVE  456



>ref|XP_009950956.1| PREDICTED: importin subunit alpha-6 isoform X2 [Leptosomus discolor]
Length=531

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 29/204 (14%)
 Frame = -3

Query  708  ITNAVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEH  562
            ++ A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+   
Sbjct  306  VSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQ  365

Query  561  KKLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRG  382
             + +  ++   +L+ +L  A F  +KE A+ + N         G P    E +  LV  G
Sbjct  366  IQAVIDANIFPILIEILQKAEFRTRKEAAWAITNAT-----SGGTP----EQIRYLVALG  416

Query  381  CLSGFVDLVRSVDAEAARLGMQFLELVLR---------GMPNREGPKLVEKEDGIEALER  229
            C     DL+  +D++  ++ +  LE +LR         GM       L+E+  G++ +E 
Sbjct  417  CTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGMGVNPYCALIEEAYGLDKIEF  476

Query  228  YQFHENEELRGMANELLDKYYGDE  157
             Q HEN+E+   A EL++ Y+G E
Sbjct  477  LQRHENQEIYQKAFELIEHYFGVE  500


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -3

Query  660  IQAQVKCL-KSEHRILKKEAAWVLSNLAAGSAEHKKLIHSSDALAVLLHLLSTAPFDIKK  484
            +Q  VK L +SE+  L+ EAAW L+N+A+G+  H K++  + A+ + + LLS+   D+++
Sbjct  121  VQRFVKFLERSENYTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLSSEHEDVQE  180

Query  483  EVAYVLGNL  457
            +  + LGN+
Sbjct  181  QAVWALGNI  189



>ref|XP_005270768.1| PREDICTED: importin subunit alpha-7 isoform X1 [Homo sapiens]
 ref|XP_008951742.1| PREDICTED: importin subunit alpha-7 isoform X1 [Pan paniscus]
 ref|XP_009450619.1| PREDICTED: importin subunit alpha-7 isoform X1 [Pan troglodytes]
Length=566

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  344  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  403

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  404  VIDANIFPVLIEILQKAEFRTRKEAAWAITNAT-----SGGTPEQI-RYLVSL---GCIK  454

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  455  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  513

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  514  SHENQEIYQKAFDLIEHYFGVE  535



>ref|XP_004740986.1| PREDICTED: importin subunit alpha-7 [Mustela putorius furo]
Length=539

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 101/202 (50%), Gaps = 31/202 (15%)
 Frame = -3

Query  699  AVLVAGNEITDAFIQAQV--KC---------LKSEHRILKKEAAWVLSNLAAGSAEHKKL  553
            A+   GN +T   IQ QV   C         L S    ++KEA W +SN+ AG+    + 
Sbjct  317  ALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQA  376

Query  552  IHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGCLS  373
            +  ++   VL+ +L  A F  +KE A+ + N         G P+ I  +LVSL   GC+ 
Sbjct  377  VIDANIFPVLIEILQKAEFRTRKEAAWAITNA-----TSGGTPEQI-RYLVSL---GCIK  427

Query  372  GFVDLVRSVDAEAARLGMQFLELVLRGMPNREGPK----------LVEKEDGIEALERYQ  223
               DL+  +D++  ++ +  LE +LR +  +EG +          L+E+  G++ +E  Q
Sbjct  428  PLCDLLTVMDSKIVQVALNGLENILR-LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQ  486

Query  222  FHENEELRGMANELLDKYYGDE  157
             HEN+E+   A +L++ Y+G E
Sbjct  487  SHENQEIYQKAFDLIEHYFGVE  508



>ref|XP_003686153.1| hypothetical protein TPHA_0F02380 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE63719.1| hypothetical protein TPHA_0F02380 [Tetrapisispora phaffii CBS 
4417]
Length=543

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 95/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  705  TNAVLVAGNEITDAFIQAQV-----------KCLKSEHRILKKEAAWVLSNLAAGSAEHK  559
            T A+   GN +T   +Q QV             L S    ++KEA W +SN+ AG+ +  
Sbjct  318  TPALRAVGNIVTGTDLQTQVVINSGVLVALRHLLSSPKESIRKEACWTISNITAGNTDQI  377

Query  558  KLIHSSDALAVLLHLLSTAPFDIKKEVAYVLGNLCVAPDDGSGMPKLILEHLVSLVGRGC  379
            + +  +D L  L+ LL TA +  KKE  + + N   A   G   P++I      LV +GC
Sbjct  378  QSVIDADILPSLIRLLETADYKTKKEACWAISN---ASSGGLHRPEIIR----YLVAQGC  430

Query  378  LSGFVDLVRSVDAEAARLGMQFLELVL---------RGMPNREGPKLVEKEDGIEALERY  226
            +    DL+   D +   + +  LE +L         RG+   E    +EK  G+E +   
Sbjct  431  IKPLCDLLEIADNKIVEVTLDALENILKMGEADKEARGLTINENADYIEKAGGMEKIFNC  490

Query  225  QFHENEELRGMANELLDKYYGDE  157
            Q +EN+++   A  +++ Y+G+E
Sbjct  491  QQNENDKIYEKAYTIIETYFGEE  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395