BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031F24

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797232.1|  PREDICTED: cytochrome P450 86A8-like               152   5e-40   Nicotiana sylvestris
ref|XP_006339587.1|  PREDICTED: cytochrome P450 86A2-like               154   1e-39   Solanum tuberosum [potatoes]
emb|CDP08799.1|  unnamed protein product                                149   1e-38   Coffea canephora [robusta coffee]
ref|XP_004229934.1|  PREDICTED: cytochrome P450 86A8-like               150   2e-38   Solanum lycopersicum
ref|XP_009629836.1|  PREDICTED: cytochrome P450 86A8                    146   4e-38   Nicotiana tomentosiformis
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like               148   3e-37   Glycine max [soybeans]
ref|XP_003525390.1|  PREDICTED: cytochrome P450 86A8                    140   4e-37   Glycine max [soybeans]
ref|XP_006583288.1|  PREDICTED: cytochrome P450 86A8-like               147   5e-37   Glycine max [soybeans]
gb|ABC68403.1|  cytochrome P450 monooxygenase CYP86A24                  139   9e-37   Glycine max [soybeans]
gb|KHN16811.1|  Cytochrome P450 86A2                                    139   1e-36   Glycine soja [wild soybean]
ref|XP_006396237.1|  hypothetical protein EUTSA_v10028550mg             142   3e-36   Eutrema salsugineum [saltwater cress]
emb|CDY66201.1|  BnaA09g51710D                                          141   4e-36   Brassica napus [oilseed rape]
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like               145   4e-36   Cicer arietinum [garbanzo]
ref|XP_010053722.1|  PREDICTED: cytochrome P450 86A8-like               144   5e-36   Eucalyptus grandis [rose gum]
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                    143   5e-36   
gb|KFK30625.1|  hypothetical protein AALP_AA6G006200                    141   5e-36   Arabis alpina [alpine rockcress]
gb|AAL75903.1|  AT4g00360/A_IG005I10_21                                 141   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287404.1|  hypothetical protein CARUB_v10000610mg             140   6e-36   Capsella rubella
ref|XP_007135090.1|  hypothetical protein PHAVU_010G099900g             144   7e-36   Phaseolus vulgaris [French bean]
ref|XP_004245593.1|  PREDICTED: cytochrome P450 86A7                    144   7e-36   Solanum lycopersicum
ref|NP_191946.1|  cytochrome P450 86A2                                  140   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670184.1|  PREDICTED: cytochrome P450 86A8                    139   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087951.1|  Cytochrome P450 86A2                               140   1e-35   Morus notabilis
ref|XP_009111490.1|  PREDICTED: cytochrome P450 86A2                    140   1e-35   Brassica rapa
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg             142   1e-35   Prunus persica
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                    143   1e-35   Vitis vinifera
ref|XP_010419577.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    139   1e-35   Camelina sativa [gold-of-pleasure]
emb|CBI34653.3|  unnamed protein product                                141   1e-35   Vitis vinifera
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like               142   1e-35   Malus domestica [apple tree]
gb|KDP28614.1|  hypothetical protein JCGZ_14385                         141   2e-35   Jatropha curcas
gb|AAZ39642.1|  cytochrome P450 fatty acid omega-hydroxylase            141   2e-35   Petunia x hybrida [garden petunia]
ref|XP_010089087.1|  Cytochrome P450 86A2                               143   2e-35   Morus notabilis
ref|XP_004138498.1|  PREDICTED: cytochrome P450 86A2-like               142   2e-35   Cucumis sativus [cucumbers]
ref|XP_002892051.1|  CYP86A4                                            140   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                    141   2e-35   Prunus mume [ume]
ref|XP_008244638.1|  PREDICTED: cytochrome P450 86A8-like               142   2e-35   Prunus mume [ume]
emb|CDP12038.1|  unnamed protein product                                142   2e-35   Coffea canephora [robusta coffee]
ref|XP_007160078.1|  hypothetical protein PHAVU_002G290700g             135   3e-35   Phaseolus vulgaris [French bean]
gb|KCW78083.1|  hypothetical protein EUGRSUZ_D02303                     142   3e-35   Eucalyptus grandis [rose gum]
ref|XP_009128484.1|  PREDICTED: cytochrome P450 86A2                    139   3e-35   Brassica rapa
ref|XP_007051775.1|  Cytochrome P450, family 86, subfamily A, pol...    142   3e-35   
ref|XP_006343967.1|  PREDICTED: cytochrome P450 86A2-like               141   3e-35   Solanum tuberosum [potatoes]
gb|EPS61958.1|  hypothetical protein M569_12832                         142   3e-35   Genlisea aurea
ref|XP_002275115.1|  PREDICTED: cytochrome P450 86A8                    142   4e-35   Vitis vinifera
emb|CAN80040.1|  hypothetical protein VITISV_037194                     141   4e-35   Vitis vinifera
ref|XP_010426970.1|  PREDICTED: cytochrome P450 86A2                    138   4e-35   
emb|CDY15167.1|  BnaC05g00460D                                          140   4e-35   Brassica napus [oilseed rape]
ref|XP_002875027.1|  CYP86A2                                            137   5e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009119710.1|  PREDICTED: cytochrome P450 86A4                    140   5e-35   Brassica rapa
emb|CBI40391.3|  unnamed protein product                                141   5e-35   Vitis vinifera
ref|XP_002511875.1|  cytochrome P450, putative                          141   5e-35   
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase       141   6e-35   Medicago truncatula
ref|XP_011022670.1|  PREDICTED: cytochrome P450 86A7-like               140   6e-35   Populus euphratica
ref|XP_007051777.1|  Cytochrome P450 86A2 isoform 3                     141   6e-35   
ref|XP_008458223.1|  PREDICTED: cytochrome P450 86A8-like               139   7e-35   Cucumis melo [Oriental melon]
gb|AJD25207.1|  cytochrome P450 CYP86A91                                138   8e-35   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002509820.1|  cytochrome P450, putative                          140   9e-35   Ricinus communis
ref|XP_006647656.1|  PREDICTED: cytochrome P450 86A2-like               140   1e-34   Oryza brachyantha
ref|NP_171666.1|  cytochrome P450, family 86, subfamily A, polype...    138   1e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07223.1|  BnaCnng02380D                                          136   1e-34   
ref|XP_010275632.1|  PREDICTED: cytochrome P450 86A8-like               140   2e-34   Nelumbo nucifera [Indian lotus]
emb|CAN80156.1|  hypothetical protein VITISV_023926                     140   2e-34   Vitis vinifera
ref|XP_010544737.1|  PREDICTED: cytochrome P450 86A8                    134   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_010522971.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    138   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_009797448.1|  PREDICTED: cytochrome P450 86A7-like               137   4e-34   Nicotiana sylvestris
ref|XP_008342161.1|  PREDICTED: cytochrome P450 86A8                    137   4e-34   
gb|KEH21079.1|  cytochrome P450 family 94 protein                       137   5e-34   Medicago truncatula
gb|KDP25417.1|  hypothetical protein JCGZ_20573                         137   5e-34   Jatropha curcas
gb|EYU38337.1|  hypothetical protein MIMGU_mgv1a005555mg                138   5e-34   Erythranthe guttata [common monkey flower]
ref|XP_011092582.1|  PREDICTED: cytochrome P450 86A8-like               137   6e-34   Sesamum indicum [beniseed]
ref|XP_009143197.1|  PREDICTED: cytochrome P450 86A8                    138   6e-34   Brassica rapa
ref|XP_009367816.1|  PREDICTED: cytochrome P450 86A8 isoform X1         136   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_002320802.1|  cytochrome P450 family protein                     136   8e-34   Populus trichocarpa [western balsam poplar]
gb|AJD25208.1|  cytochrome P450 CYP86A92                                137   8e-34   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010255320.1|  PREDICTED: cytochrome P450 86A8                    136   8e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009367817.1|  PREDICTED: cytochrome P450 86A8 isoform X2         135   9e-34   Pyrus x bretschneideri [bai li]
gb|KDO86201.1|  hypothetical protein CISIN_1g009235mg                   138   9e-34   Citrus sinensis [apfelsine]
ref|XP_006445018.1|  hypothetical protein CICLE_v10019633mg             138   9e-34   
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like               135   1e-33   Populus euphratica
ref|XP_009118821.1|  PREDICTED: cytochrome P450 86A4                    135   1e-33   Brassica rapa
gb|ACG38359.1|  cytochrome P450 CYP86A35                                137   1e-33   Zea mays [maize]
gb|AFW72704.1|  putative cytochrome P450 superfamily protein            137   1e-33   
dbj|BAC42067.1|  unknown protein                                        135   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001183394.1|  uncharacterized protein LOC100501810               137   1e-33   
ref|XP_009397933.1|  PREDICTED: cytochrome P450 86A2-like               134   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX90044.1|  BnaA10g00380D                                          135   2e-33   
gb|KJB25882.1|  hypothetical protein B456_004G213300                    134   2e-33   Gossypium raimondii
ref|XP_010053250.1|  PREDICTED: cytochrome P450 86A7                    137   3e-33   Eucalyptus grandis [rose gum]
ref|XP_006397782.1|  hypothetical protein EUTSA_v10001389mg             136   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006418437.1|  hypothetical protein EUTSA_v10007350mg             134   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011072860.1|  PREDICTED: cytochrome P450 86A7                    135   4e-33   Sesamum indicum [beniseed]
ref|XP_007218993.1|  hypothetical protein PRUPE_ppa004034mg             136   4e-33   Prunus persica
ref|XP_004306772.1|  PREDICTED: cytochrome P450 86A8-like               136   4e-33   Fragaria vesca subsp. vesca
ref|XP_002304502.2|  cytochrome P450 family protein                     134   4e-33   Populus trichocarpa [western balsam poplar]
emb|CDY38015.1|  BnaCnng08760D                                          134   4e-33   Brassica napus [oilseed rape]
ref|XP_010506590.1|  PREDICTED: cytochrome P450 86A8-like isoform X1    135   4e-33   Camelina sativa [gold-of-pleasure]
gb|AAG17470.1|AF123610_9  cytochrome P450                               135   5e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004503701.1|  PREDICTED: cytochrome P450 86A2-like               133   5e-33   Cicer arietinum [garbanzo]
gb|EMT14997.1|  Cytochrome P450 86A2                                    135   5e-33   
emb|CDX74778.1|  BnaA05g05240D                                          135   6e-33   
ref|XP_006652635.1|  PREDICTED: cytochrome P450 86A4-like               135   6e-33   Oryza brachyantha
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A7                    133   6e-33   Fragaria vesca subsp. vesca
gb|EYU23445.1|  hypothetical protein MIMGU_mgv1a026937mg                135   7e-33   Erythranthe guttata [common monkey flower]
dbj|BAJ86471.1|  predicted protein                                      134   8e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001047674.1|  Os02g0666500                                       134   1e-32   
gb|EEC73748.1|  hypothetical protein OsI_08390                          133   1e-32   Oryza sativa Indica Group [Indian rice]
gb|EYU32135.1|  hypothetical protein MIMGU_mgv1a003916mg                135   1e-32   Erythranthe guttata [common monkey flower]
gb|KJB24757.1|  hypothetical protein B456_004G159000                    133   1e-32   Gossypium raimondii
ref|XP_009402078.1|  PREDICTED: cytochrome P450 86A8-like               134   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009610115.1|  PREDICTED: cytochrome P450 86A7-like               132   1e-32   Nicotiana tomentosiformis
ref|XP_003570074.1|  PREDICTED: cytochrome P450 86A2-like               133   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_002886391.1|  predicted protein                                  124   1e-32   
ref|NP_182121.1|  cytochrome P450, family 86, subfamily A, polype...    132   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955136.1|  PREDICTED: cytochrome P450 86A2-like               134   2e-32   
ref|XP_004976485.1|  PREDICTED: cytochrome P450 86A2-like               133   2e-32   Setaria italica
gb|EEE61483.1|  hypothetical protein OsJ_15764                          134   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95147.1|  hypothetical protein OsI_16965                          134   2e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001053543.1|  Os04g0560100                                       133   2e-32   
ref|XP_002452782.1|  hypothetical protein SORBIDRAFT_04g032410          133   4e-32   Sorghum bicolor [broomcorn]
ref|XP_006293977.1|  hypothetical protein CARUB_v10022968mg             131   4e-32   Capsella rubella
ref|XP_010508082.1|  PREDICTED: cytochrome P450 86A8                    132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010518254.1|  PREDICTED: cytochrome P450 86A8-like               131   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002448320.1|  hypothetical protein SORBIDRAFT_06g025170          131   6e-32   Sorghum bicolor [broomcorn]
gb|ACN34158.1|  unknown                                                 131   7e-32   Zea mays [maize]
ref|XP_008667081.1|  PREDICTED: uncharacterized protein LOC100192...    132   8e-32   Zea mays [maize]
ref|XP_002882043.1|  CYP86A8                                            130   8e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    125   9e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001130907.1|  putative cytochrome P450 superfamily protein...    131   9e-32   Zea mays [maize]
ref|XP_006439526.1|  hypothetical protein CICLE_v10019616mg             129   9e-32   Citrus clementina [clementine]
gb|KDO76250.1|  hypothetical protein CISIN_1g037522mg                   129   9e-32   Citrus sinensis [apfelsine]
ref|XP_008667082.1|  PREDICTED: uncharacterized protein LOC100192...    131   9e-32   
ref|XP_006476545.1|  PREDICTED: cytochrome P450 86A8-like               129   9e-32   Citrus sinensis [apfelsine]
gb|AIU99467.1|  P450                                                    129   1e-31   Citrus maxima [buntan]
emb|CDY18885.1|  BnaC04g04650D                                          131   1e-31   Brassica napus [oilseed rape]
ref|XP_008338834.1|  PREDICTED: cytochrome P450 86A8                    129   1e-31   Malus domestica [apple tree]
ref|XP_007040281.1|  Cytochrome P450, family 86, subfamily A, pol...    130   1e-31   
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               124   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               124   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010676469.1|  PREDICTED: cytochrome P450 86A2-like               130   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    124   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65207.1|  putative cytochrome P450                                124   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52139.1|  hypothetical protein B456_008G247600                    128   2e-31   Gossypium raimondii
ref|XP_004143898.1|  PREDICTED: cytochrome P450 86A2-like               128   2e-31   Cucumis sativus [cucumbers]
gb|KJB41354.1|  hypothetical protein B456_007G100300                    130   2e-31   Gossypium raimondii
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                    128   2e-31   Cucumis melo [Oriental melon]
ref|XP_008804444.1|  PREDICTED: cytochrome P450 86A8-like               126   3e-31   Phoenix dactylifera
ref|XP_009400252.1|  PREDICTED: cytochrome P450 86A2-like               130   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    127   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010907215.1|  PREDICTED: cytochrome P450 86A8-like               130   4e-31   Elaeis guineensis
ref|XP_010262795.1|  PREDICTED: cytochrome P450 86A1                    127   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010556547.1|  PREDICTED: cytochrome P450 86A2-like               127   8e-31   Tarenaya hassleriana [spider flower]
dbj|BAJ88802.1|  predicted protein                                      128   8e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             119   1e-30   Capsella rubella
ref|XP_011032144.1|  PREDICTED: cytochrome P450 86A1                    120   2e-30   Populus euphratica
ref|XP_002314117.1|  Cytochrome P450 86A1 family protein                120   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008804035.1|  PREDICTED: cytochrome P450 86A8-like               128   2e-30   Phoenix dactylifera
gb|AFN53663.1|  cytochrome P450                                         123   3e-30   Linum usitatissimum
gb|KJB19906.1|  hypothetical protein B456_003G123900                    122   4e-30   Gossypium raimondii
ref|XP_010043449.1|  PREDICTED: cytochrome P450 86A1                    126   5e-30   Eucalyptus grandis [rose gum]
ref|XP_011082379.1|  PREDICTED: cytochrome P450 86A1                    120   6e-30   Sesamum indicum [beniseed]
ref|XP_006306118.1|  hypothetical protein CARUB_v10011562mg             122   6e-30   
gb|KFK37382.1|  hypothetical protein AALP_AA4G249700                    125   6e-30   Arabis alpina [alpine rockcress]
ref|XP_007142224.1|  hypothetical protein PHAVU_008G262600g             122   7e-30   Phaseolus vulgaris [French bean]
ref|XP_002525608.1|  cytochrome P450, putative                          120   1e-29   Ricinus communis
ref|XP_010650931.1|  PREDICTED: cytochrome P450 86A1                    121   1e-29   Vitis vinifera
ref|XP_003544876.2|  PREDICTED: cytochrome P450 86A1-like               121   1e-29   Glycine max [soybeans]
ref|XP_010918585.1|  PREDICTED: cytochrome P450 86A8-like               126   2e-29   Elaeis guineensis
gb|KJB55751.1|  hypothetical protein B456_009G092900                    122   2e-29   Gossypium raimondii
ref|XP_002299820.2|  Cytochrome P450 86A1 family protein                120   2e-29   
ref|XP_006425039.1|  hypothetical protein CICLE_v10030097mg             120   2e-29   Citrus clementina [clementine]
gb|AFG62316.1|  hypothetical protein 2_2530_01                          118   2e-29   Pinus taeda
ref|XP_009630929.1|  PREDICTED: cytochrome P450 86A1                    119   2e-29   Nicotiana tomentosiformis
gb|ACL53124.1|  unknown                                                 125   2e-29   Zea mays [maize]
ref|XP_011035187.1|  PREDICTED: cytochrome P450 86A1-like               120   3e-29   Populus euphratica
gb|AHD25487.1|  cytochrome-P450 monooxygenase CYP86                     125   3e-29   Zea nicaraguensis
ref|NP_001141372.1|  uncharacterized protein LOC100273463               125   3e-29   Zea mays [maize]
gb|EPS59487.1|  hypothetical protein M569_15318                         119   3e-29   Genlisea aurea
ref|XP_008457385.1|  PREDICTED: cytochrome P450 86A1                    119   5e-29   Cucumis melo [Oriental melon]
emb|CBH32594.1|  cytochrome P450, expressed                             124   5e-29   Triticum aestivum [Canadian hard winter wheat]
gb|ACG34921.1|  cytochrome P450 CYP86A34                                124   6e-29   Zea mays [maize]
ref|XP_010033023.1|  PREDICTED: cytochrome P450 86A1-like               116   7e-29   Eucalyptus grandis [rose gum]
ref|XP_004164591.1|  PREDICTED: cytochrome P450 86A1-like               119   7e-29   
ref|XP_004150627.1|  PREDICTED: cytochrome P450 86A1-like               119   7e-29   Cucumis sativus [cucumbers]
ref|XP_006645037.1|  PREDICTED: cytochrome P450 86A1-like               121   1e-28   Oryza brachyantha
ref|NP_001130939.1|  uncharacterized protein LOC100192044               123   1e-28   
gb|ACG33785.1|  cytochrome P450 CYP86A36                                123   2e-28   Zea mays [maize]
gb|ACN27732.1|  unknown                                                 123   2e-28   Zea mays [maize]
ref|XP_004970620.1|  PREDICTED: cytochrome P450 86A1-like               123   2e-28   Setaria italica
ref|XP_004241175.1|  PREDICTED: cytochrome P450 86A1                    118   2e-28   Solanum lycopersicum
gb|KDP46522.1|  hypothetical protein JCGZ_08494                         120   2e-28   Jatropha curcas
ref|XP_009763725.1|  PREDICTED: cytochrome P450 86A1                    118   2e-28   Nicotiana sylvestris
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             122   3e-28   Eutrema salsugineum [saltwater cress]
gb|KJB08946.1|  hypothetical protein B456_001G115100                    116   3e-28   Gossypium raimondii
ref|XP_007016155.1|  Cytochrome P450, family 86, subfamily A, pol...    119   3e-28   
gb|AFG62318.1|  hypothetical protein 2_2530_01                          115   3e-28   Pinus taeda
ref|XP_010104672.1|  Cytochrome P450 86A1                               117   4e-28   Morus notabilis
ref|XP_002456654.1|  hypothetical protein SORBIDRAFT_03g040250          122   5e-28   Sorghum bicolor [broomcorn]
ref|XP_010923101.1|  PREDICTED: cytochrome P450 86A1-like               119   5e-28   Elaeis guineensis
ref|XP_004500237.1|  PREDICTED: cytochrome P450 86A1-like               115   9e-28   Cicer arietinum [garbanzo]
ref|XP_010685596.1|  PREDICTED: cytochrome P450 86A1                    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|ABZ80831.1|  CYP86A32 fatty acid omega-hydroxylase                   115   1e-27   Quercus suber [cork oak]
gb|EYU45975.1|  hypothetical protein MIMGU_mgv1a025576mg                116   1e-27   Erythranthe guttata [common monkey flower]
ref|NP_001275219.1|  CYP86A33 fatty acid omega-hydroxylase              115   1e-27   Solanum tuberosum [potatoes]
emb|CDO99497.1|  unnamed protein product                                115   1e-27   Coffea canephora [robusta coffee]
ref|XP_006280320.1|  hypothetical protein CARUB_v10026242mg             115   1e-27   Capsella rubella
ref|XP_003564640.2|  PREDICTED: cytochrome P450 86A1                    120   1e-27   
ref|XP_008355259.1|  PREDICTED: cytochrome P450 86A1                    117   2e-27   
gb|EMT13769.1|  Cytochrome P450 86A1                                    119   2e-27   
ref|XP_010926207.1|  PREDICTED: cytochrome P450 86A1-like               117   2e-27   Elaeis guineensis
gb|KFK27415.1|  hypothetical protein AALP_AA8G379800                    113   2e-27   Arabis alpina [alpine rockcress]
ref|XP_002862636.1|  cytochrome P450                                    114   3e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_006401031.1|  hypothetical protein EUTSA_v10013214mg             113   3e-27   
emb|CDY61020.1|  BnaAnng17300D                                          113   3e-27   Brassica napus [oilseed rape]
emb|CDY71605.1|  BnaAnng38120D                                          112   4e-27   Brassica napus [oilseed rape]
ref|XP_009126726.1|  PREDICTED: cytochrome P450 86A1                    113   4e-27   Brassica rapa
ref|XP_009132026.1|  PREDICTED: cytochrome P450 86A1-like               113   4e-27   Brassica rapa
ref|NP_001044838.1|  Os01g0854800                                       119   4e-27   
ref|XP_006827573.1|  hypothetical protein AMTR_s00009p00227030          115   6e-27   
ref|XP_004294257.2|  PREDICTED: cytochrome P450 86A1                    114   6e-27   Fragaria vesca subsp. vesca
ref|XP_008220520.1|  PREDICTED: cytochrome P450 86A1                    114   7e-27   Prunus mume [ume]
ref|XP_010483494.1|  PREDICTED: cytochrome P450 86A1-like               112   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007208647.1|  hypothetical protein PRUPE_ppa020227mg             114   9e-27   
ref|XP_007146731.1|  hypothetical protein PHAVU_006G065000g             115   9e-27   Phaseolus vulgaris [French bean]
ref|XP_010454344.1|  PREDICTED: cytochrome P450 86A1                    112   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDY02845.1|  BnaC02g10440D                                          110   1e-26   
ref|XP_003615606.1|  Cytochrome P450                                    108   1e-26   Medicago truncatula
ref|XP_009374269.1|  PREDICTED: cytochrome P450 86A1                    114   2e-26   Pyrus x bretschneideri [bai li]
gb|AAL91155.1|  cytochrome P450                                         110   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAA62082.1|  cytochrome p450                                        110   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200694.1|  cytochrome P450 86A1                                  110   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71150.1|  BnaC03g12340D                                          110   2e-26   
ref|XP_010443636.1|  PREDICTED: cytochrome P450 86A1                    110   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002883546.1|  cytochrome P450                                    111   3e-26   
ref|XP_003538284.1|  PREDICTED: cytochrome P450 86A1-like isoform 1     112   5e-26   Glycine max [soybeans]
ref|XP_008785405.1|  PREDICTED: cytochrome P450 86A1                    112   6e-26   Phoenix dactylifera
gb|KHN47607.1|  Cytochrome P450 86A1                                    112   6e-26   Glycine soja [wild soybean]
emb|CDY70784.1|  BnaCnng69760D                                          107   2e-25   Brassica napus [oilseed rape]
ref|XP_008358971.1|  PREDICTED: cytochrome P450 86A1-like               109   2e-25   Malus domestica [apple tree]
ref|XP_003637119.1|  Cytochrome P450 86A1                               108   2e-25   
ref|XP_010541445.1|  PREDICTED: cytochrome P450 86A1-like               111   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_010520223.1|  PREDICTED: cytochrome P450 86A1                    111   2e-25   Tarenaya hassleriana [spider flower]
gb|KEH34209.1|  cytochrome P450 family-dependent fatty acid hydro...    109   3e-25   Medicago truncatula
gb|AAZ95163.1|  putative cytochrome P450                                105   8e-25   Brassica rapa
ref|XP_009407544.1|  PREDICTED: cytochrome P450 86A1                    109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004490585.1|  PREDICTED: cytochrome P450 86A1-like               100   4e-24   Cicer arietinum [garbanzo]
gb|EMT01938.1|  Cytochrome P450 86A2                                    109   8e-24   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640        95.1    2e-20   Sorghum bicolor [broomcorn]
gb|AFW89633.1|  putative cytochrome P450 superfamily protein          96.3    3e-20   
ref|NP_001141467.1|  uncharacterized protein LOC100273577             94.0    5e-20   
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein    94.0    5e-20   
ref|XP_006348808.1|  PREDICTED: cytochrome P450 86A1-like             90.1    6e-20   Solanum tuberosum [potatoes]
ref|XP_001760399.1|  predicted protein                                97.8    2e-19   
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like             89.0    2e-19   Setaria italica
ref|XP_010452805.1|  PREDICTED: cytochrome P450 86B1 isoform X1       91.7    3e-19   Camelina sativa [gold-of-pleasure]
emb|CDM81753.1|  unnamed protein product                              88.2    4e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010423121.1|  PREDICTED: cytochrome P450 86B1-like             90.9    4e-19   Camelina sativa [gold-of-pleasure]
gb|KEH40920.1|  cytochrome P450 family protein                        86.3    6e-19   Medicago truncatula
ref|XP_009354420.1|  PREDICTED: cytochrome P450 86B1-like             90.9    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_010528076.1|  PREDICTED: cytochrome P450 86B1-like             94.4    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590        89.4    1e-18   
gb|ACR38435.1|  unknown                                               89.7    1e-18   Zea mays [maize]
ref|XP_008389311.1|  PREDICTED: cytochrome P450 86B1-like             89.7    1e-18   
ref|NP_001140984.1|  putative cytochrome P450 superfamily protein     89.4    1e-18   
ref|XP_006379954.1|  cytochrome P450 family protein                   88.2    1e-18   
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610        88.2    1e-18   Sorghum bicolor [broomcorn]
gb|KHN27470.1|  Cytochrome P450 86B1                                  83.2    2e-18   Glycine soja [wild soybean]
ref|XP_008350966.1|  PREDICTED: cytochrome P450 86B1-like             88.6    2e-18   
ref|XP_011070444.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  88.6    2e-18   
ref|NP_197710.1|  cytochrome P450 86B1                                87.8    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394587.1|  hypothetical protein EUTSA_v10003923mg           90.9    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_011042366.1|  PREDICTED: cytochrome P450 86B1                  89.0    2e-18   Populus euphratica
gb|KEH40921.1|  cytochrome P450 family protein                        84.0    3e-18   Medicago truncatula
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like             82.4    3e-18   Glycine max [soybeans]
ref|XP_009148786.1|  PREDICTED: cytochrome P450 86B1                  94.0    3e-18   Brassica rapa
emb|CDY19394.1|  BnaC05g09030D                                        94.0    3e-18   Brassica napus [oilseed rape]
gb|KDP26701.1|  hypothetical protein JCGZ_17859                       87.8    3e-18   Jatropha curcas
gb|ABK25134.1|  unknown                                               92.8    3e-18   Picea sitchensis
ref|NP_001137105.1|  uncharacterized protein LOC100217282             89.0    4e-18   
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                  90.1    4e-18   Arabis alpina [alpine rockcress]
ref|XP_002988762.1|  hypothetical protein SELMODRAFT_128482           89.7    4e-18   
ref|XP_002986290.1|  fatty acid omega-hydroxylase                     89.4    4e-18   
ref|XP_010682470.1|  PREDICTED: cytochrome P450 86B1-like             84.0    4e-18   
gb|KEH40830.1|  cytochrome P450 family protein                        77.8    5e-18   
ref|XP_008461361.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  89.0    5e-18   
ref|XP_006417150.1|  hypothetical protein EUTSA_v10007334mg           91.3    5e-18   
ref|XP_008354906.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  89.7    5e-18   
ref|XP_001782495.1|  predicted protein                                93.2    5e-18   
emb|CDM81752.1|  unnamed protein product                              84.3    6e-18   
ref|XP_006293183.1|  hypothetical protein CARUB_v10019500mg           91.3    6e-18   
emb|CDX98008.1|  BnaA06g07590D                                        92.8    6e-18   
ref|XP_006399311.1|  hypothetical protein EUTSA_v10013132mg           87.8    7e-18   
ref|XP_010514257.1|  PREDICTED: cytochrome P450 86B1-like             90.9    7e-18   
ref|XP_003538960.2|  PREDICTED: cytochrome P450 86B1-like             87.4    7e-18   
ref|XP_008222001.1|  PREDICTED: cytochrome P450 86B1-like             85.9    7e-18   
ref|XP_007225033.1|  hypothetical protein PRUPE_ppa019933mg           85.9    7e-18   
gb|KHN32292.1|  Cytochrome P450 86B1                                  87.8    7e-18   
ref|XP_006661879.1|  PREDICTED: cytochrome P450 86B1-like             88.6    8e-18   
gb|EMS48808.1|  Cytochrome P450 86B1                                  85.5    8e-18   
emb|CDY21086.1|  BnaA08g24390D                                        90.1    8e-18   
ref|XP_004297737.1|  PREDICTED: cytochrome P450 86B1                  85.9    9e-18   
dbj|BAJ87689.1|  predicted protein                                    88.6    9e-18   
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g           82.8    9e-18   
gb|KFK43580.1|  hypothetical protein AALP_AA1G144800                  90.1    9e-18   
emb|CDY40805.1|  BnaC02g41740D                                        88.6    9e-18   
ref|XP_008390106.1|  PREDICTED: cytochrome P450 86B1                  85.5    1e-17   
ref|XP_002515053.1|  cytochrome P450, putative                        84.7    1e-17   
ref|XP_009110599.1|  PREDICTED: cytochrome P450 86B1                  90.5    1e-17   
gb|AAL59025.1|AC087182_8  putative cytochrome P450 protein            87.0    1e-17   
ref|NP_001064901.2|  Os10g0486100                                     86.7    1e-17   
ref|XP_009130123.1|  PREDICTED: cytochrome P450 86B1-like             88.2    1e-17   
gb|KEH40828.1|  cytochrome P450 family protein                        76.3    1e-17   
gb|EMT29646.1|  Cytochrome P450 86A1                                  86.7    1e-17   
gb|EAY78983.1|  hypothetical protein OsI_34090                        86.7    1e-17   
ref|XP_003607255.1|  Cytochrome P450                                  86.7    1e-17   
ref|XP_008389072.1|  PREDICTED: cytochrome P450 86B1-like             88.2    1e-17   
ref|XP_010502523.1|  PREDICTED: cytochrome P450 86B1-like             89.7    1e-17   
emb|CDY34587.1|  BnaC03g56870D                                        89.0    2e-17   
ref|XP_002874114.1|  CYP86B1                                          88.2    2e-17   
gb|EMT22280.1|  Cytochrome P450 86A2                                  84.3    2e-17   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg              81.3    2e-17   
tpg|DAA49553.1|  TPA: putative cytochrome P450 superfamily protein    88.6    2e-17   
ref|XP_011034022.1|  PREDICTED: cytochrome P450 86B1-like             84.3    2e-17   
ref|XP_010476304.1|  PREDICTED: cytochrome P450 86B1-like             89.0    2e-17   
gb|KEH40823.1|  cytochrome P450 family protein                        75.9    2e-17   
gb|KJB31090.1|  hypothetical protein B456_005G175500                  84.0    2e-17   
ref|XP_010495016.1|  PREDICTED: cytochrome P450 86B1-like             89.0    2e-17   
ref|XP_002314581.1|  cytochrome P450 family protein                   85.5    2e-17   
ref|XP_010556203.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  87.0    2e-17   
ref|XP_010458757.1|  PREDICTED: cytochrome P450 86B1-like             89.0    2e-17   
ref|XP_002873349.1|  predicted protein                                85.9    2e-17   
ref|XP_007131626.1|  hypothetical protein PHAVU_011G029000g           90.5    2e-17   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like             84.7    2e-17   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like             87.4    2e-17   
ref|XP_003574090.1|  PREDICTED: cytochrome P450 86B1-like             88.2    3e-17   
ref|XP_010425287.1|  PREDICTED: cytochrome P450 86B1-like             89.0    3e-17   
ref|XP_006286797.1|  hypothetical protein CARUB_v10003490mg           87.4    3e-17   
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like             88.2    3e-17   
gb|EMT01870.1|  Cytochrome P450 86A2                                  84.0    3e-17   
gb|KFK27637.1|  hypothetical protein AALP_AA8G409300                  87.0    3e-17   
ref|XP_004158225.1|  PREDICTED: cytochrome P450 86B1-like             86.7    3e-17   
ref|XP_004135954.1|  PREDICTED: cytochrome P450 86B1-like             86.7    3e-17   
gb|KHN19669.1|  Cytochrome P450 86B1                                  80.5    3e-17   
ref|XP_002892729.1|  At1g13140                                        88.6    3e-17   
ref|XP_002468539.1|  hypothetical protein SORBIDRAFT_01g047600        86.7    3e-17   
emb|CDY61911.1|  BnaC07g49710D                                        86.7    4e-17   
ref|XP_009379946.1|  PREDICTED: cytochrome P450 86B1-like             87.4    4e-17   
gb|EMT29524.1|  Cytochrome P450 86A2                                  81.3    4e-17   
gb|KHN19678.1|  Cytochrome P450 86B1                                  79.7    4e-17   
ref|XP_010454600.1|  PREDICTED: cytochrome P450 86B1-like             86.7    4e-17   
gb|KDP33058.1|  hypothetical protein JCGZ_13644                       85.1    4e-17   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein          86.3    4e-17   
emb|CAB93726.1|  cytochrome P450-like protein                         85.1    5e-17   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like             84.0    5e-17   
ref|XP_007044873.1|  Cytochrome P450 86A2                             81.6    5e-17   
gb|EPS58816.1|  hypothetical protein M569_15996                       86.3    5e-17   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like             87.4    5e-17   
ref|XP_010493430.1|  PREDICTED: cytochrome P450 86B1 isoform X1       86.3    5e-17   
ref|XP_006651022.1|  PREDICTED: cytochrome P450 86B1-like             85.5    5e-17   
ref|NP_196442.2|  cytochrome P450 superfamily protein                 84.7    5e-17   
ref|XP_003556602.2|  PREDICTED: cytochrome P450 86B1-like             84.7    6e-17   
gb|EYU28570.1|  hypothetical protein MIMGU_mgv1a017763mg              87.8    6e-17   
gb|KHN29577.1|  Cytochrome P450 86B1                                  84.7    6e-17   
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like             79.3    6e-17   
emb|CDY02213.1|  BnaA03g39540D                                        85.9    6e-17   
ref|XP_003533692.1|  PREDICTED: cytochrome P450 86B1-like             84.3    6e-17   
ref|XP_010458758.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  89.0    6e-17   
ref|XP_009136378.1|  PREDICTED: cytochrome P450 86B1                  85.9    6e-17   
ref|NP_189243.1|  cytochrome P450, family 86, subfamily C, polype...  87.8    6e-17   
emb|CDY46948.1|  BnaA02g32980D                                        85.9    7e-17   
ref|XP_010067001.1|  PREDICTED: cytochrome P450 86B1-like             85.9    7e-17   
ref|XP_006438203.1|  hypothetical protein CICLE_v10033706mg           81.6    7e-17   
gb|KDO82148.1|  hypothetical protein CISIN_1g041858mg                 81.6    7e-17   
ref|XP_010458759.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  88.6    7e-17   
gb|KHM99063.1|  Cytochrome P450 86B1                                  84.3    7e-17   
ref|XP_008221383.1|  PREDICTED: cytochrome P450 86B1-like             85.1    7e-17   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  87.0    8e-17   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                 84.3    8e-17   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  86.7    8e-17   
ref|XP_010495026.1|  PREDICTED: cytochrome P450 86B1-like             88.6    8e-17   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like             84.7    8e-17   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like             84.3    8e-17   
ref|XP_002464461.1|  hypothetical protein SORBIDRAFT_01g018855        85.1    9e-17   
gb|ABR16969.1|  unknown                                               82.4    9e-17   
dbj|BAJ89570.1|  predicted protein                                    82.0    9e-17   
emb|CAN77648.1|  hypothetical protein VITISV_032391                   82.0    1e-16   
ref|XP_010648167.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  82.0    1e-16   
ref|XP_002282185.1|  PREDICTED: cytochrome P450 86B1                  82.0    1e-16   
ref|XP_011457419.1|  PREDICTED: cytochrome P450 86B1-like             84.3    1e-16   
gb|AGV40485.1|  hypothetical protein                                  79.3    1e-16   
emb|CAN63571.1|  hypothetical protein VITISV_008250                   82.0    1e-16   
ref|XP_002264277.2|  PREDICTED: cytochrome P450 86B1-like isoform X1  82.0    1e-16   
dbj|BAJ85246.1|  predicted protein                                    83.6    1e-16   
emb|CBI34058.3|  unnamed protein product                              81.6    1e-16   
gb|KEH40821.1|  cytochrome P450 family protein                        77.4    1e-16   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg           83.6    1e-16   
ref|XP_010421118.1|  PREDICTED: cytochrome P450 86B1-like             84.7    1e-16   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g           79.0    1e-16   
ref|XP_004505709.1|  PREDICTED: cytochrome P450 86B1-like             83.2    1e-16   
ref|XP_008340443.1|  PREDICTED: cytochrome P450 86B1                  84.7    1e-16   
ref|XP_010476306.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  88.6    2e-16   
gb|EYU35580.1|  hypothetical protein MIMGU_mgv1a004717mg              86.3    2e-16   
ref|XP_002892730.1|  CYP86C4                                          88.2    2e-16   
ref|XP_010476305.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  89.0    2e-16   
ref|XP_009114095.1|  PREDICTED: cytochrome P450 86B1                  86.3    2e-16   
emb|CDY04194.1|  BnaA09g19720D                                        86.3    2e-16   
ref|XP_006290052.1|  hypothetical protein CARUB_v10003687mg           82.8    2e-16   
ref|XP_009794122.1|  PREDICTED: cytochrome P450 86B1-like             83.2    2e-16   
ref|XP_010522165.1|  PREDICTED: cytochrome P450 86B1-like             84.0    2e-16   
ref|XP_002875311.1|  CYP86C2                                          85.9    2e-16   
ref|NP_172774.1|  cytochrome P450, family 86, subfamily C, polype...  87.8    2e-16   
gb|ACG29046.1|  cytochrome P450 CYP86E2                               80.9    3e-16   
gb|KEH24772.1|  cytochrome P450 family protein                        75.9    3e-16   
gb|EMT10522.1|  Cytochrome P450 86A1                                  80.1    3e-16   
ref|XP_007223138.1|  hypothetical protein PRUPE_ppa004331mg           82.8    3e-16   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed             82.8    3e-16   
gb|EAY88477.1|  hypothetical protein OsI_09948                        82.8    4e-16   
ref|NP_001048918.1|  Os03g0140200                                     82.8    4e-16   
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like             84.7    4e-16   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g           77.4    4e-16   
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                  78.2    4e-16   
emb|CBI16821.3|  unnamed protein product                              79.7    4e-16   
gb|EMT22279.1|  Cytochrome P450 86A1                                  79.7    4e-16   
ref|XP_010478002.1|  PREDICTED: cytochrome P450 86B1                  87.0    4e-16   
ref|XP_010688690.1|  PREDICTED: cytochrome P450 86B1                  84.0    4e-16   
gb|AAK31592.1|  cytochrome P450                                       86.3    4e-16   
gb|AAO41955.1|  putative cytochrome P450                              86.7    5e-16   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g           73.9    5e-16   
gb|KEH40811.1|  cytochrome P450 family protein                        75.1    5e-16   
ref|XP_002454121.1|  hypothetical protein SORBIDRAFT_04g024930        80.5    5e-16   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                       78.2    6e-16   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like             75.1    6e-16   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g           76.6    6e-16   
gb|KEH40805.1|  cytochrome P450 family protein                        74.7    7e-16   
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like             81.6    7e-16   
ref|XP_010094084.1|  Cytochrome P450                                  83.6    7e-16   
ref|XP_002523775.1|  cytochrome P450, putative                        80.9    7e-16   
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like             77.0    7e-16   
emb|CDP11007.1|  unnamed protein product                              83.6    7e-16   
gb|KEH40819.1|  cytochrome P450 family protein                        77.0    7e-16   
ref|XP_010933313.1|  PREDICTED: cytochrome P450 86B1-like             79.3    7e-16   
gb|KEH40839.1|  cytochrome P450 family protein                        75.9    8e-16   
gb|KEH24773.1|  cytochrome P450 family protein                        76.3    8e-16   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg              72.0    9e-16   
ref|XP_009631300.1|  PREDICTED: cytochrome P450 86B1-like             82.0    9e-16   
gb|AAD31068.1|AC007357_17  Strong similarity to gi|3313615 F21J9....  83.6    9e-16   
ref|XP_010249432.1|  PREDICTED: cytochrome P450 86B1                  81.3    1e-15   
emb|CAN75428.1|  hypothetical protein VITISV_003302                   80.5    1e-15   
ref|XP_008793701.1|  PREDICTED: cytochrome P450 86B1                  82.4    1e-15   
gb|KEH40835.1|  cytochrome P450 family protein                        76.3    1e-15   
ref|XP_010100345.1|  Cytochrome P450                                  79.0    1e-15   
ref|NP_001184979.1|  cytochrome P450, family 86, subfamily C, pol...  83.2    1e-15   
emb|CBI27149.3|  unnamed protein product                              80.5    1e-15   
ref|NP_172773.4|  cytochrome P450, family 86, subfamily C, polype...  83.2    1e-15   
ref|XP_002277006.1|  PREDICTED: cytochrome P450 86B1                  80.5    1e-15   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like             80.5    1e-15   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...  69.3    1e-15   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g           74.7    1e-15   
gb|EMS50674.1|  Cytochrome P450 86B1                                  81.6    1e-15   
ref|XP_006395582.1|  hypothetical protein EUTSA_v10005711mg           83.2    1e-15   
ref|NP_001170655.1|  putative cytochrome P450 superfamily protein     78.2    1e-15   
ref|XP_008461842.1|  PREDICTED: cytochrome P450 86B1-like             85.9    1e-15   
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like             82.4    1e-15   
gb|EMT05588.1|  Cytochrome P450 86A2                                  79.0    1e-15   
gb|KEH40818.1|  cytochrome P450 family protein                        74.3    1e-15   
gb|KHN27468.1|  Cytochrome P450 86B1                                  77.4    1e-15   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g           75.5    1e-15   
gb|EMT30949.1|  Cytochrome P450 86A2                                  80.9    2e-15   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like             77.4    2e-15   
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like             77.0    2e-15   
gb|AFW62839.1|  putative cytochrome P450 superfamily protein          78.2    2e-15   
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g           73.6    2e-15   
emb|CDY27586.1|  BnaA09g28210D                                        85.5    2e-15   
ref|XP_010499164.1|  PREDICTED: cytochrome P450 86B1-like             84.7    2e-15   
ref|XP_009113810.1|  PREDICTED: cytochrome P450 86B1 isoform X1       85.5    2e-15   
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like             77.0    2e-15   
gb|KFK43581.1|  hypothetical protein AALP_AA1G144900                  84.0    2e-15   
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like             75.5    2e-15   
ref|XP_009113811.1|  PREDICTED: cytochrome P450 86B1 isoform X2       85.5    2e-15   
ref|XP_010245486.1|  PREDICTED: cytochrome P450 86B1                  79.3    2e-15   
gb|KFK44487.1|  hypothetical protein AALP_AA1G263300                  85.1    2e-15   
gb|AJD25224.1|  cytochrome P450 CYP96A84                              75.5    3e-15   
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...  80.5    3e-15   
gb|KHM99045.1|  Cytochrome P450 86B1                                  72.4    3e-15   
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like             73.2    3e-15   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like             81.3    3e-15   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like             75.1    3e-15   
ref|XP_004231497.1|  PREDICTED: cytochrome P450 86B1                  80.1    4e-15   
ref|NP_173862.1|  cytochrome P450, family 86, subfamily C, polype...  83.6    4e-15   
ref|XP_006415814.1|  hypothetical protein EUTSA_v10007367mg           84.7    4e-15   
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg              79.0    4e-15   
gb|KEH24777.1|  cytochrome P450 family protein                        70.5    5e-15   
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g           72.8    5e-15   
dbj|BAJ86572.1|  predicted protein                                    80.1    5e-15   
gb|EPS72790.1|  hypothetical protein M569_01963                       77.8    5e-15   
ref|XP_004952982.1|  PREDICTED: cytochrome P450 86B1-like             76.3    5e-15   
gb|AES86633.2|  cytochrome P450 family protein                        69.7    5e-15   
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like             73.9    6e-15   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like             80.5    6e-15   
gb|KEH22137.1|  cytochrome P450 family protein                        72.0    6e-15   
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like             75.5    6e-15   



>ref|XP_009797232.1| PREDICTED: cytochrome P450 86A8-like [Nicotiana sylvestris]
Length=538

 Score =   152 bits (385),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+M +QYKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL+++PGH+VEQKMS
Sbjct  434  PDGKKFVMHEQYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLTVAPGHKVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHN  486
            LTLFMKDGLKV + PR+LTP+V+++K +  
Sbjct  494  LTLFMKDGLKVNLRPRNLTPLVTSVKKERE  523


 Score = 39.7 bits (91),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCLEFKPERWLTP
Sbjct  420  GEDCLEFKPERWLTP  434



>ref|XP_006339587.1| PREDICTED: cytochrome P450 86A2-like [Solanum tuberosum]
Length=535

 Score =   154 bits (389),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF+M +QYKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL+++PGH+VEQKMSL
Sbjct  435  DGKKFVMHEQYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLTVAPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKD  495
            TLFMKDGLKV +HPRDLTP V+++K+
Sbjct  495  TLFMKDGLKVDLHPRDLTPFVNSVKE  520


 Score = 37.0 bits (84),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWLT
Sbjct  420  GEDCLEFKPERWLT  433



>emb|CDP08799.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   149 bits (376),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 10/110 (9%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+  D ++F++FNAGPRICLG+DLAYLQMKS+AAA+LLRHR++L+PGH+VEQKMS
Sbjct  435  PDGKKFVTHDSFRFVAFNAGPRICLGKDLAYLQMKSVAAALLLRHRITLAPGHKVEQKMS  494

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK----------DDHNRAPASVKCNG  456
            LTLFMK GLKV +HPRDLT IV ++K           D     +SV+CNG
Sbjct  495  LTLFMKYGLKVNLHPRDLTAIVESVKKQKPIGDQLSQDAGVGSSSVQCNG  544


 Score = 38.1 bits (87),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCLEFKPERWL+P
Sbjct  421  GEDCLEFKPERWLSP  435



>ref|XP_004229934.1| PREDICTED: cytochrome P450 86A8-like [Solanum lycopersicum]
Length=526

 Score =   150 bits (378),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF+M +QYKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL+++PGH+VEQKMSL
Sbjct  435  DGKKFVMHEQYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLTVAPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKD  495
            TLFMKDGLKV + PR+LTP V+++K+
Sbjct  495  TLFMKDGLKVNLRPRELTPFVNSVKE  520


 Score = 37.0 bits (84),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWLT
Sbjct  420  GEDCLEFKPERWLT  433



>ref|XP_009629836.1| PREDICTED: cytochrome P450 86A8 [Nicotiana tomentosiformis]
Length=536

 Score =   146 bits (369),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+M +QYKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL ++PGH+VEQKMS
Sbjct  434  PDGKKFVMHEQYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLMVAPGHKVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            LTLFMKDGLKV + PRDLT +  ++K +
Sbjct  494  LTLFMKDGLKVNLLPRDLTLLTDSLKKE  521


 Score = 39.7 bits (91),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCLEFKPERWLTP
Sbjct  420  GEDCLEFKPERWLTP  434



>ref|XP_003521880.1| PREDICTED: cytochrome P450 86A8-like [Glycine max]
Length=533

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKFIM D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL L PGHQVEQKMSL
Sbjct  435  DGTKFIMHDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLVLVPGHQVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHN  486
            TLFMK+GLKV VH RDL  I++++K +  
Sbjct  495  TLFMKNGLKVNVHERDLRGIITSLKKERE  523



>ref|XP_003525390.1| PREDICTED: cytochrome P450 86A8 [Glycine max]
Length=528

 Score =   140 bits (354),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            P+G K  +QD YKF+SFNAGPR+CLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMS
Sbjct  433  PEGDKIQVQDSYKFVSFNAGPRLCLGKDLAYLQMKSIAAAVLLRHRLAVAPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM  501
            LTLFMK GLKV V+PRDL P++  +
Sbjct  493  LTLFMKYGLKVNVYPRDLKPVLEKL  517


 Score = 42.0 bits (97),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIH  736
            GEDCLEFKPERWL+P  D+I 
Sbjct  419  GEDCLEFKPERWLSPEGDKIQ  439



>ref|XP_006583288.1| PREDICTED: cytochrome P450 86A8-like [Glycine max]
Length=532

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKFIM D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL L PGHQVEQKMSL
Sbjct  434  DGTKFIMHDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLVLVPGHQVEQKMSL  493

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            TLFMK+GLKV VH RDL  +++++K +
Sbjct  494  TLFMKNGLKVNVHERDLRGVITSIKKE  520



>gb|ABC68403.1| cytochrome P450 monooxygenase CYP86A24 [Glycine max]
Length=528

 Score =   139 bits (351),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            P+G K  +QD YKF+SFNAGPR+CLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMS
Sbjct  432  PEGDKIQVQDSYKFVSFNAGPRLCLGKDLAYLQMKSIAAAVLLRHRLAVAPGHRVEQKMS  491

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM  501
            LTLFMK GL+V V+PRDL P++  +
Sbjct  492  LTLFMKYGLRVNVYPRDLKPVLEKL  516


 Score = 42.0 bits (97),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIH  736
            GEDCLEFKPERWL+P  D+I 
Sbjct  418  GEDCLEFKPERWLSPEGDKIQ  438



>gb|KHN16811.1| Cytochrome P450 86A2 [Glycine soja]
Length=464

 Score =   139 bits (351),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            P+G K  +QD YKF+SFNAGPR+CLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMS
Sbjct  368  PEGDKIQVQDSYKFVSFNAGPRLCLGKDLAYLQMKSIAAAVLLRHRLAVAPGHRVEQKMS  427

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM  501
            LTLFMK GL+V V+PRDL P++  +
Sbjct  428  LTLFMKYGLRVNVYPRDLKPVLEKL  452


 Score = 41.6 bits (96),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIH  736
            GEDCLEFKPERWL+P  D+I 
Sbjct  354  GEDCLEFKPERWLSPEGDKIQ  374



>ref|XP_006396237.1| hypothetical protein EUTSA_v10028550mg [Eutrema salsugineum]
 gb|ESQ37690.1| hypothetical protein EUTSA_v10028550mg [Eutrema salsugineum]
Length=558

 Score =   142 bits (357),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 84/113 (74%), Gaps = 12/113 (11%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKMS
Sbjct  436  PDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPI------------VSAMKDDHNRAPASVKCNGV  453
            LTLFMK+GL V VH RDL  I            V+A+    N A  + KCNG+
Sbjct  496  LTLFMKNGLLVNVHKRDLEGILKSLIAKERNDVVAALNGKCNGAALNGKCNGI  548


 Score = 37.7 bits (86),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  422  GEDCLEFKPERWISPDDGKFVN  443



>emb|CDY66201.1| BnaA09g51710D [Brassica napus]
Length=559

 Score =   141 bits (356),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 5/106 (5%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKM
Sbjct  439  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM  497

Query  578  SLTLFMKDGLKVKVHPRDLTPI----VSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V VH R+L  I    VS  ++D   A  + KCNGV
Sbjct  498  SLTLFMKNGLVVNVHKRNLEGIMKSLVSKERNDVVAATLNGKCNGV  543


 Score = 38.1 bits (87),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  425  GEDCLEFKPERWISPEDGKFVN  446



>ref|XP_004510774.1| PREDICTED: cytochrome P450 86A2-like [Cicer arietinum]
Length=539

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKFIM D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGHQVEQKMSL
Sbjct  435  DGTKFIMHDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVVPGHQVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD-----HNRAPASVKCNG  456
            TLFMK+GL+V V+ RDL  +++ ++ +       +    +KCNG
Sbjct  495  TLFMKNGLRVNVYNRDLKGVLANIQKEKEGEIQGKVSNDLKCNG  538



>ref|XP_010053722.1| PREDICTED: cytochrome P450 86A8-like [Eucalyptus grandis]
Length=548

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+MQD +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL ++ GH+V QKMS
Sbjct  436  PDGQKFVMQDAFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLRVAAGHRVVQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGG  441
            LTLFM+ GLKV V  RDL PI+ +++ + N   A VK NG   GG
Sbjct  496  LTLFMQYGLKVDVLRRDLEPILESIRRERNEE-AGVKLNGECNGG  539



>ref|XP_009375001.1| PREDICTED: cytochrome P450 86A8 [Pyrus x bretschneideri]
Length=535

 Score =   143 bits (361),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K   QD YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  437  DGKKMEAQDSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+V VHPRDLTPI++ +
Sbjct  497  TLFMKYGLRVNVHPRDLTPILAKI  520


 Score = 35.8 bits (81),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  422  GEDCLEFKPERWLS  435



>gb|KFK30625.1| hypothetical protein AALP_AA6G006200 [Arabis alpina]
Length=557

 Score =   141 bits (355),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRH L+++PGH+VEQKM
Sbjct  439  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHSLTVAPGHKVEQKM  497

Query  578  SLTLFMKDGLKVKVHPRDLTPIV-SAMKDDHNRAPASV--KCNGV  453
            SLTLFMK+GL V VH RDL  I+ S M  + N   A++  KCNGV
Sbjct  498  SLTLFMKNGLLVNVHKRDLEVIMKSLMPKERNDVVAAINGKCNGV  542


 Score = 38.1 bits (87),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  425  GEDCLEFKPERWISPEDGKFVN  446



>gb|AAL75903.1| AT4g00360/A_IG005I10_21 [Arabidopsis thaliana]
 gb|AAM91369.1| At4g00360/A_IG005I10_21 [Arabidopsis thaliana]
Length=553

 Score =   141 bits (355),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKMS
Sbjct  436  PDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHEVEQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM--KDDHNRAPASVKCN-GVNEG  444
            LTLFMK+GL V VH RDL  ++ ++  K+ ++    + KCN G+ EG
Sbjct  496  LTLFMKNGLLVNVHKRDLEVMMKSLVPKERNDVVVLNGKCNGGIGEG  542


 Score = 37.7 bits (86),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  422  GEDCLEFKPERWISPDDGKFVN  443



>ref|XP_006287404.1| hypothetical protein CARUB_v10000610mg [Capsella rubella]
 gb|EOA20302.1| hypothetical protein CARUB_v10000610mg [Capsella rubella]
Length=556

 Score =   140 bits (354),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  KF+  DQY+F++FNAGPR+CLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKMS
Sbjct  438  PDDGKFVNHDQYRFVAFNAGPRVCLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMS  497

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM---KDDHNRAPASVKCN-GVNEG  444
            LTLFMK+GL V +H RDL  I+ ++   K+ ++    + KCN G+ EG
Sbjct  498  LTLFMKNGLLVNIHKRDLEVIMKSLVVSKEANDVVALNGKCNGGIGEG  545


 Score = 37.7 bits (86),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  424  GEDCLEFKPERWISPDDGKFVN  445



>ref|XP_007135090.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris]
 gb|ESW07084.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris]
Length=532

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF+M D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL L PGHQVEQKMSL
Sbjct  434  DGTKFVMHDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLVLVPGHQVEQKMSL  493

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            TLFMK+GLKV VH RDL  +V +++ +
Sbjct  494  TLFMKNGLKVNVHERDLRGVVISIQKE  520



>ref|XP_004245593.1| PREDICTED: cytochrome P450 86A7 [Solanum lycopersicum]
Length=554

 Score =   144 bits (362),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 90/112 (80%), Gaps = 4/112 (4%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+ +QD ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGNKYQVQDAFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVAPGHKVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKD----DHNRAPASVKCNGVNEGGTEST  429
            TLFMK GL + V+PRDLTPI++ +++    DH+     +  NG+N+ G  + 
Sbjct  498  TLFMKYGLVMNVNPRDLTPILAKIENFCKIDHSCGGEHMINNGINQPGATAV  549


 Score = 34.7 bits (78),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  423  GEDCLEFKPERWMS  436



>ref|NP_191946.1| cytochrome P450 86A2 [Arabidopsis thaliana]
 sp|O23066.1|C86A2_ARATH RecName: Full=Cytochrome P450 86A2; AltName: Full=Protein ABERRANT 
INDUCTION OF TYPE THREE 1 [Arabidopsis thaliana]
 gb|AAF02801.1|AF195115_21 belongs to the cytochrome p450 family [Arabidopsis thaliana]
 gb|AAB62843.1| belongs to the cytochrome p450 family [Arabidopsis thaliana]
 emb|CAB80794.1| probable cytochrome P450 [Arabidopsis thaliana]
 gb|AEE81869.1| cytochrome P450 86A2 [Arabidopsis thaliana]
Length=553

 Score =   140 bits (354),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKMS
Sbjct  436  PDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM--KDDHNRAPASVKCN-GVNEG  444
            LTLFMK+GL V VH RDL  ++ ++  K+ ++    + KCN G+ EG
Sbjct  496  LTLFMKNGLLVNVHKRDLEVMMKSLVPKERNDVVVLNGKCNGGIGEG  542


 Score = 37.7 bits (86),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  422  GEDCLEFKPERWISPDDGKFVN  443



>ref|XP_010670184.1| PREDICTED: cytochrome P450 86A8 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   139 bits (351),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+M D +KF++FNAGPRICLG+DLAYLQMKS+AA+VLLRHR+ L PGH+VEQKMS
Sbjct  433  PDGKKFMMHDHFKFVAFNAGPRICLGKDLAYLQMKSVAASVLLRHRMVLVPGHKVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK  498
            +TLFMK GLKV VH RDL  +++++K
Sbjct  493  ITLFMKYGLKVNVHHRDLNQVIASLK  518


 Score = 38.1 bits (87),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCLEFKPERWL+P
Sbjct  419  GEDCLEFKPERWLSP  433



>ref|XP_010087951.1| Cytochrome P450 86A2 [Morus notabilis]
 gb|EXB30873.1| Cytochrome P450 86A2 [Morus notabilis]
Length=556

 Score =   140 bits (354),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  755  PDGTKFIMQD-QYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            PDG KF+ Q+  YK+++FNAGPRICLG+DLAYLQM+SIAAAVLLRHRL++ PGH+VEQKM
Sbjct  435  PDGKKFLAQEYSYKYVAFNAGPRICLGKDLAYLQMRSIAAAVLLRHRLTVVPGHRVEQKM  494

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMK----DDHNRAPASVKCNGVNEG  444
            S+TLFMK GL+V + PRDL  IV  +K    D+      +VKCNG   G
Sbjct  495  SVTLFMKYGLRVYLQPRDLEGIVVGLKRERSDETTAFRGTVKCNGACNG  543


 Score = 37.4 bits (85),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDC+EFKPERWL+P
Sbjct  421  GEDCMEFKPERWLSP  435



>ref|XP_009111490.1| PREDICTED: cytochrome P450 86A2 [Brassica rapa]
Length=559

 Score =   140 bits (352),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 5/106 (5%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRH L+++PGH+VEQKM
Sbjct  439  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHSLTVAPGHKVEQKM  497

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAM----KDDHNRAPASVKCNGV  453
            SLTLFMK+GL V VH RDL  I+ ++    ++D   A  + KCNGV
Sbjct  498  SLTLFMKNGLVVNVHKRDLEGIMKSLVRTERNDVVAATLNGKCNGV  543


 Score = 38.1 bits (87),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  425  GEDCLEFKPERWISPEDGKFVN  446



>ref|XP_007209896.1| hypothetical protein PRUPE_ppa004078mg [Prunus persica]
 gb|EMJ11095.1| hypothetical protein PRUPE_ppa004078mg [Prunus persica]
Length=531

 Score =   142 bits (358),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  437  DGKKMEVQDSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+V VHPRDL PI+  +
Sbjct  497  TLFMKYGLRVNVHPRDLNPILEKI  520


 Score = 35.8 bits (81),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  422  GEDCLEFKPERWLS  435



>ref|XP_002275806.1| PREDICTED: cytochrome P450 86A7 [Vitis vinifera]
Length=545

 Score =   143 bits (360),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 4/99 (4%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  435  DGKKIELQDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAPGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNG  456
            TLFMK GLKV V PRDLTPI++ +     +A  + K NG
Sbjct  495  TLFMKYGLKVNVQPRDLTPILANIP----KAKPNTKVNG  529


 Score = 34.7 bits (78),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDCLEF+PERWL+    +I
Sbjct  420  GEDCLEFRPERWLSADGKKI  439



>ref|XP_010419577.1| PREDICTED: cytochrome P450 86A2-like isoform X1 [Camelina sativa]
 ref|XP_010419579.1| PREDICTED: cytochrome P450 86A2-like isoform X2 [Camelina sativa]
Length=556

 Score =   139 bits (351),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKM
Sbjct  438  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAM---KDDHNRAPASVKCNGV  453
            SLTLFMK+GL V VH RDL  I+ ++   K+ ++    +  CNGV
Sbjct  497  SLTLFMKNGLLVNVHKRDLEAIMKSLVVTKERNDVVALNGVCNGV  541


 Score = 38.1 bits (87),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  424  GEDCLEFKPERWISPEDGKFVN  445



>emb|CBI34653.3| unnamed protein product [Vitis vinifera]
Length=1462

 Score =   141 bits (356),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  488  DGKKIELQDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAPGHRVEQKMSL  547

Query  572  TLFMKDGLKVKVHPRDLTPIVS  507
            TLFMK GLKV V PRDLTPI++
Sbjct  548  TLFMKYGLKVNVQPRDLTPILA  569


 Score = 36.2 bits (82),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  473  GEDCLEFRPERWLS  486



>ref|XP_008373994.1| PREDICTED: cytochrome P450 86A8-like [Malus domestica]
Length=535

 Score =   142 bits (357),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K   QD YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  437  DGKKMEAQDSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+V VHPRDLTP+++ +
Sbjct  497  TLFMKYGLRVNVHPRDLTPLLAKI  520


 Score = 35.4 bits (80),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  422  GEDCLEFKPERWLS  435



>gb|KDP28614.1| hypothetical protein JCGZ_14385 [Jatropha curcas]
Length=562

 Score =   141 bits (356),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KFI  D YKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL++ PGH+VEQKMS
Sbjct  434  PDGKKFINHDSYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLTIVPGHKVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM  501
            LTLFMKDGLKV VH RDL   V+ +
Sbjct  494  LTLFMKDGLKVNVHKRDLEGSVARL  518


 Score = 35.8 bits (81),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            G+DCLEF+PERWL+P   +  N
Sbjct  420  GDDCLEFRPERWLSPDGKKFIN  441



>gb|AAZ39642.1| cytochrome P450 fatty acid omega-hydroxylase [Petunia x hybrida]
Length=553

 Score =   141 bits (355),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF +QD ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  437  DGDKFQVQDTFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVAPGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMKDGL + V PRDLTPI++ ++
Sbjct  497  TLFMKDGLVMNVTPRDLTPILAKIE  521


 Score = 36.2 bits (82),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIH  736
            GEDCLEFKPERW++   D+  
Sbjct  422  GEDCLEFKPERWMSQDGDKFQ  442



>ref|XP_010089087.1| Cytochrome P450 86A2 [Morus notabilis]
 gb|EXB37334.1| Cytochrome P450 86A2 [Morus notabilis]
Length=547

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG  F ++D YKF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH VEQKMSL
Sbjct  437  DGKIFEVRDSYKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHSVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTE  435
            TLFMK GLKV V PRDL PI++ +    + A  ++  NG +EGG E
Sbjct  497  TLFMKYGLKVSVRPRDLKPILARICKSDSCAKEAL-TNGNHEGGVE  541



>ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 ref|XP_004159797.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 gb|KGN45664.1| hypothetical protein Csa_6G004550 [Cucumis sativus]
Length=547

 Score =   142 bits (357),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 7/110 (6%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKFI  D YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  436  DGTKFIAYDPYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPAS-------VKCNGVNEG  444
            TLFMK GLKV +H R+L  IV +M+  +  +          V CNG   G
Sbjct  496  TLFMKYGLKVNIHKRNLEGIVESMRGKYGNSQGKDSPLITVVNCNGGCNG  545


 Score = 35.4 bits (80),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  421  GEDCLEFRPERWLT  434



>ref|XP_002892051.1| CYP86A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68310.1| CYP86A4 [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   140 bits (354),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAV LRHRL++ PGH+VEQKM
Sbjct  438  PMDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVFLRHRLTVVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V +H RDL  I+ ++    +   A+ KCNGV
Sbjct  497  SLTLFMKNGLLVNLHKRDLQGIMKSLVVKKSDGVANGKCNGV  538


 Score = 36.2 bits (82),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFNPERWISPMDGKFIN  445



>ref|XP_008238919.1| PREDICTED: cytochrome P450 86A8 [Prunus mume]
Length=531

 Score =   141 bits (355),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K   QD YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  437  DGQKMEAQDSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+V VHPRDL PI+  +
Sbjct  497  TLFMKYGLRVNVHPRDLNPILEKI  520


 Score = 35.8 bits (81),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  422  GEDCLEFKPERWLS  435



>ref|XP_008244638.1| PREDICTED: cytochrome P450 86A8-like [Prunus mume]
Length=548

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 5/106 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D  K+++FNAGPRICLG+DLAYLQMKS+ A+VLLRHRL+L PGH+VEQKMSL
Sbjct  435  DGKKFIMHDSNKYVAFNAGPRICLGKDLAYLQMKSVVASVLLRHRLTLVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD-----HNRAPASVKCNGVN  450
            TLFMK GL V VHPR+L  IV+  K D       +    VKC+GVN
Sbjct  495  TLFMKHGLMVNVHPRELGAIVARAKKDMEAKLQGQECVGVKCHGVN  540



>emb|CDP12038.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 81/90 (90%), Gaps = 1/90 (1%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF   DQ+KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  435  DGQKFEPHDQFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAPGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM-KDDHN  486
            TLFMK+GLKV VH RDL+P+++ + K DH+
Sbjct  495  TLFMKNGLKVNVHERDLSPVLATVGKVDHS  524



>ref|XP_007160078.1| hypothetical protein PHAVU_002G290700g [Phaseolus vulgaris]
 gb|ESW32072.1| hypothetical protein PHAVU_002G290700g [Phaseolus vulgaris]
Length=529

 Score =   135 bits (340),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            P+G +  +QD YKF+SFNAGPR+CLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMS
Sbjct  432  PEGDRIQLQDSYKFVSFNAGPRLCLGKDLAYLQMKSIAAAVLLRHRLAVAAGHRVEQKMS  491

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK  498
            LTLFMK GLK+ V PRDL P++  +K
Sbjct  492  LTLFMKYGLKLNVCPRDLKPVLKKIK  517


 Score = 41.2 bits (95),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIH  736
            GEDCLEFKPERWL+P  D I 
Sbjct  418  GEDCLEFKPERWLSPEGDRIQ  438



>gb|KCW78083.1| hypothetical protein EUGRSUZ_D02303 [Eucalyptus grandis]
Length=571

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KF+MQD +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL ++ GH+V QKMS
Sbjct  436  PDGQKFVMQDAFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLRVAAGHRVVQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTEST  429
            LTLFM+ GLKV V  RDL PI+ +++ + N   A VK NG   G  + +
Sbjct  496  LTLFMQYGLKVDVLRRDLEPILESIRRERNEE-AGVKLNGTLIGWCKES  543



>ref|XP_009128484.1| PREDICTED: cytochrome P450 86A2 [Brassica rapa]
Length=555

 Score =   139 bits (349),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IA AVLLRHRL+++ GH+VEQKMS
Sbjct  439  PDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAGAVLLRHRLTVAAGHKVEQKMS  498

Query  575  LTLFMKDGLKVKVHPRDLTPIV-SAMKDDHNRAPASVKCNGV  453
            LTLFMK+GL V VH RDL  I+ S +  + N      KCNGV
Sbjct  499  LTLFMKNGLMVNVHKRDLEGIMKSLITKESNDVIVLKKCNGV  540


 Score = 37.7 bits (86),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  425  GEDCLEFKPERWISPDDGKFVN  446



>ref|XP_007051775.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 ref|XP_007051776.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 gb|EOX95932.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 gb|EOX95933.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
Length=535

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D YKF+SFNAGPRICLG+DLAYLQMKS+AAA LLRH+L+L PGH+VEQKMSL
Sbjct  435  DGNKFIMHDSYKFVSFNAGPRICLGKDLAYLQMKSVAAAALLRHKLTLVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNG  456
            TLFMK GLKV V  RDL  IV  +  +        KCNG
Sbjct  495  TLFMKYGLKVNVAGRDLGAIVEKIISEEREGELHGKCNG  533



>ref|XP_006343967.1| PREDICTED: cytochrome P450 86A2-like [Solanum tuberosum]
Length=554

 Score =   141 bits (356),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+ +QD ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGNKYQVQDAFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVAPGHKVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM----KDDHNRAPASVKCNGVNEGG  441
            TLFMK GL + V PRDLTPI++ +    K DH+     +  NG+++ G
Sbjct  498  TLFMKYGLVMNVTPRDLTPILAKIEKFCKIDHSCGGEHIINNGIHQTG  545


 Score = 34.7 bits (78),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  423  GEDCLEFKPERWMS  436



>gb|EPS61958.1| hypothetical protein M569_12832, partial [Genlisea aurea]
Length=519

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF  +DQ++F++FNAGPRICLG+DLAYLQMKSIAA+VLLRHR+ ++ GH+VEQKMSL
Sbjct  435  DGKKFETKDQFQFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRVVVAAGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK+GLKV VHPRDLTPI+S ++
Sbjct  495  TLFMKNGLKVNVHPRDLTPIISKIE  519



>ref|XP_002275115.1| PREDICTED: cytochrome P450 86A8 [Vitis vinifera]
Length=558

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  +FI+ DQYKF++FNAGPRICLG+DLAYLQMKSIAA+VLLRHRL++  GH+VEQKMSL
Sbjct  435  DCQRFILHDQYKFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRLTVVAGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH-----NRAPASVKCNG  456
            TLFMK GLKV VH RDLT +V  ++++            VKCNG
Sbjct  495  TLFMKYGLKVNVHERDLTAVVDGVRNEKASEVCGEEAVRVKCNG  538



>emb|CAN80040.1| hypothetical protein VITISV_037194 [Vitis vinifera]
Length=580

 Score =   141 bits (356),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  435  DGKKIELQDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAPGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVS  507
            TLFMK GLKV V PRDLTPI++
Sbjct  495  TLFMKYGLKVNVQPRDLTPILA  516


 Score = 34.7 bits (78),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDCLEF+PERWL+    +I
Sbjct  420  GEDCLEFRPERWLSADGKKI  439



>ref|XP_010426970.1| PREDICTED: cytochrome P450 86A2 [Camelina sativa]
Length=556

 Score =   138 bits (347),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKM
Sbjct  438  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            SLTLFMK+GL V VH RDL  I+ ++     R    V  NG+  G
Sbjct  497  SLTLFMKNGLLVNVHKRDLEAIMKSLVVTRERNDV-VALNGICSG  540


 Score = 38.1 bits (87),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  424  GEDCLEFKPERWISPEDGKFVN  445



>emb|CDY15167.1| BnaC05g00460D [Brassica napus]
Length=555

 Score =   140 bits (353),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKM
Sbjct  438  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGG  441
            SLTLFMK+GL V +H RDL  I+ ++    +    +  C GV  GG
Sbjct  497  SLTLFMKNGLLVNLHKRDLQGIIKSLVVAKSDGVVNGNCTGVTCGG  542


 Score = 35.8 bits (81),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFIPERWISPIDGKFIN  445



>ref|XP_002875027.1| CYP86A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51286.1| CYP86A2 [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   137 bits (346),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKM
Sbjct  436  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM  494

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAM--KDDHNRAPASVKCNG  456
            SLTLFMK+GL V VH RDL  ++ ++  K  ++    + KCNG
Sbjct  495  SLTLFMKNGLLVNVHKRDLEVMMKSLVTKQRNDVVVLNGKCNG  537


 Score = 38.1 bits (87),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  422  GEDCLEFKPERWISPEDGKFVN  443



>ref|XP_009119710.1| PREDICTED: cytochrome P450 86A4 [Brassica rapa]
Length=555

 Score =   140 bits (352),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH++EQKM
Sbjct  438  PTDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKMEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGG  441
            SLTLFMK+GL V +H RDL  I+ ++    +    +  C GV  GG
Sbjct  497  SLTLFMKNGLLVNLHKRDLQGIIKSLVVAKSDGVVNGSCTGVTGGG  542


 Score = 35.8 bits (81),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFIPERWISPTDGKFIN  445



>emb|CBI40391.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 5/104 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  +FI+ DQYKF++FNAGPRICLG+DLAYLQMKSIAA+VLLRHRL++  GH+VEQKMSL
Sbjct  393  DCQRFILHDQYKFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRLTVVAGHRVEQKMSL  452

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH-----NRAPASVKCNG  456
            TLFMK GLKV VH RDLT +V  ++++            VKCNG
Sbjct  453  TLFMKYGLKVNVHERDLTAVVDGVRNEKASEVCGEEAVRVKCNG  496



>ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50544.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   141 bits (355),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG  F+  D YKF++FNAGPRICLG+ LAYLQMKS+AAA+LLRHR++L PGH+VEQKMSL
Sbjct  405  DGKNFMKHDSYKFVAFNAGPRICLGKHLAYLQMKSVAAALLLRHRITLVPGHKVEQKMSL  464

Query  572  TLFMKDGLKVKVHPRDLTPIVS------AMKDDHNRAPASVKCNGVNEGGTE  435
            TLFMKDGLKV VH R+L    +       +  ++N     V+CNGV+E G E
Sbjct  465  TLFMKDGLKVNVHKRNLEGTAARVITRNNLVRNNNEGRDGVRCNGVSESGEE  516


 Score = 34.7 bits (78),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  390  GDDCLEFKPERWLS  403



>ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula]
 gb|AET02042.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=540

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 83/104 (80%), Gaps = 5/104 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT FIM D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  436  DGTTFIMHDSFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVVPGHRVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD-----HNRAPASVKCNG  456
            TLFMK+GL+V V+ RDL  + + ++++       +    +KCNG
Sbjct  496  TLFMKNGLRVNVYNRDLKGVFATIQNEKEGEIQGKVLNDLKCNG  539



>ref|XP_011022670.1| PREDICTED: cytochrome P450 86A7-like [Populus euphratica]
Length=541

 Score =   140 bits (354),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD Y+F++FNAGPRICLG+DLAYLQMKSIAAA+LLRHR+S+ PGH+VEQKMSL
Sbjct  437  DGKKIEVQDSYRFLAFNAGPRICLGKDLAYLQMKSIAAALLLRHRISVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTEST  429
            TLFMK GL V VHPRDL PIV        R   +   NG +  G EST
Sbjct  497  TLFMKYGLMVNVHPRDLRPIV-------ERVRKNALTNGNHACGIEST  537


 Score = 34.7 bits (78),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  422  GDDCLEFKPERWLS  435



>ref|XP_007051777.1| Cytochrome P450 86A2 isoform 3, partial [Theobroma cacao]
 gb|EOX95934.1| Cytochrome P450 86A2 isoform 3, partial [Theobroma cacao]
Length=590

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D YKF+SFNAGPRICLG+DLAYLQMKS+AAA LLRH+L+L PGH+VEQKMSL
Sbjct  490  DGNKFIMHDSYKFVSFNAGPRICLGKDLAYLQMKSVAAAALLRHKLTLVPGHKVEQKMSL  549

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNG  456
            TLFMK GLKV V  RDL  IV  +  +        KCNG
Sbjct  550  TLFMKYGLKVNVAGRDLGAIVEKIISEEREGELHGKCNG  588



>ref|XP_008458223.1| PREDICTED: cytochrome P450 86A8-like [Cucumis melo]
Length=551

 Score =   139 bits (351),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFI  D YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  436  DGKKFIQYDPYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRA-------PASVKCNGVNEGGTE  435
            TLFMK GLKV VH R+L  +V +M+  +  +        A V CNG   G  E
Sbjct  496  TLFMKYGLKVNVHKRNLEGMVESMRGKYGNSHGKDGPLIAVVNCNGGCNGVKE  548


 Score = 35.4 bits (80),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  421  GEDCLEFRPERWLT  434



>gb|AJD25207.1| cytochrome P450 CYP86A91 [Salvia miltiorrhiza]
Length=555

 Score =   138 bits (348),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  KF+  D YKF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSL
Sbjct  437  DREKFVAHDSYKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPA  474
            TLFMKDGLKV +H RDL  +V+++  +   A A
Sbjct  497  TLFMKDGLKVNLHRRDLKSVVASVIKEREVAAA  529


 Score = 36.6 bits (83),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            G+DCLEFKPERWL+  R++ 
Sbjct  422  GDDCLEFKPERWLSSDREKF  441



>ref|XP_002509820.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51207.1| cytochrome P450, putative [Ricinus communis]
Length=545

 Score =   140 bits (353),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 6/103 (6%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD YKFI+FNAGPRICLG+DLAYLQMKSI+AAVLLRHRLS++ GH+VEQKMSL
Sbjct  441  DGKKMEVQDSYKFIAFNAGPRICLGKDLAYLQMKSISAAVLLRHRLSVAAGHRVEQKMSL  500

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GLKV VHPRDL P+V  +    N        NG  EG
Sbjct  501  TLFMKYGLKVNVHPRDLKPLVEVINKKGN------IINGNREG  537


 Score = 34.3 bits (77),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  426  GDDCLEFKPERWLS  439



>ref|XP_006647656.1| PREDICTED: cytochrome P450 86A2-like [Oryza brachyantha]
Length=532

 Score =   140 bits (353),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG+KF   D YKF++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  437  DGSKFEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPA  474
            TLFMK+GL+++VHPRDL P+   ++    RA A
Sbjct  497  TLFMKNGLRMEVHPRDLVPVADELRGADVRATA  529


 Score = 34.3 bits (77),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  422  GEDCLEFRPERWLS  435



>ref|NP_171666.1| cytochrome P450, family 86, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9LMM1.1|C86A4_ARATH RecName: Full=Cytochrome P450 86A4 [Arabidopsis thaliana]
 gb|AAF81318.1|AC061957_14 Contains a strong similarity to a cytochrome P450 86A2 from Arabidopsis 
thaliana gi|5915846 and contains a cytochrome P450 
PF|00067 domain [Arabidopsis thaliana]
 gb|AEE27310.1| cytochrome P450, family 86, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=554

 Score =   138 bits (348),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKM
Sbjct  438  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V ++ RDL  I+ ++    +   ++ +CNGV
Sbjct  497  SLTLFMKNGLLVNLYKRDLQGIIKSLVVKKSDGVSNGQCNGV  538


 Score = 35.8 bits (81),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFNPERWISPIDGKFIN  445



>emb|CDY07223.1| BnaCnng02380D [Brassica napus]
Length=559

 Score =   136 bits (342),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KF+  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL+++PGH+VEQKM
Sbjct  439  PEDG-KFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM  497

Query  578  SLTLFMKDGLKVKVHPRDLTPI----VSAMKDDHNRAPASVKCNGV  453
            SLTLFMK GL V VH R+L  I    VS   +D   A  + KC GV
Sbjct  498  SLTLFMKKGLVVNVHKRNLEGIVKSRVSTEINDVVAAGLNGKCKGV  543


 Score = 38.1 bits (87),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERW++P   +  N
Sbjct  425  GEDCLEFKPERWISPEDGKFVN  446



>ref|XP_010275632.1| PREDICTED: cytochrome P450 86A8-like [Nelumbo nucifera]
Length=558

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  +F  Q  +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRLSL+PGH VEQKMS
Sbjct  434  PDEKQFEAQHPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLSLAPGHCVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD-----HNRAPASVKCNGVNEGGTE  435
            LTLFMK GLKV VH RDLT I S++  +           +VKCNGV     +
Sbjct  494  LTLFMKYGLKVNVHHRDLTAIASSIHRETEGKLWGVEGLAVKCNGVTPAACD  545



>emb|CAN80156.1| hypothetical protein VITISV_023926 [Vitis vinifera]
Length=547

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 5/103 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  +FI+ DQYKF++FNAGPRICLG+DLAYLQMKSIAA+VLLRHRL++  GH+VEQKMSL
Sbjct  425  DCQRFILHDQYKFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRLTVVAGHRVEQKMSL  484

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH-----NRAPASVKCN  459
            TLFMK GLKV VH RDLT +V  ++++            VKCN
Sbjct  485  TLFMKYGLKVNVHERDLTAVVDGVRNEXASEVCGEEAVXVKCN  527



>ref|XP_010544737.1| PREDICTED: cytochrome P450 86A8 [Tarenaya hassleriana]
Length=531

 Score =   134 bits (337),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D ++F++FNAGPRICLG+DLAYLQMKSIAA VLLRHRL+++ GH+VEQKMSL
Sbjct  426  DGGRFINHDPFRFVAFNAGPRICLGKDLAYLQMKSIAATVLLRHRLTVANGHKVEQKMSL  485

Query  572  TLFMKDGLK----VKVHPRDLTPIVSAMKDDHNRAPASVKCNGVN  450
            TLFMK+GL+    V VH RDLT IVS + +          CNGV 
Sbjct  486  TLFMKNGLRHGLLVNVHKRDLTAIVSDLTEGKRNGVVDGVCNGVT  530


 Score = 38.9 bits (89),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERW++P  D
Sbjct  409  GEDCLEFKPERWISPSSD  426



>ref|XP_010522971.1| PREDICTED: cytochrome P450 86A2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010522972.1| PREDICTED: cytochrome P450 86A2-like isoform X2 [Tarenaya hassleriana]
Length=536

 Score =   138 bits (347),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P +G KFI  DQY+F++FNAGPR CLG+D+AYLQMKSIAAA+LLRHR+++ PGH+VEQKM
Sbjct  437  PSEGGKFINHDQYRFVAFNAGPRTCLGKDMAYLQMKSIAAALLLRHRVTMVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL+V +H RDL  IV ++  + +      KC+GV
Sbjct  497  SLTLFMKNGLRVHLHKRDLGAIVESIMAERDAG----KCDGV  534


 Score = 35.0 bits (79),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCLEF PERW++P
Sbjct  423  GEDCLEFNPERWISP  437



>ref|XP_009797448.1| PREDICTED: cytochrome P450 86A7-like [Nicotiana sylvestris]
Length=549

 Score =   137 bits (346),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+ +QD ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGNKYQVQDAFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVAPGHKVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNE  447
            TLFMK GL + V PRDLTPI++      + A   +  NG+++
Sbjct  498  TLFMKYGLVMNVTPRDLTPILAKFGKIESCAGEHLINNGIHQ  539


 Score = 34.7 bits (78),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  423  GEDCLEFKPERWMS  436



>ref|XP_008342161.1| PREDICTED: cytochrome P450 86A8 [Malus domestica]
Length=553

 Score =   137 bits (346),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 9/109 (8%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KFIM D  KF++FNAGPRICLG+DLAYLQMKS+ A+VLL HRL++ PGH+VEQKMS
Sbjct  434  PDGKKFIMHDSNKFVAFNAGPRICLGKDLAYLQMKSVTASVLLHHRLTVVPGHKVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD---------HNRAPASVKCNG  456
            LTLFMK GL V VH RDL  I+S++K +           +   +V+CNG
Sbjct  494  LTLFMKYGLMVNVHKRDLGAILSSIKKEMTTEGQLQGEEQECVAVECNG  542


 Score = 35.0 bits (79),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DCLEF PERWL+P
Sbjct  420  GDDCLEFXPERWLSP  434



>gb|KEH21079.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=517

 Score =   137 bits (346),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  MQ  YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL + PGH VEQKMSL
Sbjct  433  DGEK--MQSSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLEVVPGHCVEQKMSL  490

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GLKV VHPRDLTP++  +
Sbjct  491  TLFMKYGLKVNVHPRDLTPVLEKI  514


 Score = 34.7 bits (78),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHNA  730
            GEDCLEFKPERW +   +++ ++
Sbjct  418  GEDCLEFKPERWFSTDGEKMQSS  440



>gb|KDP25417.1| hypothetical protein JCGZ_20573 [Jatropha curcas]
Length=553

 Score =   137 bits (346),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  +QD YKF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRLS++ GH+VEQKMSL
Sbjct  439  DGKKIEVQDSYKFLAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLSVAAGHRVEQKMSL  498

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL V VHPRDL PI+ ++
Sbjct  499  TLFMKYGLLVDVHPRDLKPILESI  522


 Score = 34.7 bits (78),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  424  GDDCLEFKPERWLS  437



>gb|EYU38337.1| hypothetical protein MIMGU_mgv1a005555mg [Erythranthe guttata]
Length=479

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +F+ +DQ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRH L L PGH+ EQKMSL
Sbjct  389  DGGRFVARDQFQFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHVLVLPPGHKAEQKMSL  448

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRA  480
            TLFMKDGLKV V PRDL PIV  + ++   A
Sbjct  449  TLFMKDGLKVNVLPRDLAPIVDKIGNNDGGA  479



>ref|XP_011092582.1| PREDICTED: cytochrome P450 86A8-like [Sesamum indicum]
Length=521

 Score =   137 bits (346),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF+M D YKF++FNAGPRICLG+DLA LQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  435  DGNKFVMHDSYKFVAFNAGPRICLGKDLASLQMKSIAAAVLLRHRLTMAAGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            TLFM+ GLKV V  RDL+PIV+++ ++
Sbjct  495  TLFMRHGLKVDVRARDLSPIVASIMNN  521


 Score = 34.7 bits (78),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  420  GDDCLEFKPERWLS  433



>ref|XP_009143197.1| PREDICTED: cytochrome P450 86A8 [Brassica rapa]
Length=538

 Score =   138 bits (348),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  437  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            TLFMK GL V VH RDLT I + +++  + A     CNGV
Sbjct  497  TLFMKYGLLVNVHNRDLTAIAADLRESKSNAVNDGVCNGV  536


 Score = 33.5 bits (75),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERW++
Sbjct  421  GDDCLEFKPERWIS  434



>ref|XP_009367816.1| PREDICTED: cytochrome P450 86A8 isoform X1 [Pyrus x bretschneideri]
Length=554

 Score =   136 bits (342),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 9/108 (8%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KFIM D  KF++FNAGPRICLG+DLAYLQMKS+ A+VLLRHRL++ PGH+VEQKMS
Sbjct  436  PDGKKFIMHDSNKFVAFNAGPRICLGKDLAYLQMKSVTASVLLRHRLTVVPGHKVEQKMS  495

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD---------HNRAPASVKCN  459
            LTLFMK GL V VH R+L  I+S++K +           +   +V+CN
Sbjct  496  LTLFMKYGLMVNVHKRELGAILSSIKKEMTTEGQLQGEEQECVAVECN  543


 Score = 35.8 bits (81),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DCLEF+PERWL+P
Sbjct  422  GDDCLEFRPERWLSP  436



>ref|XP_002320802.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE99117.1| cytochrome P450 family protein [Populus trichocarpa]
Length=565

 Score =   136 bits (342),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D YKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRLS+  GH+VEQKMSL
Sbjct  436  DGEKFIMHDSYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLSVVQGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDL  522
            TLFMK GLKV VH RDL
Sbjct  496  TLFMKHGLKVNVHKRDL  512


 Score = 35.8 bits (81),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  421  GEDCLEFKPERWLS  434



>gb|AJD25208.1| cytochrome P450 CYP86A92 [Salvia miltiorrhiza]
Length=525

 Score =   137 bits (345),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  KF+ +DQ++F++FNAGPRICLG+DLAYLQMKSIAAA+LLRHRL ++ GH+VEQKMSL
Sbjct  435  DEKKFVAKDQFQFVAFNAGPRICLGKDLAYLQMKSIAAALLLRHRLVVAAGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIV  510
            TLFMKDGLKV VHPRDLT I+
Sbjct  495  TLFMKDGLKVNVHPRDLTLIL  515


 Score = 34.7 bits (78),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  420  GDDCLEFKPERWLS  433



>ref|XP_010255320.1| PREDICTED: cytochrome P450 86A8 [Nelumbo nucifera]
Length=561

 Score =   136 bits (342),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 8/108 (7%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PD  +F  Q  +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMS
Sbjct  434  PDEKQFEAQHPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAPGHRVEQKMS  493

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAP--------ASVKCNG  456
            LTLFMK GLKV VH RDLT I +++  ++             +V CNG
Sbjct  494  LTLFMKYGLKVNVHERDLTAIAASIPKENTEEKLWGRVVDGMAVNCNG  541


 Score = 35.4 bits (80),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDCL+F+PERWL+P
Sbjct  420  GEDCLKFRPERWLSP  434



>ref|XP_009367817.1| PREDICTED: cytochrome P450 86A8 isoform X2 [Pyrus x bretschneideri]
Length=550

 Score =   135 bits (341),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 9/108 (8%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KFIM D  KF++FNAGPRICLG+DLAYLQMKS+ A+VLLRHRL++ PGH+VEQKMS
Sbjct  432  PDGKKFIMHDSNKFVAFNAGPRICLGKDLAYLQMKSVTASVLLRHRLTVVPGHKVEQKMS  491

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD---------HNRAPASVKCN  459
            LTLFMK GL V VH R+L  I+S++K +           +   +V+CN
Sbjct  492  LTLFMKYGLMVNVHKRELGAILSSIKKEMTTEGQLQGEEQECVAVECN  539


 Score = 35.8 bits (81),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DCLEF+PERWL+P
Sbjct  418  GDDCLEFRPERWLSP  432



>gb|KDO86201.1| hypothetical protein CISIN_1g009235mg [Citrus sinensis]
Length=539

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF M D +KF++FNAGPRICLG+DLAYLQMKS+AAAVLLRH L++ PGH+VEQKMSL
Sbjct  435  DGTKFEMHDSFKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHGLTVVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTES  432
            TLFMK+GLKV VH R+L  IV ++K    +    +  +G  +GG E+
Sbjct  495  TLFMKNGLKVNVHTRELEGIVQSIK--KRKKNNCMHLSGGGDGGAEN  539



>ref|XP_006445018.1| hypothetical protein CICLE_v10019633mg [Citrus clementina]
 ref|XP_006491128.1| PREDICTED: cytochrome P450 86A2-like [Citrus sinensis]
 gb|ESR58258.1| hypothetical protein CICLE_v10019633mg [Citrus clementina]
Length=539

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF M D +KF++FNAGPRICLG+DLAYLQMKS+AAAVLLRH L++ PGH+VEQKMSL
Sbjct  435  DGTKFEMHDSFKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHGLTVVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTES  432
            TLFMK+GLKV VH R+L  IV ++K    +    +  +G  +GG E+
Sbjct  495  TLFMKNGLKVNVHTRELEGIVQSIK--KRKKNNCMHLSGGGDGGAEN  539



>ref|XP_011036497.1| PREDICTED: cytochrome P450 86A8-like [Populus euphratica]
Length=565

 Score =   135 bits (341),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D YKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRLS+  GH+VEQKMSL
Sbjct  436  DGKKFIMHDSYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLSVVQGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDL  522
            TLFMK GLKV VH RDL
Sbjct  496  TLFMKHGLKVNVHKRDL  512


 Score = 35.8 bits (81),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  421  GEDCLEFKPERWLS  434



>ref|XP_009118821.1| PREDICTED: cytochrome P450 86A4 [Brassica rapa]
Length=536

 Score =   135 bits (341),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHR+++ PGH+VEQKM
Sbjct  434  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRITVVPGHRVEQKM  492

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V +H RDL   + ++           KC+GV
Sbjct  493  SLTLFMKNGLLVNLHKRDLEGTIKSLVVAKGDGVIDGKCDGV  534


 Score = 35.4 bits (80),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  420  GEDCLEFIPERWISPIDGKFIN  441



>gb|ACG38359.1| cytochrome P450 CYP86A35 [Zea mays]
Length=534

 Score =   137 bits (345),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  436  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVARGHRVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKC  462
            TLFMK GL+++VHPRDL P++  ++      PA   C
Sbjct  496  TLFMKHGLRMEVHPRDLAPVIDELRGAGAARPAMAPC  532


 Score = 33.9 bits (76),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  421  GEDCLEFRPERWLS  434



>gb|AFW72704.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=534

 Score =   137 bits (344),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  436  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVARGHRVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKC  462
            TLFMK GL+++VHPRDL P++  ++      PA   C
Sbjct  496  TLFMKHGLRMEVHPRDLAPVIDELRGAGAARPAMAPC  532


 Score = 33.9 bits (76),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  421  GEDCLEFRPERWLS  434



>dbj|BAC42067.1| unknown protein [Arabidopsis thaliana]
Length=554

 Score =   135 bits (340),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKM
Sbjct  438  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V ++ RD   I+ ++    +   ++ +CNGV
Sbjct  497  SLTLFMKNGLLVNLYKRDPQGIIKSLVVKKSDGVSNGQCNGV  538


 Score = 35.8 bits (81),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFNPERWISPIDGKFIN  445



>ref|NP_001183394.1| uncharacterized protein LOC100501810 [Zea mays]
 gb|ACR36635.1| unknown [Zea mays]
Length=518

 Score =   137 bits (344),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  420  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVARGHRVEQKMSL  479

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKC  462
            TLFMK GL+++VHPRDL P++  ++      PA   C
Sbjct  480  TLFMKHGLRMEVHPRDLAPVIDELRGAGAARPAMAPC  516


 Score = 33.9 bits (76),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  405  GEDCLEFRPERWLS  418



>ref|XP_009397933.1| PREDICTED: cytochrome P450 86A2-like [Musa acuminata subsp. malaccensis]
Length=531

 Score =   134 bits (338),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +F+  D +KF++FN GPRICLG+DLAYLQMKSIAAAVLLRH+LS++PGH+VEQKMS
Sbjct  429  PDGNRFLPHDSFKFVAFNGGPRICLGKDLAYLQMKSIAAAVLLRHQLSVAPGHRVEQKMS  488

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAM  501
            LTLFM++GL+V VH R+LT I   +
Sbjct  489  LTLFMRNGLRVNVHDRNLTTIAEEL  513


 Score = 35.8 bits (81),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DCLEF+PERWL+P
Sbjct  415  GDDCLEFRPERWLSP  429



>emb|CDX90044.1| BnaA10g00380D [Brassica napus]
Length=538

 Score =   135 bits (339),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKM
Sbjct  438  PTDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM  496

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAM  501
            SLTLFMK+GL V +H RDL  I+ ++
Sbjct  497  SLTLFMKNGLLVNLHKRDLQGIIKSL  522


 Score = 35.8 bits (81),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  424  GEDCLEFIPERWISPTDGKFIN  445



>gb|KJB25882.1| hypothetical protein B456_004G213300 [Gossypium raimondii]
Length=534

 Score =   134 bits (337),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +F  QD YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  435  DGKRFETQDSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAEGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL + VHPR+L P++  +
Sbjct  495  TLFMKYGLVMDVHPRNLKPVLEKI  518


 Score = 35.8 bits (81),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  420  GEDCLEFKPERWLS  433



>ref|XP_010053250.1| PREDICTED: cytochrome P450 86A7 [Eucalyptus grandis]
 gb|KCW77511.1| hypothetical protein EUGRSUZ_D01839 [Eucalyptus grandis]
Length=553

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +  +QD +KF+SFNAGPR+CLG+DLAYLQMKS+ AAVLLRHRL+++PGH+VEQKMSL
Sbjct  440  DGKRLELQDSFKFVSFNAGPRLCLGKDLAYLQMKSVVAAVLLRHRLTVAPGHRVEQKMSL  499

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNG  456
            TLFMK GLK+ VH RDL PI++ +  + +    +V  NG
Sbjct  500  TLFMKYGLKMNVHQRDLRPILAKITKNDDLCGKAVLSNG  538



>ref|XP_006397782.1| hypothetical protein EUTSA_v10001389mg [Eutrema salsugineum]
 gb|ESQ39235.1| hypothetical protein EUTSA_v10001389mg [Eutrema salsugineum]
Length=541

 Score =   136 bits (342),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  437  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL V VH RDLT I + +     R     K N VN+G
Sbjct  497  TLFMKYGLLVNVHKRDLTAIAADL-----RGKTGCKSNAVNDG  534


 Score = 33.9 bits (76),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERW++
Sbjct  421  GDDCLEFKPERWIS  434



>ref|XP_006418437.1| hypothetical protein EUTSA_v10007350mg [Eutrema salsugineum]
 gb|ESQ36790.1| hypothetical protein EUTSA_v10007350mg [Eutrema salsugineum]
Length=528

 Score =   134 bits (337),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKM
Sbjct  437  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM  495

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAM  501
            SLTLFMK+GL V +H RDL  I+ ++
Sbjct  496  SLTLFMKNGLLVNLHKRDLEGIIKSL  521


 Score = 35.4 bits (80),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  423  GEDCLEFVPERWISPIDGKFIN  444



>ref|XP_011072860.1| PREDICTED: cytochrome P450 86A7 [Sesamum indicum]
Length=545

 Score =   135 bits (339),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF  +DQY+F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL ++ GH+VEQKMSL
Sbjct  438  DGKKFEARDQYQFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLVVAAGHKVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTE  435
            TLFMKDGLKV V  R+L PI+  +     +A   +  NG++    E
Sbjct  498  TLFMKDGLKVNVQARELGPILDKIGGT-GKAREGLITNGISHAHVE  542


 Score = 34.3 bits (77),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  423  GDDCLEFKPERWLS  436



>ref|XP_007218993.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica]
 gb|EMJ20192.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica]
Length=534

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KFIM D  K+++FNAGPRICLG+DLAYLQMKS+ A+VLLRHRL+L PGH+VEQKMSL
Sbjct  435  DGKKFIMHDSNKYVAFNAGPRICLGKDLAYLQMKSVVASVLLRHRLTLVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            TLFMK GL V VHPR+L  IV+  K D
Sbjct  495  TLFMKHGLMVNVHPRELGAIVARAKKD  521



>ref|XP_004306772.1| PREDICTED: cytochrome P450 86A8-like [Fragaria vesca subsp. vesca]
Length=553

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 5/103 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FIM D  K+++FNAGPRICLG+DLAYLQMKS+AA+VLLRHRL++ PGH+VEQKMSL
Sbjct  435  DGKRFIMHDSSKYVAFNAGPRICLGKDLAYLQMKSVAASVLLRHRLTVVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDD-----HNRAPASVKCN  459
            TLFMK GL V VH RDL P++   K D     + +   ++KCN
Sbjct  495  TLFMKYGLMVNVHQRDLGPVLGRAKRDMEVKLNGQDSIAIKCN  537



>ref|XP_002304502.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE79481.2| cytochrome P450 family protein [Populus trichocarpa]
Length=550

 Score =   134 bits (338),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  + D Y+F++FNAGPRICLG+DLAYLQMKSIAAA+LLRHR+S+ PGH+VEQKMSL
Sbjct  446  DGKKIEVPDSYRFLAFNAGPRICLGKDLAYLQMKSIAAALLLRHRISVVPGHRVEQKMSL  505

Query  572  TLFMKDGLKVKVHPRDLTPIV  510
            TLFMK GL V VHPRDL PIV
Sbjct  506  TLFMKYGLMVNVHPRDLRPIV  526


 Score = 34.7 bits (78),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERWL+
Sbjct  431  GDDCLEFKPERWLS  444



>emb|CDY38015.1| BnaCnng08760D [Brassica napus]
Length=537

 Score =   134 bits (336),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -2

Query  758  PPDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P DG KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRH++++ PGH+VEQKM
Sbjct  435  PIDG-KFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHQITVVPGHRVEQKM  493

Query  578  SLTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            SLTLFMK+GL V +H RDL   + ++         + KC+GV
Sbjct  494  SLTLFMKNGLLVNLHKRDLEGTIKSLVVAKGDGVVNGKCDGV  535


 Score = 35.4 bits (80),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEF PERW++P   +  N
Sbjct  421  GEDCLEFIPERWISPIDGKFIN  442



>ref|XP_010506590.1| PREDICTED: cytochrome P450 86A8-like isoform X1 [Camelina sativa]
 ref|XP_010506591.1| PREDICTED: cytochrome P450 86A8-like isoform X2 [Camelina sativa]
Length=538

 Score =   135 bits (340),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL V VH RDLT I + ++++     A+V  +GV  G
Sbjct  496  TLFMKYGLVVNVHERDLTGIAAELREEKT---ANVNDDGVGNG  535


 Score = 33.9 bits (76),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  420  GEDCMEFKPERWIS  433



>gb|AAG17470.1|AF123610_9 cytochrome P450 [Triticum aestivum]
Length=541

 Score =   135 bits (339),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D YKF++FNAGPR+CLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGTKFEQHDSYKFVAFNAGPRVCLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIV  510
            TLFMK GL+++V PRDL P++
Sbjct  498  TLFMKGGLRMEVRPRDLAPVL  518


 Score = 33.9 bits (76),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  423  GEDCLEFRPERWLS  436



>ref|XP_004503701.1| PREDICTED: cytochrome P450 86A2-like [Cicer arietinum]
Length=516

 Score =   133 bits (335),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K  MQ  YKF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRLS++PGH+VEQKMSL
Sbjct  433  DGEK--MQGSYKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLSVAPGHRVEQKMSL  490

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKD  495
            TLFMK GL V VH RDL P++  + +
Sbjct  491  TLFMKYGLMVNVHSRDLAPMLQKIAN  516


 Score = 35.8 bits (81),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHNA  730
            GEDCLEFKPERWL+   +++  +
Sbjct  418  GEDCLEFKPERWLSTDGEKMQGS  440



>gb|EMT14997.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=541

 Score =   135 bits (339),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D YKF++FNAGPR+CLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGTKFEQHDSYKFVAFNAGPRVCLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIV  510
            TLFMK GL+++V PRDL P++
Sbjct  498  TLFMKGGLRMEVRPRDLAPVL  518


 Score = 33.9 bits (76),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  423  GEDCLEFRPERWLS  436



>emb|CDX74778.1| BnaA05g05240D [Brassica napus]
Length=541

 Score =   135 bits (339),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  437  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVK---CNGV  453
            TLFMK GL V VH RDLT I + +++  +    +V    CNGV
Sbjct  497  TLFMKYGLLVNVHNRDLTAIAADLREKRDCESNAVNDGVCNGV  539


 Score = 33.5 bits (75),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERW++
Sbjct  421  GDDCLEFKPERWIS  434



>ref|XP_006652635.1| PREDICTED: cytochrome P450 86A4-like [Oryza brachyantha]
Length=540

 Score =   135 bits (341),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D ++F++FNAGPRICLG+DLAYLQM++IA +VLLRHRLS++PGH+VEQKMSL
Sbjct  440  DGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLLRHRLSVAPGHRVEQKMSL  499

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL PIV  ++
Sbjct  500  TLFMKHGLRMEVRPRDLAPIVDELR  524


 Score = 33.1 bits (74),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEF+PERWL+
Sbjct  425  GDDCLEFRPERWLS  438



>ref|XP_004298810.1| PREDICTED: cytochrome P450 86A7 [Fragaria vesca subsp. vesca]
Length=543

 Score =   133 bits (335),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +  +QD YKF++FN GPRICLG+DLAYLQMKSIA+A+LLRHRL++ PGH+VEQKMSL
Sbjct  437  DGKQMEVQDSYKFVAFNGGPRICLGKDLAYLQMKSIASAMLLRHRLAVVPGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GLKV V PRDL P++  M
Sbjct  497  TLFMKYGLKVSVQPRDLKPVLEKM  520


 Score = 35.4 bits (80),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  422  GEDCLEFKPERWLS  435



>gb|EYU23445.1| hypothetical protein MIMGU_mgv1a026937mg [Erythranthe guttata]
Length=523

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF  +DQ++F++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  436  DGKKFEAKDQFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVAVGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GLKV VH RDL PI+  +
Sbjct  496  TLFMKYGLKVNVHRRDLAPILEKI  519



>dbj|BAJ86471.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95804.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   134 bits (338),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 4/88 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG+KF   D YKF++FNAGPR+CLG+DLAYLQMK+IA +VLLRHRL+++PGH VEQKMSL
Sbjct  438  DGSKFEQHDSYKFVAFNAGPRVCLGKDLAYLQMKNIAGSVLLRHRLTVAPGHCVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH  489
            TLFMKDGL+++V PRDL P++    D+H
Sbjct  498  TLFMKDGLRMEVCPRDLAPVL----DEH  521


 Score = 33.9 bits (76),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  423  GEDCLEFRPERWLS  436



>ref|NP_001047674.1| Os02g0666500 [Oryza sativa Japonica Group]
 dbj|BAD28400.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD27777.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF09588.1| Os02g0666500 [Oryza sativa Japonica Group]
 dbj|BAG91222.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57534.1| hypothetical protein OsJ_07852 [Oryza sativa Japonica Group]
Length=532

 Score =   134 bits (336),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG+KF   D YKF++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  437  DGSKFEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPA  474
            TLFMK+GL+++V PRDL P+   ++    RA A
Sbjct  497  TLFMKNGLRMEVRPRDLAPVADELRGADVRATA  529


 Score = 34.3 bits (77),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  422  GEDCLEFRPERWLS  435



>gb|EEC73748.1| hypothetical protein OsI_08390 [Oryza sativa Indica Group]
Length=501

 Score =   133 bits (335),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG+KF   D YKF++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  406  DGSKFEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSL  465

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPA  474
            TLFMK+GL+++V PRDL P+   ++    RA A
Sbjct  466  TLFMKNGLRMEVRPRDLAPVADELRGADVRATA  498


 Score = 34.3 bits (77),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  391  GEDCLEFRPERWLS  404



>gb|EYU32135.1| hypothetical protein MIMGU_mgv1a003916mg [Erythranthe guttata]
Length=555

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  749  GTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLT  570
            G +F M D YKF++FNAGPRICLG+DLAYLQMKS+AAAVLLRHRL++ PGH+VEQKMSLT
Sbjct  436  GDRFSMHDSYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLTVVPGHKVEQKMSLT  495

Query  569  LFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASV-KCNGVNE  447
            LFMK GLKV VH RDL  + +++  +      S  KC G +E
Sbjct  496  LFMKYGLKVNVHRRDLGLVAASVAKERCLGTLSNGKCGGFSE  537



>gb|KJB24757.1| hypothetical protein B456_004G159000 [Gossypium raimondii]
Length=527

 Score =   133 bits (334),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FIM D YKF++FNAGPRICLGR LAYLQMKS+AAA LLRH+L+++PGH+VEQK+SL
Sbjct  435  DGKEFIMHDSYKFVAFNAGPRICLGRGLAYLQMKSVAAAALLRHKLTVAPGHKVEQKISL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH  489
            TLFMK GLKV VH RDL  IV  + ++ 
Sbjct  495  TLFMKYGLKVNVHGRDLGAIVEKIINEQ  522


 Score = 34.7 bits (78),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            G+DCLEF+PERWLT    E 
Sbjct  420  GDDCLEFRPERWLTADGKEF  439



>ref|XP_009402078.1| PREDICTED: cytochrome P450 86A8-like [Musa acuminata subsp. malaccensis]
Length=532

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +F MQD ++F++FNAGPRICLG+DLAYLQMKSIAA+VLLRHRL+++PGH+VEQKMSL
Sbjct  430  DGKRFEMQDSFRFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRLNVAPGHRVEQKMSL  489

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GLK+ VH RD+  I S ++
Sbjct  490  TLFMKHGLKMNVHDRDMDSIASEVR  514



>ref|XP_009610115.1| PREDICTED: cytochrome P450 86A7-like [Nicotiana tomentosiformis]
Length=552

 Score =   132 bits (333),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+ +QD ++F++FNAGPRICLG+DLAYLQMKSI AAVLLRHRL + PGH+VEQKMSL
Sbjct  438  DGNKYQVQDAFRFVAFNAGPRICLGKDLAYLQMKSIVAAVLLRHRLVVVPGHKVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL + V PRDLTPI++ +
Sbjct  498  TLFMKYGLVMNVTPRDLTPILAKI  521


 Score = 34.7 bits (78),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  423  GEDCLEFKPERWMS  436



>ref|XP_003570074.1| PREDICTED: cytochrome P450 86A2-like [Brachypodium distachyon]
Length=537

 Score =   133 bits (335),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D YKF++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  439  DGTKFEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAPGHRVEQKMSL  498

Query  572  TLFMKDGLKVKVHPRDLT  519
            TLFMKDGL+++V PRDL+
Sbjct  499  TLFMKDGLRMEVRPRDLS  516


 Score = 33.9 bits (76),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  424  GEDCLEFRPERWLS  437



>ref|XP_002886391.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=549

 Score =   124 bits (312),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++PGH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKMSLTLFMKFGL  500

Query  548  KVKVHPRDLT-PIVSAMKDDHN-RAPASVKCNGVNEG  444
            K+ VH RDLT P+   + +  N  +    +  G N+G
Sbjct  501  KMDVHRRDLTLPVEKVVNEMRNYESCGKSEIIGTNDG  537


 Score = 42.7 bits (99),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERWL   RDEI N
Sbjct  420  GEDCLEFKPERWLEENRDEICN  441



>ref|NP_182121.1| cytochrome P450, family 86, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 sp|O80823.1|C86A8_ARATH RecName: Full=Cytochrome P450 86A8; AltName: Full=Protein LACERATA 
[Arabidopsis thaliana]
 emb|CAC67445.1| CYP86A8 protein [Arabidopsis thaliana]
 gb|AAL38383.1| At2g45970/F4I18.5 [Arabidopsis thaliana]
 gb|AAM14972.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAN72250.1| At2g45970/F4I18.5 [Arabidopsis thaliana]
 gb|AEC10625.1| cytochrome P450, family 86, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=537

 Score =   132 bits (333),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 8/103 (8%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIA+AVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIASAVLLRHRLTVVTGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL V VH RDLT I + +++         K N VN+G
Sbjct  496  TLFMKYGLLVNVHERDLTAIAADLRE--------CKSNVVNDG  530


 Score = 34.7 bits (78),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  420  GEDCLEFKPERWIS  433



>ref|XP_004955136.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=455

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  357  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAPGHRVEQKMSL  416

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+++V PRDL P++  +
Sbjct  417  TLFMKHGLRMEVRPRDLAPVIDEL  440



>ref|XP_004976485.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=542

 Score =   133 bits (334),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  442  DGARFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAPGHRVEQKMSL  501

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL P+V  ++
Sbjct  502  TLFMKHGLRMEVRPRDLGPVVDELR  526


 Score = 34.3 bits (77),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  427  GEDCLEFRPERWLS  440



>gb|EEE61483.1| hypothetical protein OsJ_15764 [Oryza sativa Japonica Group]
Length=508

 Score =   134 bits (336),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D ++F++FNAGPRICLG+DLAYLQM++IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  408  DGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLLRHRLAVAPGHRVEQKMSL  467

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+++V PRDL PIV  +
Sbjct  468  TLFMKHGLRMEVRPRDLAPIVDEL  491


 Score = 33.1 bits (74),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEF+PERWL+
Sbjct  393  GDDCLEFRPERWLS  406



>gb|EAY95147.1| hypothetical protein OsI_16965 [Oryza sativa Indica Group]
Length=526

 Score =   134 bits (336),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D ++F++FNAGPRICLG+DLAYLQM++IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  426  DGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLLRHRLAVAPGHRVEQKMSL  485

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+++V PRDL PIV  +
Sbjct  486  TLFMKHGLRMEVRPRDLAPIVDEL  509


 Score = 33.1 bits (74),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEF+PERWL+
Sbjct  411  GDDCLEFRPERWLS  424



>ref|NP_001053543.1| Os04g0560100 [Oryza sativa Japonica Group]
 emb|CAE01843.2| OSJNBa0084K11.4 [Oryza sativa Japonica Group]
 dbj|BAF15457.1| Os04g0560100 [Oryza sativa Japonica Group]
 emb|CAH68054.1| B0103C08-B0602B01.11 [Oryza sativa Indica Group]
 dbj|BAG97496.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   133 bits (335),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTKF   D ++F++FNAGPRICLG+DLAYLQM++IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  445  DGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLLRHRLAVAPGHRVEQKMSL  504

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL+++V PRDL PIV  +
Sbjct  505  TLFMKHGLRMEVRPRDLAPIVDEL  528


 Score = 33.1 bits (74),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEF+PERWL+
Sbjct  430  GDDCLEFRPERWLS  443



>ref|XP_002452782.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
 gb|EES05758.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
Length=542

 Score =   133 bits (334),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++ GH+VEQKMSL
Sbjct  442  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSL  501

Query  572  TLFMKDGLKVKVHPRDLTPIV  510
            TLFMK GL+++VHPRDL P++
Sbjct  502  TLFMKHGLRMEVHPRDLAPVI  522


 Score = 33.1 bits (74),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWL+
Sbjct  427  GEDCLDFRPERWLS  440



>ref|XP_006293977.1| hypothetical protein CARUB_v10022968mg [Capsella rubella]
 gb|EOA26875.1| hypothetical protein CARUB_v10022968mg [Capsella rubella]
Length=535

 Score =   131 bits (329),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKD  495
            TLFMK GL V VH RDLT I + +++
Sbjct  496  TLFMKYGLLVNVHERDLTGIAAELRE  521


 Score = 34.7 bits (78),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  420  GEDCLEFKPERWIS  433



>ref|XP_010508082.1| PREDICTED: cytochrome P450 86A8 [Camelina sativa]
Length=539

 Score =   132 bits (331),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHN  486
            TLFMK GL V VH RDLT I + ++++ +
Sbjct  496  TLFMKYGLLVNVHERDLTGIAAELREEKS  524


 Score = 33.9 bits (76),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  420  GEDCMEFKPERWIS  433



>ref|XP_010518254.1| PREDICTED: cytochrome P450 86A8-like [Camelina sativa]
Length=536

 Score =   131 bits (330),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 5/103 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVAGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL V VH RDLT I + +     R   +   +GV  G
Sbjct  496  TLFMKYGLLVNVHERDLTGIAAEL-----REKKTANVDGVGNG  533


 Score = 33.9 bits (76),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  420  GEDCMEFKPERWIS  433



>ref|XP_002448320.1| hypothetical protein SORBIDRAFT_06g025170 [Sorghum bicolor]
 gb|EES12648.1| hypothetical protein SORBIDRAFT_06g025170 [Sorghum bicolor]
Length=538

 Score =   131 bits (329),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  438  DGTRFEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAPGHRVEQKMSL  497

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL  ++  ++
Sbjct  498  TLFMKHGLRMEVRPRDLGAVIDELR  522


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  423  GEDCLEFRPERWLS  436



>gb|ACN34158.1| unknown [Zea mays]
 tpg|DAA36467.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=646

 Score =   131 bits (330),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  546  DGTRFQPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  605

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL+ ++  ++
Sbjct  606  TLFMKHGLRMEVRPRDLSVVIDELR  630


 Score = 33.5 bits (75),  Expect(2) = 7e-32, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWL+
Sbjct  531  GEDCLQFRPERWLS  544



>ref|XP_008667081.1| PREDICTED: uncharacterized protein LOC100192011 isoform X1 [Zea 
mays]
Length=618

 Score =   132 bits (331),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  518  DGTRFQPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  577

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL+ ++  ++
Sbjct  578  TLFMKHGLRMEVRPRDLSVVIDELR  602


 Score = 33.1 bits (74),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWL+
Sbjct  503  GEDCLQFRPERWLS  516



>ref|XP_002882043.1| CYP86A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58302.1| CYP86A8 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  436  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL V VH RDLT I + ++
Sbjct  496  TLFMKYGLLVNVHERDLTVIAADLR  520


 Score = 34.7 bits (78),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW++
Sbjct  420  GEDCLEFKPERWIS  433



>ref|XP_010430476.1| PREDICTED: cytochrome P450 86A7 [Camelina sativa]
Length=533

 Score =   125 bits (313),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++ GH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVASGHRVEQKMSLTLFMKYGL  500

Query  548  KVKVHPRDLTPIVSAMKDDHNR  483
            K+ VH RDLT  V  M ++ ++
Sbjct  501  KMDVHKRDLTSTVEKMVNEMSK  522


 Score = 40.0 bits (92),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERWL   R++I N
Sbjct  420  GEDCLEFKPERWLDENREDICN  441



>ref|NP_001130907.1| putative cytochrome P450 superfamily protein isoform 1 [Zea mays]
 gb|ACF79291.1| unknown [Zea mays]
Length=513

 Score =   131 bits (330),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  413  DGTRFQPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  472

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL+ ++  ++
Sbjct  473  TLFMKHGLRMEVRPRDLSVVIDELR  497


 Score = 33.1 bits (74),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWL+
Sbjct  398  GEDCLQFRPERWLS  411



>ref|XP_006439526.1| hypothetical protein CICLE_v10019616mg [Citrus clementina]
 gb|ESR52766.1| hypothetical protein CICLE_v10019616mg [Citrus clementina]
Length=541

 Score =   129 bits (324),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+   DQYKF++FNAGPRICLG+DLAYLQMKSIAA VLLR+ L++ PGH+VEQKMSL
Sbjct  441  DGNKYEGHDQYKFVAFNAGPRICLGKDLAYLQMKSIAAEVLLRYHLTVVPGHRVEQKMSL  500

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL + VHPR+L P++  +           KC G  +G
Sbjct  501  TLFMKYGLMMNVHPRELKPMLEKI----------CKCGGNYQG  533


 Score = 35.8 bits (81),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  426  GEDCLEFKPERWLS  439



>gb|KDO76250.1| hypothetical protein CISIN_1g037522mg [Citrus sinensis]
Length=541

 Score =   129 bits (324),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+   DQYKF++FNAGPRICLG+DLAYLQMKSIAA VLLR+ L++ PGH+VEQKMSL
Sbjct  441  DGNKYEGHDQYKFVAFNAGPRICLGKDLAYLQMKSIAAEVLLRYHLTVVPGHRVEQKMSL  500

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL + VHPR+L P++  +           KC G  +G
Sbjct  501  TLFMKYGLMMNVHPRELKPMLEKI----------CKCGGNYQG  533


 Score = 35.8 bits (81),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  426  GEDCLEFKPERWLS  439



>ref|XP_008667082.1| PREDICTED: uncharacterized protein LOC100192011 isoform X2 [Zea 
mays]
 gb|ACN28568.1| unknown [Zea mays]
 tpg|DAA36468.1| TPA: putative cytochrome P450 superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA36469.1| TPA: putative cytochrome P450 superfamily protein isoform 2 [Zea 
mays]
Length=536

 Score =   131 bits (330),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGT+F   D Y+F++FNAGPRICLG+DLAYLQMK+IA +VLLRHRL+++PGH+VEQKMSL
Sbjct  436  DGTRFQPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL+++V PRDL+ ++  ++
Sbjct  496  TLFMKHGLRMEVRPRDLSVVIDELR  520


 Score = 33.1 bits (74),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWL+
Sbjct  421  GEDCLQFRPERWLS  434



>ref|XP_006476545.1| PREDICTED: cytochrome P450 86A8-like [Citrus sinensis]
Length=541

 Score =   129 bits (324),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+   DQYKF++FNAGPRICLG+DLAYLQMKSIAA VLLR+ L++ PGH+VEQKMSL
Sbjct  441  DGNKYEGHDQYKFVAFNAGPRICLGKDLAYLQMKSIAAEVLLRYHLTVVPGHRVEQKMSL  500

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL + VHPR+L P++  +           KC G  +G
Sbjct  501  TLFMKYGLMMNVHPRELKPMLEKI----------CKCGGNYQG  533


 Score = 35.4 bits (80),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  426  GEDCLEFKPERWLS  439



>gb|AIU99467.1| P450 [Citrus maxima]
Length=541

 Score =   129 bits (324),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+   DQYKF++FNAGPRICLG+DLAYLQMKSIAA VLLR+ L++ PGH+VEQKMSL
Sbjct  441  DGNKYEGHDQYKFVAFNAGPRICLGKDLAYLQMKSIAAEVLLRYHLTVVPGHRVEQKMSL  500

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL + VHPR+L P++  +           KC G  +G
Sbjct  501  TLFMKYGLMMNVHPRELKPMLEKI----------CKCGGNYQG  533


 Score = 35.4 bits (80),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  426  GEDCLEFKPERWLS  439



>emb|CDY18885.1| BnaC04g04650D [Brassica napus]
Length=541

 Score =   131 bits (329),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 5/103 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D +KF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  437  DGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEG  444
            TLFMK GL V V  RDLT I + +++  +      + N VN+G
Sbjct  497  TLFMKYGLLVNVRNRDLTAIAADLREKTD-----CESNAVNDG  534


 Score = 33.5 bits (75),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DCLEFKPERW++
Sbjct  421  GDDCLEFKPERWIS  434



>ref|XP_008338834.1| PREDICTED: cytochrome P450 86A8 [Malus domestica]
Length=525

 Score =   129 bits (323),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG KFIM D  KF++FNAGPRICLG+DLAYLQMKS+ A+VLL HRL++ PGH+VEQKMS
Sbjct  434  PDG-KFIMHDSNKFVAFNAGPRICLGKDLAYLQMKSVTASVLLSHRLTVVPGHKVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDD  492
            LTLFMK GL V VH R+L  IVS+++ +
Sbjct  493  LTLFMKYGLMVNVHKRELGAIVSSIEKE  520


 Score = 35.8 bits (81),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DCLEF+PERWL+P
Sbjct  420  GDDCLEFRPERWLSP  434



>ref|XP_007040281.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
 gb|EOY24782.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
Length=541

 Score =   130 bits (326),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG K+  +D YKF++FNAGPRICLG+DLAYLQMKSIA AVLLRHRL++  GH+VEQKMSL
Sbjct  435  DGNKYEAKDSYKFLAFNAGPRICLGKDLAYLQMKSIATAVLLRHRLTIMAGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL V VHPR+L P++  +
Sbjct  495  TLFMKYGLLVDVHPRNLKPVLEKI  518


 Score = 34.3 bits (77),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+FKPERWL+
Sbjct  420  GEDCLDFKPERWLS  433



>ref|XP_010473620.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   124 bits (311),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++ GH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVASGHRVEQKMSLTLFMKYGL  500

Query  548  KVKVHPRDLTPIVSAMKDD  492
            K+ VH RDLT  V  M ++
Sbjct  501  KMDVHKRDLTSTVEKMVNE  519


 Score = 40.0 bits (92),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERWL   R++I N
Sbjct  420  GEDCLEFKPERWLDENREDICN  441



>ref|XP_010418406.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   124 bits (311),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++ GH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVASGHRVEQKMSLTLFMKYGL  500

Query  548  KVKVHPRDLTPIVSAMKDD  492
            K+ VH RDLT  V  M ++
Sbjct  501  KMDVHKRDLTSTVEKMVNE  519


 Score = 40.0 bits (92),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERWL   R++I N
Sbjct  420  GEDCLEFKPERWLDENREDICN  441



>ref|XP_010676469.1| PREDICTED: cytochrome P450 86A2-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   130 bits (326),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTK   QD +KF+SFNAGPRICLG+DLAYLQMKSIAAAVLLRHRL+++ GH+VEQKMSL
Sbjct  434  DGTKMEWQDPFKFVSFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLNVTRGHKVEQKMSL  493

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK+GL + V+PR+L+ I + +
Sbjct  494  TLFMKNGLVMDVNPRELSSIAAKI  517


 Score = 34.3 bits (77),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWL+
Sbjct  419  GEDCLEFRPERWLS  432



>ref|NP_176558.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 sp|Q9CAD6.1|C86A7_ARATH RecName: Full=Cytochrome P450 86A7 [Arabidopsis thaliana]
 gb|AAG52424.1|AC011622_12 putative cytochrome P450; 34849-36420 [Arabidopsis thaliana]
 gb|AEE34136.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=523

 Score =   124 bits (312),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++PGH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKMSLTLFMKFGL  500

Query  548  KVKVHPRDLT  519
            K+ VH RDLT
Sbjct  501  KMDVHKRDLT  510


 Score = 39.3 bits (90),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDE  742
            GEDCLEFKPERWL   RDE
Sbjct  420  GEDCLEFKPERWLEESRDE  438



>gb|AAM65207.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=523

 Score =   124 bits (312),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++PGH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKMSLTLFMKFGL  500

Query  548  KVKVHPRDLT  519
            K+ VH RDLT
Sbjct  501  KMDVHKRDLT  510


 Score = 39.3 bits (90),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDE  742
            GEDCLEFKPERWL   RDE
Sbjct  420  GEDCLEFKPERWLEESRDE  438



>gb|KJB52139.1| hypothetical protein B456_008G247600 [Gossypium raimondii]
Length=562

 Score =   128 bits (322),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG KF  +D Y+F++FNAGPRICLG+DLAYLQMKSIAAAVLL HRL+++ GH+VEQKMSL
Sbjct  435  DGKKFEPKDSYRFVTFNAGPRICLGKDLAYLQMKSIAAAVLLHHRLTVAAGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK GL + VHPR+L P+   M
Sbjct  495  TLFMKYGLCMDVHPRNLKPVPEKM  518


 Score = 35.4 bits (80),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERWL+
Sbjct  420  GEDCLEFKPERWLS  433



>ref|XP_004143898.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 ref|XP_004159940.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 gb|KGN50086.1| hypothetical protein Csa_5G153010 [Cucumis sativus]
Length=524

 Score =   128 bits (322),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++ YKF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSLTLFMK G
Sbjct  439  ENAYKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHRVEQKMSLTLFMKYG  498

Query  551  LKVKVHPRDLTPIVSAM  501
            LKV +HPRDL  +V  +
Sbjct  499  LKVHLHPRDLGRVVETI  515


 Score = 35.0 bits (79),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            GEDCLEFKPERWL
Sbjct  423  GEDCLEFKPERWL  435



>gb|KJB41354.1| hypothetical protein B456_007G100300 [Gossypium raimondii]
Length=528

 Score =   130 bits (328),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DG +FI  D YKF++FNAGPRICLG+ LAYLQMKS+AAA LLRH+L+L PGH+VEQKMSL
Sbjct  435  DGEEFIKHDSYKFVAFNAGPRICLGKGLAYLQMKSVAAAALLRHKLTLVPGHKVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDH  489
            TLFMK GLKV VH RDL  IV  +  + 
Sbjct  495  TLFMKYGLKVNVHGRDLGAIVEKITSEE  522


 Score = 32.7 bits (73),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            G+DCLEF+P+RWL+   +E 
Sbjct  420  GDDCLEFRPQRWLSADGEEF  439



>ref|XP_008437294.1| PREDICTED: cytochrome P450 86A7 [Cucumis melo]
Length=524

 Score =   128 bits (321),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++ YKF++FNAGPRICLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMSLTLFMK G
Sbjct  439  ENAYKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLTVVPGHRVEQKMSLTLFMKYG  498

Query  551  LKVKVHPRDLTPIVSAM  501
            LKV +HPRDL  +V  +
Sbjct  499  LKVHLHPRDLGHVVEKI  515


 Score = 35.0 bits (79),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            GEDCLEFKPERWL
Sbjct  423  GEDCLEFKPERWL  435



>ref|XP_008804444.1| PREDICTED: cytochrome P450 86A8-like [Phoenix dactylifera]
Length=552

 Score =   126 bits (316),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +    D +KF++FN GPR+CLG+DLAYLQMKSIAA+VLLRHRL++ PGH+VEQKMS
Sbjct  430  PDGKQIEAHDSFKFVAFNGGPRVCLGKDLAYLQMKSIAASVLLRHRLAVVPGHRVEQKMS  489

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGGTES  432
            LTLFMK GLK+ V+ RDL  +   +     R P   K   V  GGT +
Sbjct  490  LTLFMKHGLKMNVYDRDLNVVAEEL-----RPPEQPKV-AVESGGTAA  531


 Score = 37.0 bits (84),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDC+EF+PERWL+P   +I
Sbjct  416  GEDCMEFRPERWLSPDGKQI  435



>ref|XP_009400252.1| PREDICTED: cytochrome P450 86A2-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +F   D +KF++FNAGPR+CLG+DLAYLQMKSIAAAVLLRHRL ++PGH+VEQKMS
Sbjct  425  PDGKRFEPHDSFKFVAFNAGPRVCLGKDLAYLQMKSIAAAVLLRHRLRVAPGHRVEQKMS  484

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK  498
            LTLFMK+GL++ V  RDLT +   ++
Sbjct  485  LTLFMKNGLRMDVQDRDLTAMADELR  510



>ref|XP_010533650.1| PREDICTED: cytochrome P450 86A7 [Tarenaya hassleriana]
Length=523

 Score =   127 bits (318),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  737  IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMK  558
            I  +QYKF++FNAGPRICLG+DLAYLQMKSI AAVLLRHR++++ GH+VEQKMSLTLFMK
Sbjct  443  IRNNQYKFVAFNAGPRICLGKDLAYLQMKSIVAAVLLRHRITVAAGHKVEQKMSLTLFMK  502

Query  557  DGLKVKVHPRDLTPIVSAM  501
             GLKV VH RDLT ++  +
Sbjct  503  YGLKVNVHKRDLTSVLEKL  521


 Score = 35.8 bits (81),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 3/25 (12%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD---EIHN  733
            GEDCLEFKPERW+    D   EI N
Sbjct  421  GEDCLEFKPERWILSNSDIDTEIRN  445



>ref|XP_010907215.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis]
Length=540

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +F   D +KF++FN GPR+CLG+DLAYLQMKSIAAAVLLRHRL++ PGH+VEQKMS
Sbjct  430  PDGKRFEAHDSFKFVAFNGGPRVCLGKDLAYLQMKSIAAAVLLRHRLAVVPGHRVEQKMS  489

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGVNEGG  441
            LTLFMK GLK+ V+ RDL  +   ++ +  +   +V+ +G    G
Sbjct  490  LTLFMKYGLKMNVYDRDLDAVTEELRLEQRK--VAVESSGTAVAG  532



>ref|XP_010262795.1| PREDICTED: cytochrome P450 86A1 [Nelumbo nucifera]
Length=512

 Score =   127 bits (319),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++ YKFI+FNAGPR CLG+DLAYLQMKS+AAAVLLRHRLSL PGH+VEQKMSLTLFMK+G
Sbjct  441  KEGYKFIAFNAGPRTCLGKDLAYLQMKSVAAAVLLRHRLSLVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L+V VHPR+L
Sbjct  501  LRVYVHPRNL  510


 Score = 35.0 bits (79),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDC+EF+PERWL+   D   +
Sbjct  418  GEDCMEFRPERWLSAEGDRFES  439



>ref|XP_010556547.1| PREDICTED: cytochrome P450 86A2-like [Tarenaya hassleriana]
Length=530

 Score =   127 bits (319),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            +G KFI  DQY+F++FNAGPR CLG+D+AYLQMKSIAAA++LRHR++L P H+VEQKMSL
Sbjct  433  EGGKFINHDQYRFVAFNAGPRTCLGKDMAYLQMKSIAAALMLRHRVTLVPNHKVEQKMSL  492

Query  572  TLFMKDGLKVKVHPRDLTPIVSAM  501
            TLFMK+GL+V +H R+L  IV ++
Sbjct  493  TLFMKNGLRVHLHRRELGEIVRSV  516


 Score = 34.3 bits (77),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            GEDCLEFKPERW+
Sbjct  420  GEDCLEFKPERWM  432



>dbj|BAJ88802.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89180.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   128 bits (321),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTK    D Y+F++FNAGPRICLG+DLAYLQMK+IA ++LLRH L+++PGH+VEQKMSL
Sbjct  435  DGTKLEPHDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSILLRHHLAVAPGHRVEQKMSL  494

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMK  498
            TLFMK GL++ V PRDL P V  ++
Sbjct  495  TLFMKHGLRMVVRPRDLAPTVDELR  519


 Score = 33.5 bits (75),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERW++
Sbjct  420  GEDCLEFRPERWMS  433



>ref|XP_006300436.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
 gb|EOA33334.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
Length=546

 Score =   119 bits (297),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            +QYKF++FNAGPRICLG+DLAYLQMKSI A++LLRHRL+++ GH+VEQKMSLTLFMK GL
Sbjct  441  NQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVALGHRVEQKMSLTLFMKFGL  500

Query  548  KVKVHPRDLTPIVSAMKDDHNR  483
            K+ VH R LT  V  + ++ ++
Sbjct  501  KMDVHKRGLTLTVEKLVNEMSK  522


 Score = 42.4 bits (98),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDCLEFKPERWL   RD+I N
Sbjct  420  GEDCLEFKPERWLDKNRDDICN  441



>ref|XP_011032144.1| PREDICTED: cytochrome P450 86A1 [Populus euphratica]
Length=511

 Score =   120 bits (302),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L V +HPR L
Sbjct  501  LHVFLHPRTL  510


 Score = 39.7 bits (91),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDC+EFKPERWL+P  D+ 
Sbjct  418  GEDCMEFKPERWLSPEEDKF  437



>ref|XP_002314117.1| Cytochrome P450 86A1 family protein [Populus trichocarpa]
 gb|ABK95030.1| unknown [Populus trichocarpa]
 gb|EEE88072.1| Cytochrome P450 86A1 family protein [Populus trichocarpa]
Length=511

 Score =   120 bits (301),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L V +HPR L
Sbjct  501  LHVLLHPRTL  510


 Score = 39.7 bits (91),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDC+EFKPERWL+P  D+ 
Sbjct  418  GEDCMEFKPERWLSPEEDKF  437



>ref|XP_008804035.1| PREDICTED: cytochrome P450 86A8-like [Phoenix dactylifera]
Length=548

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +F   D +KF++FN GPR+CLG+DLAYLQMKSIAAAVLLRHRL+++PGH+VEQKMS
Sbjct  433  PDGKRFEAHDSFKFVAFNGGPRVCLGKDLAYLQMKSIAAAVLLRHRLAVAPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK  498
            LTLFMK GL++ V  RDL  I   ++
Sbjct  493  LTLFMKYGLRMNVFDRDLHAIAEELR  518



>gb|AFN53663.1| cytochrome P450 [Linum usitatissimum]
Length=516

 Score =   123 bits (309),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKMSLTLFMK+G
Sbjct  444  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLEPGHRVEQKMSLTLFMKNG  503

Query  551  LKVKVHPRDLT  519
            L+V + PRDL+
Sbjct  504  LRVMLQPRDLS  514


 Score = 36.6 bits (83),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEFKPERW+T
Sbjct  417  GEDCLEFKPERWIT  430



>gb|KJB19906.1| hypothetical protein B456_003G123900 [Gossypium raimondii]
Length=511

 Score =   122 bits (305),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P+G KF   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKM
Sbjct  432  PEGDKFNTPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKM  491

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK GL+V + PR L
Sbjct  492  SLTLFMKQGLRVYLQPRKL  510


 Score = 37.4 bits (85),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHN  733
            GEDC+EF+PERW++P  D+ + 
Sbjct  418  GEDCMEFRPERWISPEGDKFNT  439



>ref|XP_010043449.1| PREDICTED: cytochrome P450 86A1 [Eucalyptus grandis]
 gb|KCW85461.1| hypothetical protein EUGRSUZ_B02269 [Eucalyptus grandis]
Length=515

 Score =   126 bits (316),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL+PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLAPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L+V +HPRDL
Sbjct  501  LRVNLHPRDL  510


 Score = 32.7 bits (73),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EF+PERW++
Sbjct  418  GEDCMEFRPERWIS  431



>ref|XP_011082379.1| PREDICTED: cytochrome P450 86A1 [Sesamum indicum]
Length=520

 Score =   120 bits (300),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P G +F   +D YKF++FN GPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKM
Sbjct  432  PGGDRFEPPKDAYKFVAFNGGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKM  491

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GLKV + PR+L
Sbjct  492  SLTLFMKNGLKVYLKPREL  510


 Score = 38.9 bits (89),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERWL+P  D
Sbjct  418  GEDCLEFKPERWLSPGGD  435



>ref|XP_006306118.1| hypothetical protein CARUB_v10011562mg, partial [Capsella rubella]
 gb|EOA39016.1| hypothetical protein CARUB_v10011562mg, partial [Capsella rubella]
Length=340

 Score =   122 bits (305),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 12/97 (12%)
 Frame = -2

Query  743  KFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLF  564
            KFI  DQY+F++FNAGPRICLG+DLAYLQMK+IAAAVLLRHRL++ PGH+VEQKMSLTLF
Sbjct  240  KFISHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKMSLTLF  299

Query  563  MKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            MK+GL            +S +    +   ++ KCNGV
Sbjct  300  MKNGL------------LSLLMVKKSNGVSNGKCNGV  324


 Score = 37.0 bits (84),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDCLEFKPERW++   D+ 
Sbjct  222  GEDCLEFKPERWISSMDDKF  241



>gb|KFK37382.1| hypothetical protein AALP_AA4G249700 [Arabis alpina]
Length=532

 Score =   125 bits (314),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 5/100 (5%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            +G +FI  D +KF++FNAGPRICLG+DLAYLQMKSI+AAVLLRH L++  GH+VEQKMSL
Sbjct  436  NGGRFINHDPFKFVAFNAGPRICLGKDLAYLQMKSISAAVLLRHSLTVVTGHKVEQKMSL  495

Query  572  TLFMKDGLKVKVHPRDLTPIVSAMKDDHNRAPASVKCNGV  453
            TLFMK GL V VH RDLT + + +++  +      K NGV
Sbjct  496  TLFMKYGLLVNVHKRDLTAVAADVREKRDG-----KVNGV  530


 Score = 33.5 bits (75),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRR  748
            G+DCLEFKPERW+   R
Sbjct  423  GDDCLEFKPERWINGGR  439



>ref|XP_007142224.1| hypothetical protein PHAVU_008G262600g [Phaseolus vulgaris]
 gb|ESW14218.1| hypothetical protein PHAVU_008G262600g [Phaseolus vulgaris]
Length=519

 Score =   122 bits (305),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D +KF++FNAGPR CLG+DLAYLQMKS+A AVLLRHRLSL PGH+VEQKMSLTLFMK+G
Sbjct  443  KDGFKFVAFNAGPRTCLGKDLAYLQMKSVAFAVLLRHRLSLVPGHRVEQKMSLTLFMKNG  502

Query  551  LKVKVHPRDLTPIVSA  504
            LKV +HPR L  + ++
Sbjct  503  LKVFLHPRKLQGVATS  518


 Score = 36.6 bits (83),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DC+EFKPERWL+ R D
Sbjct  420  GKDCMEFKPERWLSVRED  437



>ref|XP_002525608.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36726.1| cytochrome P450, putative [Ricinus communis]
Length=511

 Score =   120 bits (302),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L+V +HPR L
Sbjct  501  LRVFLHPRIL  510


 Score = 37.0 bits (84),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            GEDC+EFKPERWL+P
Sbjct  418  GEDCVEFKPERWLSP  432



>ref|XP_010650931.1| PREDICTED: cytochrome P450 86A1 [Vitis vinifera]
 emb|CBI15990.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   121 bits (304),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDLTP  516
            L+V +HPR L P
Sbjct  501  LRVYLHPRGLEP  512


 Score = 35.8 bits (81),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERWL+   D
Sbjct  418  GEDCLEFKPERWLSTGGD  435



>ref|XP_003544876.2| PREDICTED: cytochrome P450 86A1-like [Glycine max]
Length=540

 Score =   121 bits (303),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D +KF++FNAGPR CLG+DLAYLQMKS+AAAVLLR+RLSL PGH+VEQKMSLTLFMK+G
Sbjct  461  KDGFKFVAFNAGPRTCLGKDLAYLQMKSVAAAVLLRYRLSLVPGHRVEQKMSLTLFMKNG  520

Query  551  LKVKVHPRDL  522
            L+V +HPR L
Sbjct  521  LRVFLHPRKL  530


 Score = 36.2 bits (82),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DC+EFKPERWL+ R D
Sbjct  438  GKDCMEFKPERWLSVRGD  455



>ref|XP_010918585.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis]
Length=548

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  755  PDGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            PDG +F   D +KF++FN GPR+CLG+DLAYLQMKSI AAVLLRHRL+++PGH+VEQKMS
Sbjct  433  PDGKRFEPHDSFKFVAFNGGPRVCLGKDLAYLQMKSITAAVLLRHRLAVAPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMK  498
            LTLFMK GL++ V  RDL  +   ++
Sbjct  493  LTLFMKYGLRMNVFDRDLNAVAEELR  518



>gb|KJB55751.1| hypothetical protein B456_009G092900 [Gossypium raimondii]
Length=511

 Score =   122 bits (306),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P+G KF   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH+VEQKM
Sbjct  432  PEGDKFDPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHKVEQKM  491

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GL+V + PR L
Sbjct  492  SLTLFMKNGLRVYLQPRTL  510


 Score = 35.0 bits (79),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GE C+EF+PERWL+P  D+ 
Sbjct  418  GEACMEFRPERWLSPEGDKF  437



>ref|XP_002299820.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
 gb|EEE84625.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
Length=511

 Score =   120 bits (301),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH +EQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHCIEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L+V +HPR+L
Sbjct  501  LRVFLHPRNL  510


 Score = 37.0 bits (84),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC EFKPERWL+P  D
Sbjct  418  GEDCQEFKPERWLSPEED  435



>ref|XP_006425039.1| hypothetical protein CICLE_v10030097mg [Citrus clementina]
 ref|XP_006488493.1| PREDICTED: cytochrome P450 86A1-like [Citrus sinensis]
 gb|ESR38279.1| hypothetical protein CICLE_v10030097mg [Citrus clementina]
 gb|KDO66831.1| hypothetical protein CISIN_1g010337mg [Citrus sinensis]
Length=513

 Score =   120 bits (300),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS A+AVLLR+RLSL PGH+VEQKMSLTLFMK G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSAASAVLLRYRLSLVPGHRVEQKMSLTLFMKHG  500

Query  551  LKVKVHPRDL  522
            L+V +HPR+L
Sbjct  501  LRVFLHPRNL  510


 Score = 37.0 bits (84),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERWL+   D
Sbjct  418  GEDCLEFKPERWLSAEGD  435



>gb|AFG62316.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62317.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62319.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62320.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62321.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62322.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62323.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62324.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62325.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62326.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62327.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
 gb|AFG62328.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
Length=110

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            QD YKF++FN GPRICLG+DLAYLQMKSI AA+LLRHR+SL PG+ VEQKMSLTLFMK G
Sbjct  38   QDSYKFVAFNGGPRICLGKDLAYLQMKSIVAAILLRHRISLVPGNPVEQKMSLTLFMKHG  97

Query  551  LKVKVHPRDL  522
            LKV + PR+L
Sbjct  98   LKVFLEPRNL  107



>ref|XP_009630929.1| PREDICTED: cytochrome P450 86A1 [Nicotiana tomentosiformis]
Length=521

 Score =   119 bits (297),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+AAA+LLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNGGPRTCLGKDLAYLQMKSVAAAILLRYRLLPVPGHKVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDLTP  516
            LKV ++PR+L P
Sbjct  501  LKVYLNPRELAP  512


 Score = 38.1 bits (87),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+  RD
Sbjct  418  GEDCMEFKPERWLSTGRD  435



>gb|ACL53124.1| unknown [Zea mays]
Length=521

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  418  DGTRFEPPKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  477

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKD  495
            LTLFMK+GL+V V PRDL   V+A +D
Sbjct  478  LTLFMKNGLRVHVKPRDLAGYVAAPED  504



>ref|XP_011035187.1| PREDICTED: cytochrome P450 86A1-like [Populus euphratica]
Length=511

 Score =   120 bits (300),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH +EQKMSLTLFMK+G
Sbjct  441  KDCYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHCIEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            L+V +HPR+L
Sbjct  501  LRVFLHPRNL  510


 Score = 36.6 bits (83),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC EFKPERWL+P  D
Sbjct  418  GEDCQEFKPERWLSPEED  435



>gb|AHD25487.1| cytochrome-P450 monooxygenase CYP86 [Zea nicaraguensis]
Length=548

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  445  DGTRFEPPKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  504

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKD  495
            LTLFMK+GL+V V PRDL   V+A +D
Sbjct  505  LTLFMKNGLRVHVKPRDLAGYVAAPED  531



>ref|NP_001141372.1| uncharacterized protein LOC100273463 [Zea mays]
 gb|ACF86194.1| unknown [Zea mays]
 gb|AFW84525.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=548

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  445  DGTRFEPPKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  504

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKD  495
            LTLFMK+GL+V V PRDL   V+A +D
Sbjct  505  LTLFMKNGLRVHVKPRDLAGYVAAPED  531



>gb|EPS59487.1| hypothetical protein M569_15318, partial [Genlisea aurea]
Length=502

 Score =   119 bits (297),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  749  GTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLT  570
            G +F+M DQ+KF++FNAGPRICLG++LAYLQMKSIAAAVLLRHRLSL PGH+VEQKMSLT
Sbjct  439  GDEFVMHDQFKFVAFNAGPRICLGKELAYLQMKSIAAAVLLRHRLSLVPGHKVEQKMSLT  498

Query  569  LFMK  558
            LFMK
Sbjct  499  LFMK  502


 Score = 37.4 bits (85),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDCLEF+PERWL+   DE 
Sbjct  423  GEDCLEFRPERWLSAGGDEF  442



>ref|XP_008457385.1| PREDICTED: cytochrome P450 86A1 [Cucumis melo]
Length=514

 Score =   119 bits (297),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKFI-MQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P G +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL+  PGH+VEQKM
Sbjct  435  PAGDRFEGPKDAYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLTPVPGHRVEQKM  494

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GL+V +HPR L
Sbjct  495  SLTLFMKNGLRVYLHPRQL  513


 Score = 37.0 bits (84),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC EFKPERWL+P  D
Sbjct  421  GEDCTEFKPERWLSPAGD  438



>emb|CBH32594.1| cytochrome P450, expressed [Triticum aestivum]
Length=546

 Score =   124 bits (310),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG++F  ++D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGHQVEQKMS
Sbjct  442  DGSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHQVEQKMS  501

Query  575  LTLFMKDGLKVKVHPRDLTPIV  510
            LTLFMK+GL+V V PRDL   V
Sbjct  502  LTLFMKNGLRVNVKPRDLAGYV  523


 Score = 32.0 bits (71),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC+EF+PERWL+
Sbjct  427  GKDCVEFRPERWLS  440



>gb|ACG34921.1| cytochrome P450 CYP86A34 [Zea mays]
Length=548

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  445  DGTRFEPPKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  504

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKD  495
            LTLFMK GL+V V PRDL   V+A +D
Sbjct  505  LTLFMKSGLRVHVKPRDLAGYVAAPED  531



>ref|XP_010033023.1| PREDICTED: cytochrome P450 86A1-like [Eucalyptus grandis]
 gb|KCW52554.1| hypothetical protein EUGRSUZ_J01934 [Eucalyptus grandis]
Length=521

 Score =   116 bits (291),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P+G +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+ LS  PGH+VEQKM
Sbjct  432  PEGDRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYALSPVPGHRVEQKM  491

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLT+FMKDGL+V + PR L
Sbjct  492  SLTMFMKDGLRVYLRPRAL  510


 Score = 38.9 bits (89),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+P  D
Sbjct  418  GEDCMEFKPERWLSPEGD  435



>ref|XP_004164591.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
Length=513

 Score =   119 bits (299),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKFI-MQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P G +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKM
Sbjct  434  PTGDRFEGPKDAYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKM  493

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GL+V +HPR L
Sbjct  494  SLTLFMKNGLRVYLHPRRL  512


 Score = 35.8 bits (81),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC EFKP+RWL+P  D
Sbjct  420  GEDCTEFKPDRWLSPTGD  437



>ref|XP_004150627.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
 gb|KGN65795.1| hypothetical protein Csa_1G528600 [Cucumis sativus]
Length=513

 Score =   119 bits (298),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKFI-MQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            P G +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKM
Sbjct  434  PTGDRFEGPKDAYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKM  493

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GL+V +HPR L
Sbjct  494  SLTLFMKNGLRVYLHPRRL  512


 Score = 35.8 bits (81),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC EFKP+RWL+P  D
Sbjct  420  GEDCTEFKPDRWLSPTGD  437



>ref|XP_006645037.1| PREDICTED: cytochrome P450 86A1-like [Oryza brachyantha]
Length=545

 Score =   121 bits (303),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = -2

Query  755  PDGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKM  579
            PDG++F  ++D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLR+ + L PGH+VEQKM
Sbjct  441  PDGSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRNTVELVPGHKVEQKM  500

Query  578  SLTLFMKDGLKVKVHPRDL  522
            SLTLFMK+GL+V V PRDL
Sbjct  501  SLTLFMKNGLRVHVKPRDL  519


 Score = 33.1 bits (74),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTP  754
            G+DC EF+PERWL+P
Sbjct  427  GKDCAEFRPERWLSP  441



>ref|NP_001130939.1| uncharacterized protein LOC100192044 [Zea mays]
 gb|ACF79330.1| unknown [Zea mays]
 gb|ACN28337.1| unknown [Zea mays]
Length=519

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  416  DGTRFEPAKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  475

Query  575  LTLFMKDGLKVKVHPRDLTPIVSA  504
            LTLFMK+GL+V V PRDL   V A
Sbjct  476  LTLFMKNGLRVHVKPRDLAGYVVA  499



>gb|ACG33785.1| cytochrome P450 CYP86A36 [Zea mays]
Length=547

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  444  DGTRFEPAKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  503

Query  575  LTLFMKDGLKVKVHPRDLTPIVSA  504
            LTLFMK+GL+V V PRDL   V A
Sbjct  504  LTLFMKNGLRVHVKPRDLAGYVVA  527



>gb|ACN27732.1| unknown [Zea mays]
 tpg|DAA56780.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=547

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  444  DGTRFEPAKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  503

Query  575  LTLFMKDGLKVKVHPRDLTPIVSA  504
            LTLFMK+GL+V V PRDL   V A
Sbjct  504  LTLFMKNGLRVHVKPRDLAGYVVA  527



>ref|XP_004970620.1| PREDICTED: cytochrome P450 86A1-like [Setaria italica]
Length=547

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  444  DGTRFEPAKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSMELVPGHKVEQKMS  503

Query  575  LTLFMKDGLKVKVHPRDLTPIVS  507
            LTLFMK+GL+V V PRDL   V+
Sbjct  504  LTLFMKNGLRVHVKPRDLAGYVA  526



>ref|XP_004241175.1| PREDICTED: cytochrome P450 86A1 [Solanum lycopersicum]
Length=521

 Score =   118 bits (296),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+AAA+LLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNGGPRTCLGKDLAYLQMKSVAAAILLRYRLLPVPGHKVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDLTPIV  510
            LKV ++PR L P V
Sbjct  501  LKVYLNPRQLEPAV  514


 Score = 35.4 bits (80),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+   D
Sbjct  418  GEDCMEFKPERWLSTGGD  435



>gb|KDP46522.1| hypothetical protein JCGZ_08494 [Jatropha curcas]
Length=511

 Score =   120 bits (300),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            +G KF   +D YKF+SFNAGPR CLG+DLAYLQMKS+A+A+LLR+RLSL PGH+V+QKMS
Sbjct  433  EGNKFEPPKDGYKFVSFNAGPRTCLGKDLAYLQMKSVASAILLRYRLSLVPGHRVQQKMS  492

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK+GL+V +HPR L
Sbjct  493  LTLFMKNGLRVFLHPRML  510


 Score = 33.5 bits (75),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF PERWL+
Sbjct  418  GEDCLEFNPERWLS  431



>ref|XP_009763725.1| PREDICTED: cytochrome P450 86A1 [Nicotiana sylvestris]
Length=521

 Score =   118 bits (295),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+AAA+LLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNGGPRTCLGKDLAYLQMKSVAAAILLRYRLLPVPGHKVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDLTP  516
            LKV ++PR+L P
Sbjct  501  LKVFLNPRELAP  512


 Score = 35.4 bits (80),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+   D
Sbjct  418  GEDCMEFKPERWLSTGGD  435



>ref|XP_006391721.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
 gb|ESQ29007.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
Length=525

 Score =   122 bits (305),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++QYKF++FNAGPRICLG+DLAYLQMKSI A+VLLR+RL+++ GH+VEQKMSLTLFMK G
Sbjct  439  RNQYKFVAFNAGPRICLGKDLAYLQMKSITASVLLRYRLTVAQGHRVEQKMSLTLFMKFG  498

Query  551  LKVKVHPRDLTPIVSAMKDDHNR  483
            LK+ VH RDLT +V  + ++ ++
Sbjct  499  LKMDVHKRDLTLMVEKLVNEMSK  521


 Score = 31.2 bits (69),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            GEDC EFKPERW 
Sbjct  420  GEDCQEFKPERWF  432



>gb|KJB08946.1| hypothetical protein B456_001G115100 [Gossypium raimondii]
Length=514

 Score =   116 bits (291),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            +G KF   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+R+SL PGH+VEQKMS
Sbjct  436  EGDKFEAPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRVSLVPGHRVEQKMS  495

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK GL+V + PR L
Sbjct  496  LTLFMKKGLRVYLQPRLL  513


 Score = 36.6 bits (83),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            GEDC+EFKPERWL+   D+ 
Sbjct  421  GEDCMEFKPERWLSAEGDKF  440



>ref|XP_007016155.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
 gb|EOY33774.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
Length=511

 Score =   119 bits (298),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            +G KF   +D YKF++FNAGPR CLG+DLAYLQMKS A+AVLLR+RLSL PGH+VEQKMS
Sbjct  433  EGNKFDPPKDAYKFVAFNAGPRTCLGKDLAYLQMKSAASAVLLRYRLSLVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMKDGL+V + PR L
Sbjct  493  LTLFMKDGLRVYLQPRIL  510


 Score = 33.5 bits (75),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EF+PERWL+
Sbjct  418  GEDCMEFRPERWLS  431



>gb|AFG62318.1| hypothetical protein 2_2530_01, partial [Pinus taeda]
Length=110

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            QD YKF++FN GPRICLG+DLAYLQMKSI AA+LLRHR+SL PG+ VEQKMSLTLFMK G
Sbjct  38   QDSYKFVAFNGGPRICLGKDLAYLQMKSIVAAILLRHRISLVPGNPVEQKMSLTLFMKHG  97

Query  551  LKVKVHPRDL  522
            LKV +  R+L
Sbjct  98   LKVFLETRNL  107



>ref|XP_010104672.1| Cytochrome P450 86A1 [Morus notabilis]
 gb|EXC01478.1| Cytochrome P450 86A1 [Morus notabilis]
Length=520

 Score =   117 bits (293),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSLTLFMK+G
Sbjct  442  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNG  501

Query  551  LKVKVHPRDL  522
            L+V + PR+L
Sbjct  502  LRVYLQPREL  511


 Score = 35.4 bits (80),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKP+RWL+ + D
Sbjct  419  GEDCMEFKPDRWLSEKGD  436



>ref|XP_002456654.1| hypothetical protein SORBIDRAFT_03g040250 [Sorghum bicolor]
 gb|EES01774.1| hypothetical protein SORBIDRAFT_03g040250 [Sorghum bicolor]
Length=547

 Score =   122 bits (305),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DGT+F   +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+VEQKMS
Sbjct  444  DGTRFEPAKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVEQKMS  503

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK+GL+V V PRDL
Sbjct  504  LTLFMKNGLRVHVKPRDL  521


 Score = 30.4 bits (67),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC EF+PERWL+
Sbjct  429  GKDCAEFRPERWLS  442



>ref|XP_010923101.1| PREDICTED: cytochrome P450 86A1-like [Elaeis guineensis]
Length=556

 Score =   119 bits (297),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 9/89 (10%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F + +D Y+F++FN GPR CLG+DLAYLQM+SIA+A+LLRHRL L PGH+V+QKMS
Sbjct  453  DGGRFELAKDTYRFVAFNGGPRTCLGKDLAYLQMRSIASAILLRHRLELVPGHRVQQKMS  512

Query  575  LTLFMKDGLKVKVHPRDLTPIVSAMKDDH  489
            LTLFMK+GL+V VH R L        DDH
Sbjct  513  LTLFMKNGLQVYVHQRKL--------DDH  533


 Score = 33.5 bits (75),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC+EF+PERWLT
Sbjct  438  GKDCMEFRPERWLT  451



>ref|XP_004500237.1| PREDICTED: cytochrome P450 86A1-like [Cicer arietinum]
Length=529

 Score =   115 bits (287),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+AAAVL+R+R+S  PGH+V+QKMSLTLFMK G
Sbjct  456  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVAAAVLIRYRISPVPGHRVQQKMSLTLFMKYG  515

Query  551  LKVKVHPRDL  522
            L+V +HPR L
Sbjct  516  LRVFLHPRQL  525


 Score = 36.2 bits (82),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+ + D
Sbjct  433  GEDCMEFKPERWLSVQGD  450



>ref|XP_010685596.1| PREDICTED: cytochrome P450 86A1 [Beta vulgaris subsp. vulgaris]
Length=529

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  452  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLLAVPGHRVEQKMSLTLFMKNG  511

Query  551  LKVKVHPRDLTPIVSA  504
            LKV V PR+L   V+A
Sbjct  512  LKVFVEPRELNGGVAA  527


 Score = 33.1 bits (74),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            GEDC+EF+PERWL
Sbjct  419  GEDCMEFRPERWL  431



>gb|ABZ80831.1| CYP86A32 fatty acid omega-hydroxylase [Quercus suber]
Length=520

 Score =   115 bits (289),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMSLTLFMKDG
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLLPVPGHRVEQKMSLTLFMKDG  500

Query  551  LKVKVHPRDL  522
            L+V + PR L
Sbjct  501  LRVYLQPRQL  510


 Score = 35.0 bits (79),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL    D
Sbjct  418  GEDCMEFKPERWLADEGD  435



>gb|EYU45975.1| hypothetical protein MIMGU_mgv1a025576mg [Erythranthe guttata]
Length=521

 Score =   116 bits (290),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  749  GTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            G +F + +D Y+F++FN GPR CLG+DLAYLQMKS+AAAVLLR+R+ L PGH VEQKMSL
Sbjct  433  GERFELPKDGYRFVAFNGGPRTCLGKDLAYLQMKSVAAAVLLRYRVVLVPGHPVEQKMSL  492

Query  572  TLFMKDGLKVKVHPRDL  522
            TLFMK+GLKV + PR+L
Sbjct  493  TLFMKNGLKVYLKPREL  509


 Score = 35.0 bits (79),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERWL+
Sbjct  417  GEDCMEFKPERWLS  430



>ref|NP_001275219.1| CYP86A33 fatty acid omega-hydroxylase [Solanum tuberosum]
 gb|ABZ80830.1| CYP86A33 fatty acid omega-hydroxylase [Solanum tuberosum]
Length=521

 Score =   115 bits (289),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+AAA+LLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNGGPRTCLGKDLAYLQMKSVAAAILLRYRLLPVPGHKVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            LKV ++PR+L
Sbjct  501  LKVYLNPREL  510


 Score = 35.4 bits (80),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+   D
Sbjct  418  GEDCMEFKPERWLSTGGD  435



>emb|CDO99497.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   115 bits (287),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+A+AVLLR+RLSL PGH VEQKMSLTLFMK G
Sbjct  440  KDVYKFVAFNGGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHGVEQKMSLTLFMKHG  499

Query  551  LKVKVHPRDL  522
            LKV + PR L
Sbjct  500  LKVYLSPRLL  509


 Score = 35.8 bits (81),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPERWL+   D
Sbjct  417  GEDCMEFKPERWLSTAGD  434



>ref|XP_006280320.1| hypothetical protein CARUB_v10026242mg [Capsella rubella]
 gb|EOA13218.1| hypothetical protein CARUB_v10026242mg [Capsella rubella]
Length=513

 Score =   115 bits (287),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>ref|XP_003564640.2| PREDICTED: cytochrome P450 86A1 [Brachypodium distachyon]
Length=545

 Score =   120 bits (301),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG++F  ++D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGH+V+QK+S
Sbjct  441  DGSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHKVQQKIS  500

Query  575  LTLFMKDGLKVKVHPRDLTPIVS  507
            LTLFMK+GL+V V PRDL   V+
Sbjct  501  LTLFMKNGLRVNVKPRDLASYVA  523


 Score = 30.4 bits (67),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC EF+PERWL+
Sbjct  426  GKDCAEFRPERWLS  439



>ref|XP_008355259.1| PREDICTED: cytochrome P450 86A1 [Malus domestica]
Length=524

 Score =   117 bits (293),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PG + +QKMSLTLFMKDG
Sbjct  440  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKDG  499

Query  551  LKVKVHPRDL  522
            L+V +HPR L
Sbjct  500  LQVYLHPRKL  509


 Score = 33.1 bits (74),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKP+RW++
Sbjct  418  GEDCMEFKPDRWIS  431



>gb|EMT13769.1| Cytochrome P450 86A1 [Aegilops tauschii]
Length=397

 Score =   119 bits (297),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  734  MQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKD  555
            ++D Y+F +FN GPR CLG+DLAYLQMKSIA+AVLLRH + L PGHQVEQKMSLTLFMK+
Sbjct  300  VKDAYRFGAFNGGPRTCLGKDLAYLQMKSIASAVLLRHSVELVPGHQVEQKMSLTLFMKN  359

Query  554  GLKVKVHPRDLTPIV  510
            GL+V V PRDL   V
Sbjct  360  GLRVNVKPRDLADYV  374


 Score = 32.0 bits (71),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC+EF+PERWL+
Sbjct  269  GKDCVEFRPERWLS  282



>ref|XP_010926207.1| PREDICTED: cytochrome P450 86A1-like [Elaeis guineensis]
Length=554

 Score =   117 bits (292),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 8/81 (10%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLRHRL L PGH+V+QKMSLTLFMK+G
Sbjct  461  KDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRHRLELVPGHRVQQKMSLTLFMKNG  520

Query  551  LKVKVHPRDLTPIVSAMKDDH  489
            L+V V PR L        DDH
Sbjct  521  LQVYVRPRKL--------DDH  533


 Score = 33.5 bits (75),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC+EF+PERWLT
Sbjct  438  GKDCMEFRPERWLT  451



>gb|KFK27415.1| hypothetical protein AALP_AA8G379800 [Arabis alpina]
Length=513

 Score =   113 bits (283),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  441  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLFPVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPR  528
            L+V + PR
Sbjct  501  LRVYLQPR  508


 Score = 37.0 bits (84),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEF+PERWLT   D
Sbjct  418  GEDCLEFRPERWLTANGD  435



>ref|XP_002862636.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38894.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   114 bits (284),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+R+   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRVFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>ref|XP_006401031.1| hypothetical protein EUTSA_v10013214mg [Eutrema salsugineum]
 gb|ESQ42484.1| hypothetical protein EUTSA_v10013214mg [Eutrema salsugineum]
Length=533

 Score =   113 bits (283),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMSLTLFMK+G
Sbjct  461  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLFPVPGHRVEQKMSLTLFMKNG  520

Query  551  LKVKVHPR  528
            L+V + PR
Sbjct  521  LRVYLQPR  528


 Score = 36.2 bits (82),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEI  739
            G++CLEF+PERWLT + D+ 
Sbjct  438  GQNCLEFRPERWLTAKGDQF  457



>emb|CDY61020.1| BnaAnng17300D [Brassica napus]
Length=492

 Score =   113 bits (282),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
             D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSL+LFMK+G
Sbjct  419  NDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLSLFMKNG  478

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  479  LHVYLQPR  486


 Score = 36.2 bits (82),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCLEF+PERWLT   D
Sbjct  396  GQDCLEFRPERWLTAEGD  413



>emb|CDY71605.1| BnaAnng38120D [Brassica napus]
Length=101

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D +KF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSLTLFMK+G
Sbjct  29   KDSFKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNG  88

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  89   LHVYLQPR  96



>ref|XP_009126726.1| PREDICTED: cytochrome P450 86A1 [Brassica rapa]
Length=513

 Score =   113 bits (283),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D +KF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSLTLFMK+G
Sbjct  441  KDSFKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNG  500

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  501  LHVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCLEF+PERWLT   D
Sbjct  418  GQDCLEFRPERWLTAEGD  435



>ref|XP_009132026.1| PREDICTED: cytochrome P450 86A1-like [Brassica rapa]
Length=514

 Score =   113 bits (282),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
             D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMSL+LFMK+G
Sbjct  441  NDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLSLFMKNG  500

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  501  LHVYLQPR  508


 Score = 36.2 bits (82),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCLEF+PERWLT   D
Sbjct  418  GQDCLEFRPERWLTAEGD  435



>ref|NP_001044838.1| Os01g0854800 [Oryza sativa Japonica Group]
 dbj|BAD82458.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF06752.1| Os01g0854800 [Oryza sativa Japonica Group]
 gb|EAY76534.1| hypothetical protein OsI_04477 [Oryza sativa Indica Group]
 gb|EAZ14187.1| hypothetical protein OsJ_04113 [Oryza sativa Japonica Group]
 dbj|BAG98848.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   119 bits (297),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG++F  ++D Y+F++FN GPR CLG+DLAYLQMKSIA+AVLLR+ + L PGH+VEQKMS
Sbjct  442  DGSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRNSVELVPGHKVEQKMS  501

Query  575  LTLFMKDGLKVKVHPRDLTPIV  510
            LTLFMK+GL+V V PRD+   V
Sbjct  502  LTLFMKNGLRVHVKPRDIASYV  523


 Score = 30.4 bits (67),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC EF+PERWL+
Sbjct  427  GKDCAEFRPERWLS  440



>ref|XP_006827573.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
 gb|ERM94989.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
Length=510

 Score =   115 bits (288),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  728  DQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDGL  549
            D Y F+SFNAGPRICLG+DLAYLQMK +AA+VLLRH L+++PGH V+QKMSLTLFM+ GL
Sbjct  432  DPYAFVSFNAGPRICLGKDLAYLQMKVVAASVLLRHSLTVAPGHVVQQKMSLTLFMEQGL  491

Query  548  KVKVHPRDL  522
            KV VHPR L
Sbjct  492  KVHVHPRVL  500


 Score = 33.5 bits (75),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRR  748
            G D LEFKPERWLTP +
Sbjct  408  GADFLEFKPERWLTPDK  424



>ref|XP_004294257.2| PREDICTED: cytochrome P450 86A1 [Fragaria vesca subsp. vesca]
Length=553

 Score =   114 bits (284),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V QKMSLTLFMK G
Sbjct  474  KDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYG  533

Query  551  LKVKVHPRDL  522
            LKV + PR L
Sbjct  534  LKVYLQPRKL  543


 Score = 34.7 bits (78),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRR  748
            GEDC+EFKP+RWL+  R
Sbjct  451  GEDCMEFKPDRWLSSDR  467



>ref|XP_008220520.1| PREDICTED: cytochrome P450 86A1 [Prunus mume]
Length=522

 Score =   114 bits (285),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PG + +QKMS
Sbjct  433  DGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMS  492

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK+GL+V +HPR L
Sbjct  493  LTLFMKNGLQVYLHPRQL  510


 Score = 34.3 bits (77),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  418  GEDCMEFKPERWIS  431



>ref|XP_010483494.1| PREDICTED: cytochrome P450 86A1-like [Camelina sativa]
Length=513

 Score =   112 bits (280),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D +KF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+R+   PGH+VEQKMS
Sbjct  433  DGERFETPKDGFKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRVFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>ref|XP_007208647.1| hypothetical protein PRUPE_ppa020227mg, partial [Prunus persica]
 gb|EMJ09846.1| hypothetical protein PRUPE_ppa020227mg, partial [Prunus persica]
Length=525

 Score =   114 bits (284),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PG + +QKMS
Sbjct  436  DGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMS  495

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK+GL+V +HPR L
Sbjct  496  LTLFMKNGLQVYLHPRQL  513


 Score = 34.3 bits (77),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  421  GEDCMEFKPERWIS  434



>ref|XP_007146731.1| hypothetical protein PHAVU_006G065000g [Phaseolus vulgaris]
 gb|ESW18725.1| hypothetical protein PHAVU_006G065000g [Phaseolus vulgaris]
Length=522

 Score =   115 bits (287),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FN GPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V+QKMSLTLFM++G
Sbjct  445  KDSYKFVAFNGGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVQQKMSLTLFMQNG  504

Query  551  LKVKVHPRDLTP  516
            L+V + PR L P
Sbjct  505  LRVFLQPRQLQP  516


 Score = 33.1 bits (74),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPER+L+ + D
Sbjct  422  GEDCMEFKPERFLSVKGD  439



>ref|XP_010454344.1| PREDICTED: cytochrome P450 86A1 [Camelina sativa]
Length=513

 Score =   112 bits (279),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAY QMKS+A+AVLLR+RL   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRLFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>emb|CDY02845.1| BnaC02g10440D [Brassica napus]
Length=101

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            +G +F   ++ +KF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+VEQKMS
Sbjct  21   EGDRFETPKESFKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMS  80

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL V + PR
Sbjct  81   LTLFMKNGLHVYLQPR  96



>ref|XP_003615606.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98564.1| cytochrome P450 family-dependent fatty acid hydroxylase [Medicago 
truncatula]
Length=510

 Score =   108 bits (271),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++ + F++FNAGPR CLG+DLAYLQMKS+AAAVLLR+RL   PGH VEQKMSLTLFMK+G
Sbjct  441  KEGFMFVAFNAGPRTCLGKDLAYLQMKSVAAAVLLRYRLLPVPGHVVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            LKV + PR L
Sbjct  501  LKVFLQPRKL  510


 Score = 38.5 bits (88),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERWL+ R D
Sbjct  418  GEDCLEFKPERWLSVRGD  435



>ref|XP_009374269.1| PREDICTED: cytochrome P450 86A1 [Pyrus x bretschneideri]
Length=524

 Score =   114 bits (284),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLSL PG + +QKMSLTLFMK+G
Sbjct  440  KDGYKFMAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKNG  499

Query  551  LKVKVHPR  528
            L+V +HPR
Sbjct  500  LQVYLHPR  507


 Score = 33.1 bits (74),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKP+RW++
Sbjct  418  GEDCMEFKPDRWIS  431



>gb|AAL91155.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO29963.1| cytochrome P450 [Arabidopsis thaliana]
Length=513

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAY QMKS+A+AVLLR+R+   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>emb|CAA62082.1| cytochrome p450 [Arabidopsis thaliana]
Length=513

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAY QMKS+A+AVLLR+R+   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>ref|NP_200694.1| cytochrome P450 86A1 [Arabidopsis thaliana]
 sp|P48422.2|C86A1_ARATH RecName: Full=Cytochrome P450 86A1; AltName: Full=CYPLXXXVI; 
AltName: Full=P450-dependent fatty acid omega-hydroxylase; AltName: 
Full=Protein HYDROXYLASE OF ROOT SUBERIZED TISSUE [Arabidopsis 
thaliana]
 dbj|BAB09631.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AED97111.1| cytochrome P450 86A1 [Arabidopsis thaliana]
Length=513

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAY QMKS+A+AVLLR+R+   PGH+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>emb|CDX71150.1| BnaC03g12340D [Brassica napus]
Length=491

 Score =   110 bits (275),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
             D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RL   PGH+VEQKMSL+LFMK+G
Sbjct  418  NDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLFPVPGHRVEQKMSLSLFMKNG  477

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  478  LHVYLQPR  485


 Score = 36.2 bits (82),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCLEF+PERWLT   D
Sbjct  395  GQDCLEFRPERWLTAEGD  412



>ref|XP_010443636.1| PREDICTED: cytochrome P450 86A1 [Camelina sativa]
Length=513

 Score =   110 bits (275),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+R+   P H+VEQKMS
Sbjct  433  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRVFPVPCHRVEQKMS  492

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  493  LTLFMKNGLRVYLQPR  508


 Score = 35.8 bits (81),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCLEF+PERWLT
Sbjct  418  GEDCLEFRPERWLT  431



>ref|XP_002883546.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59805.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   111 bits (277),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+R+   PG++VEQKMS
Sbjct  432  DGERFETPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRVFPVPGNRVEQKMS  491

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  492  LTLFMKNGLRVYLQPR  507


 Score = 34.7 bits (78),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDCL+F+PERWLT
Sbjct  417  GEDCLDFRPERWLT  430



>ref|XP_003538284.1| PREDICTED: cytochrome P450 86A1-like isoform 1 [Glycine max]
Length=521

 Score =   112 bits (281),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -2

Query  749  GTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            G +F + +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V+QKMSL
Sbjct  437  GDRFELPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVQQKMSL  496

Query  572  TLFMKDGLKVKVHPRDLTP  516
            TLFMK GL+V +  R L P
Sbjct  497  TLFMKHGLRVFLQTRQLQP  515


 Score = 32.7 bits (73),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPER+L+ + D
Sbjct  421  GEDCMEFKPERFLSVQGD  438



>ref|XP_008785405.1| PREDICTED: cytochrome P450 86A1 [Phoenix dactylifera]
Length=553

 Score =   112 bits (279),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D Y+F++FN GPR CLG+DLAYLQM+SIA+A+LLRHRL L PGH+V+QKMSLTLFM++G
Sbjct  461  KDAYRFVAFNGGPRTCLGKDLAYLQMRSIASAILLRHRLELVPGHRVQQKMSLTLFMQNG  520

Query  551  LKVKVHPRDL  522
            L+V V  R+L
Sbjct  521  LQVYVRQREL  530


 Score = 33.5 bits (75),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            G+DC+EF+PERWLT
Sbjct  438  GKDCMEFRPERWLT  451



>gb|KHN47607.1| Cytochrome P450 86A1 [Glycine soja]
Length=518

 Score =   112 bits (281),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -2

Query  749  GTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            G +F + +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V+QKMSL
Sbjct  434  GDRFELPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVQQKMSL  493

Query  572  TLFMKDGLKVKVHPRDLTP  516
            TLFMK GL+V +  R L P
Sbjct  494  TLFMKHGLRVFLQTRQLQP  512


 Score = 32.7 bits (73),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDC+EFKPER+L+ + D
Sbjct  418  GEDCMEFKPERFLSVQGD  435



>emb|CDY70784.1| BnaCnng69760D [Brassica napus]
Length=101

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            ++ +KF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V QKMSLTLFMK+G
Sbjct  29   KESFKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKNG  88

Query  551  LKVKVHPR  528
            L V + PR
Sbjct  89   LHVYLQPR  96



>ref|XP_008358971.1| PREDICTED: cytochrome P450 86A1-like [Malus domestica]
Length=522

 Score =   109 bits (273),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FN GPR CLG+DLAYLQMKS+ +AVLLR+RLS  PG + +QKMS
Sbjct  433  DGNRFEPPKDGYKFVAFNGGPRTCLGKDLAYLQMKSVVSAVLLRYRLSPVPGFRAQQKMS  492

Query  575  LTLFMKDGLKVKVHPRDL  522
            LTLFMK GL+V +HPR L
Sbjct  493  LTLFMKKGLQVHLHPRKL  510


 Score = 34.3 bits (77),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKPERW++
Sbjct  418  GEDCMEFKPERWIS  431



>ref|XP_003637119.1| Cytochrome P450 86A1, partial [Medicago truncatula]
Length=153

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+AAAVL+R+RL   PGH+V+QKMSLTLFMK G
Sbjct  78   KDGYKFVAFNAGPRTCLGKDLAYLQMKSVAAAVLIRYRLLPVPGHKVQQKMSLTLFMKYG  137

Query  551  LKVKVHPRDL  522
            L+V + PR L
Sbjct  138  LRVFLCPRQL  147



>ref|XP_010541445.1| PREDICTED: cytochrome P450 86A1-like [Tarenaya hassleriana]
Length=514

 Score =   111 bits (278),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+A+AVLLR+RLS  PGH+V+QKMSLTLFM++G
Sbjct  440  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVQQKMSLTLFMQNG  499

Query  551  LKVKVHPR  528
            L+V + PR
Sbjct  500  LRVLMQPR  507


 Score = 32.0 bits (71),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCL+F+P+RWL+   D
Sbjct  417  GDDCLQFRPDRWLSAEGD  434



>ref|XP_010520223.1| PREDICTED: cytochrome P450 86A1 [Tarenaya hassleriana]
Length=514

 Score =   111 bits (277),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  752  DGTKF-IMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMS  576
            DG +F   +D YKF++FNAGPR CLG+DLAYLQMKS+A+A+LLR+RL   PGH+V+QKMS
Sbjct  432  DGDRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAILLRYRLCPVPGHRVQQKMS  491

Query  575  LTLFMKDGLKVKVHPR  528
            LTLFMK+GL+V + PR
Sbjct  492  LTLFMKNGLRVFLRPR  507


 Score = 32.3 bits (72),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            G+DCLEF+P+RWL+   D
Sbjct  417  GKDCLEFRPDRWLSADGD  434



>gb|KEH34209.1| cytochrome P450 family-dependent fatty acid hydroxylase [Medicago 
truncatula]
Length=510

 Score =   109 bits (272),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D YKF++FNAGPR CLG+DLAYLQMKS+AAAVL+R+RL   PGH+V+QKMSLTLFMK G
Sbjct  435  KDGYKFVAFNAGPRTCLGKDLAYLQMKSVAAAVLIRYRLLPVPGHKVQQKMSLTLFMKYG  494

Query  551  LKVKVHPRDL  522
            L+V + PR L
Sbjct  495  LRVFLCPRQL  504


 Score = 33.5 bits (75),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLT  757
            GEDC+EFKP+RWL+
Sbjct  410  GEDCMEFKPDRWLS  423



>gb|AAZ95163.1| putative cytochrome P450 [Brassica rapa]
Length=94

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            D  +FI  D +KF++FNAGPRI LG+DLAYLQMKSIAAAVLLRHRL++  GH+VEQKMSL
Sbjct  30   DSGRFINHDPFKFVAFNAGPRIYLGKDLAYLQMKSIAAAVLLRHRLTVVTGHKVEQKMSL  89

Query  572  TLFMK  558
            TLFMK
Sbjct  90   TLFMK  94



>ref|XP_009407544.1| PREDICTED: cytochrome P450 86A1 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   109 bits (272),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D Y+F++FN GPR CLG+DLA LQMKSIA+AVLLR+RL L PGH+V+QKMSLTLFMK+G
Sbjct  461  KDPYQFVAFNGGPRTCLGKDLADLQMKSIASAVLLRYRLELVPGHRVQQKMSLTLFMKNG  520

Query  551  LKVKVHPR  528
            L+V V PR
Sbjct  521  LRVYVRPR  528


 Score = 30.8 bits (68),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRDEIHNA  730
            G+DC EF+PERWL+   D    A
Sbjct  438  GKDCREFRPERWLSAEGDRFEPA  460



>ref|XP_004490585.1| PREDICTED: cytochrome P450 86A1-like [Cicer arietinum]
Length=510

 Score =   100 bits (250),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
            +D + F++FNAGPR CLG+DLAYLQMKS+AAAVLLR+RL L PGHQVEQKMSLTLFMK+G
Sbjct  441  KDGFMFVAFNAGPRTCLGKDLAYLQMKSVAAAVLLRYRLLLVPGHQVEQKMSLTLFMKNG  500

Query  551  LKVKVHPRDL  522
            LKV + PR L
Sbjct  501  LKVFLQPRQL  510


 Score = 38.5 bits (88),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWLTPRRD  745
            GEDCLEFKPERWL+ R D
Sbjct  418  GEDCLEFKPERWLSVRGD  435



>gb|EMT01938.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=489

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -2

Query  731  QDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSLTLFMKDG  552
             D Y+F++FNAGPRICLG+DLAYLQMK+IA ++LLRHRL+++PGH+VEQKMSLTLFMK G
Sbjct  358  HDSYRFVAFNAGPRICLGKDLAYLQMKNIAGSILLRHRLAVAPGHRVEQKMSLTLFMKHG  417

Query  551  LKV  543
            L++
Sbjct  418  LRM  420



>ref|XP_002465889.1| hypothetical protein SORBIDRAFT_01g047640 [Sorghum bicolor]
 gb|EER92887.1| hypothetical protein SORBIDRAFT_01g047640 [Sorghum bicolor]
Length=536

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            +GTK   +  YKFISFNAGPR CLG+++A++QMK++AAAVL    + + PGH VE K+S+
Sbjct  448  EGTKLRYEPSYKFISFNAGPRTCLGKEMAFVQMKTVAAAVLWNFAVEVVPGHVVEPKLSI  507

Query  572  TLFMKDGLKVKVHPRDLT  519
             L MK+GL VKV  RD T
Sbjct  508  ILHMKNGLAVKVRRRDGT  525


 Score = 31.6 bits (70),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            G+DC+EF+PERWL
Sbjct  433  GKDCMEFRPERWL  445



>gb|AFW89633.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=543

 Score = 96.3 bits (238),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            DGTK   +  YKFISFNAGPR CLG+++A++QMK++AAAVL    + + PGH VE K+S+
Sbjct  450  DGTKLRYEPSYKFISFNAGPRTCLGKEMAFVQMKAVAAAVLWNFAVEVVPGHVVEPKLSI  509

Query  572  TLFMKDGLKVKVHPRDLT  519
             L MK+GL VKV  RD T
Sbjct  510  ILHMKNGLAVKVRRRDGT  527


 Score = 29.6 bits (65),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            G+DC EF+PERWL
Sbjct  435  GKDCTEFRPERWL  447



>ref|NP_001141467.1| uncharacterized protein LOC100273577 [Zea mays]
 gb|ACF86433.1| unknown [Zea mays]
Length=537

 Score = 94.0 bits (232),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            +GTK   +  YKFISFNAGPR CLG+++A++QMK++AAAVL    + + PGH VE K+S+
Sbjct  445  EGTKLRYEPSYKFISFNAGPRTCLGKEMAFVQMKTVAAAVLWNFAVEVVPGHVVEPKLSI  504

Query  572  TLFMKDGLKVKVHPRD  525
             L MK+GL VKV  RD
Sbjct  505  ILHMKNGLAVKVTRRD  520


 Score = 31.6 bits (70),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            G+DC+EF+PERWL
Sbjct  430  GKDCMEFRPERWL  442



>tpg|DAA43291.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=535

 Score = 94.0 bits (232),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  752  DGTKFIMQDQYKFISFNAGPRICLGRDLAYLQMKSIAAAVLLRHRLSLSPGHQVEQKMSL  573
            +GTK   +  YKFISFNAGPR CLG+++A++QMK++AAAVL    + + PGH VE K+S+
Sbjct  444  EGTKLRYEPSYKFISFNAGPRTCLGKEMAFVQMKTVAAAVLWNFAVEVVPGHVVEPKLSI  503

Query  572  TLFMKDGLKVKVHPRD  525
             L MK+GL VKV  RD
Sbjct  504  ILHMKNGLAVKVTRRD  519


 Score = 31.6 bits (70),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  798  GEDCLEFKPERWL  760
            G+DC+EF+PERWL
Sbjct  429  GKDCMEFRPERWL  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195