BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031D22

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA13440.1|  calcium dependent protein kinase                       358   2e-117   Ipomoea batatas [batate]
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    324   3e-104   Sesamum indicum [beniseed]
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      324   3e-104   Nicotiana tomentosiformis
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    323   6e-104   Nicotiana sylvestris
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    320   1e-102   Solanum tuberosum [potatoes]
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             320   2e-102   
gb|AEY99979.1|  calcium-dependent protein kinase                        319   4e-102   Nicotiana tabacum [American tobacco]
ref|NP_001275322.1|  calcium-dependent protein kinase                   319   4e-102   Solanum tuberosum [potatoes]
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    318   8e-102   Nicotiana sylvestris
gb|AAD28192.2|  calcium-dependent protein kinase                        318   1e-101   Solanum tuberosum [potatoes]
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      318   1e-101   
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    317   1e-101   Nicotiana tomentosiformis
gb|KHN38276.1|  Calcium-dependent protein kinase 33                     312   4e-101   Glycine soja [wild soybean]
emb|CDP05759.1|  unnamed protein product                                316   6e-101   Coffea canephora [robusta coffee]
gb|KHN11921.1|  Calcium-dependent protein kinase 9                      312   7e-101   Glycine soja [wild soybean]
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      316   9e-101   Prunus mume [ume]
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    315   3e-100   Nicotiana sylvestris
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    314   3e-100   Nicotiana tomentosiformis
gb|AAC25423.1|  calcium-dependent protein kinase                        315   3e-100   Nicotiana tabacum [American tobacco]
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 313   5e-100   Solanum tuberosum [potatoes]
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    313   1e-99    Pyrus x bretschneideri [bai li]
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                312   3e-99    Morus notabilis
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      312   3e-99    
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    311   5e-99    Fragaria vesca subsp. vesca
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             311   6e-99    Prunus persica
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    310   1e-98    Glycine max [soybeans]
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 311   1e-98    Morus notabilis
gb|AET00506.2|  calcium-dependent kinase                                310   2e-98    Medicago truncatula
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    310   2e-98    Sesamum indicum [beniseed]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      309   5e-98    Cucumis melo [Oriental melon]
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    309   6e-98    Cucumis sativus [cucumbers]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      308   8e-98    Panax ginseng [Asiatic ginseng]
emb|CDP04396.1|  unnamed protein product                                308   1e-97    Coffea canephora [robusta coffee]
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                  299   2e-97    Citrus sinensis [apfelsine]
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      308   2e-97    Phoenix dactylifera
ref|XP_007212312.1|  hypothetical protein PRUPE_ppa006748mg             302   4e-97    
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     306   6e-97    Tarenaya hassleriana [spider flower]
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    306   7e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    305   7e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    305   8e-97    Populus euphratica
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    305   1e-96    Arabis alpina [alpine rockcress]
gb|AIU98507.1|  calcium-dependent protein kinase                        305   1e-96    Musa acuminata AAA Group [Cavendish banana]
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   305   2e-96    Medicago truncatula
gb|ABE72958.1|  calcium dependent protein kinase 3                      305   2e-96    Medicago truncatula
emb|CAA65500.1|  protein kinase                                         305   2e-96    Medicago sativa [alfalfa]
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    305   2e-96    Populus euphratica
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    305   2e-96    Sesamum indicum [beniseed]
ref|NP_001234806.1|  calcium-dependent protein kinase                   305   2e-96    Solanum lycopersicum
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             305   2e-96    Phaseolus vulgaris [French bean]
gb|KHN35744.1|  Calcium-dependent protein kinase 33                     300   3e-96    Glycine soja [wild soybean]
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             304   3e-96    Eutrema salsugineum [saltwater cress]
ref|XP_008384073.1|  PREDICTED: calcium-dependent protein kinase ...    300   4e-96    
ref|XP_002891589.1|  calcium-dependent protein kinase 33                303   4e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    304   4e-96    Nicotiana sylvestris
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             303   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    303   7e-96    Nelumbo nucifera [Indian lotus]
gb|EPS59225.1|  calcium-dependent protein kinase 1                      302   8e-96    Genlisea aurea
ref|NP_175485.1|  calcium-dependent protein kinase 33                   302   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         303   1e-95    Ricinus communis
gb|AIO04122.1|  calcium-dependent protein kinase                        303   1e-95    Hevea brasiliensis [jebe]
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    303   1e-95    Solanum tuberosum [potatoes]
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         302   2e-95    Jatropha curcas
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    301   2e-95    Elaeis guineensis
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      302   2e-95    
gb|AGA83664.1|  calcium-dependent protein kinase 1                      302   2e-95    Dendrobium officinale
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    303   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             301   2e-95    Capsella rubella
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    302   3e-95    Prunus mume [ume]
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    301   4e-95    Glycine max [soybeans]
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    301   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    301   5e-95    Nicotiana tomentosiformis
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    301   6e-95    Elaeis guineensis
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             301   6e-95    Populus trichocarpa [western balsam poplar]
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    301   7e-95    Cicer arietinum [garbanzo]
gb|ACB71246.2|  calcium-dependent protein kinase 1                      301   8e-95    Hevea brasiliensis [jebe]
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    301   8e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CAN60225.1|  hypothetical protein VITISV_039919                     298   9e-95    Vitis vinifera
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    300   9e-95    Solanum lycopersicum
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                300   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    300   1e-94    Pyrus x bretschneideri [bai li]
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    300   1e-94    Cicer arietinum [garbanzo]
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    299   2e-94    Populus euphratica
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    300   2e-94    Glycine max [soybeans]
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    299   2e-94    Phoenix dactylifera
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     298   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 299   3e-94    Arabidopsis lyrata subsp. lyrata
emb|CBI23246.3|  unnamed protein product                                298   3e-94    Vitis vinifera
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             299   3e-94    Citrus clementina [clementine]
emb|CBI26637.3|  unnamed protein product                                292   4e-94    Vitis vinifera
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      299   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             299   4e-94    Capsella rubella
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      298   7e-94    Vitis vinifera
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    298   8e-94    Pyrus x bretschneideri [bai li]
gb|AHN49725.1|  calcium-dependent protein kinase 1                      298   1e-93    Hippeastrum hybrid cultivar
ref|XP_003610427.1|  Calcium-dependent protein kinase                   298   1e-93    
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    297   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    297   1e-93    Fragaria vesca subsp. vesca
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             297   1e-93    Citrus clementina [clementine]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    296   2e-93    Arabis alpina [alpine rockcress]
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            297   2e-93    Malus domestica [apple tree]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    297   2e-93    Citrus sinensis [apfelsine]
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   297   2e-93    Citrus sinensis [apfelsine]
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             296   2e-93    Phaseolus vulgaris [French bean]
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          294   2e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         297   3e-93    Ricinus communis
gb|AAP03014.1|  seed calcium dependent protein kinase c                 296   3e-93    Glycine max [soybeans]
gb|AFY10519.1|  calcium dependent protein kinase 1                      296   4e-93    Dendrobium officinale
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    296   4e-93    
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     296   6e-93    Gossypium arboreum [tree cotton]
dbj|BAE71239.1|  putative calcium dependent protein kinase              296   6e-93    Trifolium pratense [peavine clover]
gb|ACJ61504.1|  calcium-dependent protein kinase                        296   7e-93    Glycine max [soybeans]
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     295   8e-93    Vitis amurensis
gb|KDP20751.1|  hypothetical protein JCGZ_21222                         296   1e-92    Jatropha curcas
emb|CAA57157.1|  calcium-dependent protein kinase                       295   1e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    296   1e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 295   1e-92    Solanum tuberosum [potatoes]
ref|NP_001059775.1|  Os07g0515100                                       295   1e-92    
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           295   1e-92    Cicer arietinum [garbanzo]
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      295   2e-92    Glycine soja [wild soybean]
ref|XP_003617547.1|  Calcium dependent protein kinase                   305   2e-92    
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    295   2e-92    Elaeis guineensis
gb|KJB69279.1|  hypothetical protein B456_011G014200                    294   3e-92    Gossypium raimondii
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    293   3e-92    Oryza brachyantha
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    293   5e-92    Cucumis melo [Oriental melon]
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    293   5e-92    Cucumis sativus [cucumbers]
gb|AGG35978.1|  calcium-dependent protein kinase 9                      293   8e-92    Brassica napus [oilseed rape]
emb|CDY36037.1|  BnaC03g41610D                                          292   9e-92    Brassica napus [oilseed rape]
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      292   1e-91    Vitis vinifera
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    292   2e-91    
gb|ADM14342.1|  calcium-dependent protein kinase 19                     291   2e-91    Oryza sativa Japonica Group [Japonica rice]
gb|ACR34538.1|  unknown                                                 291   3e-91    Zea mays [maize]
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     291   3e-91    Vitis amurensis
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    291   3e-91    
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     291   3e-91    Tarenaya hassleriana [spider flower]
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       291   4e-91    
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            289   4e-91    Phaseolus vulgaris [French bean]
emb|CDX82244.1|  BnaA03g35770D                                          291   4e-91    
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 290   4e-91    
gb|KFK28778.1|  hypothetical protein AALP_AA7G046400                    290   5e-91    Arabis alpina [alpine rockcress]
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      291   5e-91    Brassica rapa
ref|NP_001105306.1|  calcium-dependent protein kinase                   290   6e-91    Zea mays [maize]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    294   7e-91    
gb|ABC59620.1|  calcium-dependent protein kinase                        290   7e-91    Triticum aestivum [Canadian hard winter wheat]
gb|ABC59619.1|  calcium-dependent protein kinase                        290   7e-91    Triticum aestivum [Canadian hard winter wheat]
gb|ABD98803.1|  calcium-dependent protein kinase                        290   7e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    290   8e-91    
dbj|BAJ99143.1|  predicted protein                                      290   8e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD98804.1|  calcium-dependent protein kinase                        290   9e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    290   1e-90    Tarenaya hassleriana [spider flower]
gb|ABB54456.1|  calcium-dependent protein kinase                        289   2e-90    Hordeum brevisubulatum
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      289   2e-90    Gossypium arboreum [tree cotton]
gb|KJB13679.1|  hypothetical protein B456_002G088800                    289   2e-90    Gossypium raimondii
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      289   2e-90    Gossypium arboreum [tree cotton]
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     289   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    289   4e-90    Camelina sativa [gold-of-pleasure]
gb|KJB62816.1|  hypothetical protein B456_009G438300                    288   4e-90    Gossypium raimondii
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     286   1e-89    Eucalyptus grandis [rose gum]
gb|KJB68586.1|  hypothetical protein B456_010G252400                    287   1e-89    Gossypium raimondii
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    288   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     288   1e-89    Brassica rapa
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                287   1e-89    Erythranthe guttata [common monkey flower]
emb|CDX79112.1|  BnaA01g11790D                                          288   2e-89    
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    287   2e-89    Eucalyptus grandis [rose gum]
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    286   2e-89    Eucalyptus grandis [rose gum]
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             287   3e-89    Capsella rubella
gb|AGG35967.1|  calcium-dependent protein kinase 15                     287   3e-89    Brassica napus [oilseed rape]
emb|CDX82886.1|  BnaC01g13360D                                          286   3e-89    
gb|KCW66998.1|  hypothetical protein EUGRSUZ_F007612                    273   5e-89    Eucalyptus grandis [rose gum]
ref|XP_006413708.1|  hypothetical protein EUTSA_v100267671mg            275   5e-89    
ref|NP_193925.1|  calcium-dependent protein kinase 15                   286   5e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CAD70165.1|  calcium-dependent protein kinase                       286   6e-89    Landoltia punctata
ref|NP_001190794.1|  calcium-dependent protein kinase 15                285   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AAQ17506.1|  calcium dependent protein kinase 3                      284   2e-88    Oryza sativa Japonica Group [Japonica rice]
gb|AFR11230.1|  calcium dependent protein kinase 1                      284   3e-88    Chenopodium album [lamb's-quarters]
ref|XP_002869856.1|  calcium-dependent protein kinase 15                284   3e-88    Arabidopsis lyrata subsp. lyrata
gb|AGG35970.1|  calcium-dependent protein kinase 21                     283   4e-88    Brassica napus [oilseed rape]
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    283   4e-88    Arabis alpina [alpine rockcress]
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    283   6e-88    
gb|KJB81727.1|  hypothetical protein B456_013G159300                    283   6e-88    Gossypium raimondii
gb|AAK92828.1|  putative calcium dependent protein kinase               282   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             282   9e-88    Capsella rubella
ref|XP_002874811.1|  calcium-dependent protein kinase 21                282   1e-87    
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      282   1e-87    Gossypium arboreum [tree cotton]
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     281   1e-87    Eucalyptus grandis [rose gum]
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     281   2e-87    Eucalyptus grandis [rose gum]
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     281   2e-87    Brassica rapa
ref|NP_192381.1|  calcium-dependent protein kinase 21                   281   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             280   6e-87    Eutrema salsugineum [saltwater cress]
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780          280   1e-86    Amborella trichopoda
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    279   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     279   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    278   2e-86    
ref|XP_010100127.1|  Calcium-dependent protein kinase 29                278   4e-86    Morus notabilis
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    278   9e-86    
ref|XP_002869854.1|  hypothetical protein ARALYDRAFT_914449             282   6e-85    
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    275   1e-84    
ref|XP_011083439.1|  PREDICTED: calcium-dependent protein kinase 29     271   1e-83    Sesamum indicum [beniseed]
gb|KFK30982.1|  hypothetical protein AALP_AA6G053400                    269   2e-83    Arabis alpina [alpine rockcress]
ref|XP_004164365.1|  PREDICTED: calcium-dependent protein kinase ...    264   2e-83    
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg             270   6e-83    Eutrema salsugineum [saltwater cress]
emb|CDP12100.1|  unnamed protein product                                265   8e-83    Coffea canephora [robusta coffee]
gb|AAD17800.1|  Ca2+-dependent protein kinase                           269   8e-83    Mesembryanthemum crystallinum
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         269   9e-83    Ricinus communis
ref|XP_002888057.1|  predicted protein                                  270   1e-82    
ref|NP_177731.2|  calcium-dependent protein kinase 29                   262   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg             269   1e-82    Capsella rubella
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      269   2e-82    Solanum tuberosum [potatoes]
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     268   2e-82    Solanum lycopersicum
ref|XP_011003084.1|  PREDICTED: calcium-dependent protein kinase ...    268   3e-82    Populus euphratica
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    268   4e-82    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                    268   6e-82    Arabis alpina [alpine rockcress]
ref|XP_002306955.1|  hypothetical protein POPTR_0005s26640g             266   7e-82    Populus trichocarpa [western balsam poplar]
gb|KDP36877.1|  hypothetical protein JCGZ_08168                         266   8e-82    Jatropha curcas
ref|XP_011003085.1|  PREDICTED: calcium-dependent protein kinase ...    266   9e-82    Populus euphratica
ref|XP_002874810.1|  hypothetical protein ARALYDRAFT_490109             265   9e-82    
gb|KHN35055.1|  Calcium-dependent protein kinase 3                      261   1e-81    Glycine soja [wild soybean]
emb|CDX94570.1|  BnaC09g22660D                                          271   1e-81    
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29     266   1e-81    Prunus mume [ume]
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg             266   2e-81    Prunus persica
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    273   2e-81    
gb|KHN16773.1|  Calcium-dependent protein kinase 3                      256   3e-81    Glycine soja [wild soybean]
ref|XP_006342079.1|  PREDICTED: calcium-dependent protein kinase ...    266   3e-81    Solanum tuberosum [potatoes]
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      265   4e-81    Eucalyptus grandis [rose gum]
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g             264   8e-81    Populus trichocarpa [western balsam poplar]
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29     264   8e-81    Malus domestica [apple tree]
sp|Q9ZSA3.2|CDPKM_ARATH  RecName: Full=Calcium-dependent protein ...    263   9e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413705.1|  hypothetical protein EUTSA_v10027200mg             258   1e-80    
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19     262   1e-80    
emb|CBI34415.3|  unnamed protein product                                259   1e-80    Vitis vinifera
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg                263   1e-80    Erythranthe guttata [common monkey flower]
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             263   2e-80    Citrus clementina [clementine]
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   263   2e-80    Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    263   2e-80    Citrus sinensis [apfelsine]
ref|XP_009114553.1|  PREDICTED: calcium-dependent protein kinase 22     262   2e-80    Brassica rapa
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 263   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29     263   2e-80    Populus euphratica
ref|XP_008239005.1|  PREDICTED: calcium-dependent protein kinase 3      259   3e-80    
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      262   3e-80    Populus euphratica
gb|AEY99978.1|  calcium-dependent protein kinase                        262   3e-80    Nicotiana tabacum [American tobacco]
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    262   3e-80    Nelumbo nucifera [Indian lotus]
ref|NP_176386.2|  calcium-dependent protein kinase 19                   263   4e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KDP25359.1|  hypothetical protein JCGZ_20515                         262   4e-80    Jatropha curcas
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    262   4e-80    Sesamum indicum [beniseed]
gb|KJB52214.1|  hypothetical protein B456_008G251000                    258   4e-80    Gossypium raimondii
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       262   4e-80    Cucumis sativus [cucumbers]
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...    263   5e-80    Arabidopsis thaliana [mouse-ear cress]
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...    262   5e-80    Daucus carota [carrots]
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    260   5e-80    Citrus sinensis [apfelsine]
gb|KHG01345.1|  Calcium-dependent protein kinase 29                     255   5e-80    Gossypium arboreum [tree cotton]
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    261   5e-80    Glycine max [soybeans]
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             261   6e-80    
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      261   6e-80    Nicotiana tomentosiformis
gb|AGS15000.1|  calcium-dependent protein kinase 3                      261   6e-80    Vitis amurensis
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...    262   6e-80    
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...    261   8e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY07254.1|  BnaC04g19170D                                          262   8e-80    
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    261   8e-80    Solanum tuberosum [potatoes]
gb|KHN25667.1|  Calcium-dependent protein kinase 3                      257   9e-80    Glycine soja [wild soybean]
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    261   9e-80    Populus euphratica
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      261   9e-80    Nicotiana sylvestris
ref|XP_010471751.1|  PREDICTED: calcium-dependent protein kinase ...    262   9e-80    
emb|CAN61364.1|  hypothetical protein VITISV_032639                     260   1e-79    Vitis vinifera
emb|CDY24863.1|  BnaA03g59670D                                          261   1e-79    Brassica napus [oilseed rape]
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg             261   1e-79    Citrus clementina [clementine]
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...    261   1e-79    Citrus sinensis [apfelsine]
emb|CDP07348.1|  unnamed protein product                                261   1e-79    Coffea canephora [robusta coffee]
ref|XP_010536433.1|  PREDICTED: calcium-dependent protein kinase 29     261   1e-79    Tarenaya hassleriana [spider flower]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      261   1e-79    Cucumis melo [Oriental melon]
ref|XP_010416511.1|  PREDICTED: calcium-dependent protein kinase ...    262   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010428653.1|  PREDICTED: calcium-dependent protein kinase ...    262   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       261   1e-79    
emb|CAC83060.1|  calcium dependent calmodulin independent protein...    257   2e-79    Cucumis sativus [cucumbers]
ref|NP_974150.2|  calcium-dependent protein kinase 29                   261   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAD48958.1|AF149414_7  similar to Pfam families PF00069 (Eukar...    258   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      260   3e-79    Vitis vinifera
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      260   3e-79    Pyrus x bretschneideri [bai li]
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    259   3e-79    Cicer arietinum [garbanzo]
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg             261   3e-79    Capsella rubella
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...    260   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    259   5e-79    
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29     259   6e-79    
gb|AES59823.2|  calcium-dependent kinase                                259   8e-79    
ref|XP_007017899.1|  Calcium-dependent protein kinase 29                258   9e-79    
emb|CDY16652.1|  BnaA09g20300D                                          257   9e-79    
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      258   9e-79    
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         258   1e-78    
ref|NP_680596.2|  calcium-dependent protein kinase 31                   257   1e-78    
ref|XP_007017897.1|  Calcium-dependent protein kinase 29                258   1e-78    
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                     258   1e-78    
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      258   1e-78    
ref|XP_003611046.1|  Calcium dependent protein kinase                   258   1e-78    
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   258   1e-78    
gb|KJB52213.1|  hypothetical protein B456_008G251000                    258   1e-78    
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    258   2e-78    
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    258   2e-78    
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  257   2e-78    
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     257   2e-78    
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             258   2e-78    
emb|CAN67210.1|  hypothetical protein VITISV_026712                     258   2e-78    
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            257   3e-78    
tpg|DAA58513.1|  TPA: putative calcium-dependent protein kinase f...    250   3e-78    
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             257   3e-78    
ref|XP_009414364.1|  PREDICTED: calcium-dependent protein kinase ...    248   3e-78    
ref|NP_192380.1|  calcium-dependent protein kinase 22                   258   3e-78    
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg             256   3e-78    
ref|XP_002869852.1|  hypothetical protein ARALYDRAFT_354567             253   4e-78    
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    257   4e-78    
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     256   5e-78    
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29     258   5e-78    
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    257   6e-78    
gb|AGG35971.1|  calcium-dependent protein kinase 29                     256   7e-78    
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29     257   8e-78    
gb|ABC47163.2|  CDPK1                                                   256   9e-78    
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     256   1e-77    
gb|EEC79771.1|  hypothetical protein OsI_21169                          252   1e-77    
emb|CDX73219.1|  BnaC06g36670D                                          256   1e-77    
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 258   2e-77    
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    255   2e-77    
ref|XP_003610425.1|  Calcium-dependent protein kinase                   256   2e-77    
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      255   2e-77    
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    253   3e-77    
ref|XP_002874809.1|  calcium-dependent protein kinase 31                253   3e-77    
gb|KJB63479.1|  hypothetical protein B456_010G001300                    254   4e-77    
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    254   5e-77    
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    254   5e-77    
gb|EEE64852.1|  hypothetical protein OsJ_19709                          254   6e-77    
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19     254   7e-77    
ref|XP_003545013.1|  PREDICTED: calcium-dependent protein kinase ...    254   7e-77    
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                   253   8e-77    
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    253   8e-77    
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      253   1e-76    
ref|NP_001056455.1|  Os05g0585500                                       253   1e-76    
ref|XP_006596531.1|  PREDICTED: calcium-dependent protein kinase ...    253   2e-76    
dbj|BAA81749.1|  calcium-dependent protein kinase                       253   2e-76    
gb|AGF69185.1|  calcium-dependent protein kinase 3-like 1               243   2e-76    
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    252   3e-76    
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             258   3e-76    
gb|KFK42039.1|  hypothetical protein AALP_AA2G204000                    252   3e-76    
ref|XP_006390245.1|  hypothetical protein EUTSA_v10018359mg             253   4e-76    
ref|XP_003589572.1|  Calcium-dependent protein kinase                   259   4e-76    
ref|XP_006849377.1|  hypothetical protein AMTR_s00158p00082100          252   5e-76    
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      251   6e-76    
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...    247   6e-76    
gb|EMT20115.1|  Calcium-dependent protein kinase 3                      245   1e-75    
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                250   1e-75    
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      252   1e-75    
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg             250   2e-75    
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    248   2e-75    
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    248   2e-75    
ref|XP_002874812.1|  calcium-dependent protein kinase 23                250   2e-75    
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    250   3e-75    
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    250   3e-75    
gb|EMS46165.1|  Calcium-dependent protein kinase 3                      244   3e-75    
ref|XP_010667438.1|  PREDICTED: calcium-dependent protein kinase 29     249   4e-75    
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          249   4e-75    
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    249   5e-75    
emb|CDY10955.1|  BnaA03g46140D                                          244   6e-75    
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...    247   7e-75    
ref|XP_009137376.1|  PREDICTED: calcium-dependent protein kinase 3      244   7e-75    
ref|NP_001169721.1|  uncharacterized LOC100383602                       248   7e-75    
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             248   8e-75    
ref|NP_001151970.1|  calcium-dependent protein kinase                   248   1e-74    
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    248   1e-74    
gb|AFW59214.1|  putative calcium-dependent protein kinase family ...    248   1e-74    
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    248   2e-74    
gb|AIU98501.1|  calcium-dependent protein kinase                        247   2e-74    
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...    248   2e-74    
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      246   2e-74    
ref|XP_008466461.1|  PREDICTED: calcium-dependent protein kinase 29     247   2e-74    
ref|XP_004976490.1|  PREDICTED: calcium-dependent protein kinase ...    247   2e-74    
dbj|BAA81748.1|  calcium-dependent protein kinase                       248   3e-74    
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             247   3e-74    
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    252   3e-74    
gb|EEC71113.1|  hypothetical protein OsI_02910                          246   3e-74    
dbj|BAJ94561.1|  predicted protein                                      246   4e-74    
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    246   5e-74    
gb|AIU98504.1|  calcium-dependent protein kinase                        246   6e-74    
ref|XP_006287670.1|  hypothetical protein CARUB_v10000880mg             244   6e-74    
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          246   6e-74    
ref|XP_004136368.1|  PREDICTED: calcium-dependent protein kinase ...    246   6e-74    
ref|XP_004167002.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    246   7e-74    
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...    244   8e-74    
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        246   8e-74    
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    246   8e-74    
gb|KDO62708.1|  hypothetical protein CISIN_1g018604mg                   241   9e-74    
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    245   1e-73    
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         245   1e-73    
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg             245   1e-73    
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          245   1e-73    
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      245   1e-73    
ref|XP_002448323.1|  hypothetical protein SORBIDRAFT_06g025220          245   1e-73    
dbj|BAK07881.1|  predicted protein                                      245   1e-73    
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                   245   1e-73    
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    245   1e-73    
emb|CAF18446.1|  putative calcium-dependent protein kinase              245   1e-73    
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873    253   2e-73    
dbj|BAJ95679.1|  predicted protein                                      244   2e-73    
emb|CDP20327.1|  unnamed protein product                                244   2e-73    
dbj|BAD61167.1|  putative calcium-dependent protein kinase              249   2e-73    
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940          244   3e-73    
emb|CDY44125.1|  BnaA01g13330D                                          244   4e-73    
gb|AGG35973.1|  calcium-dependent protein kinase 3                      244   4e-73    
tpg|DAA62901.2|  TPA: putative calcium-dependent protein kinase f...    231   4e-73    
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             244   4e-73    
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 244   4e-73    
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     244   5e-73    
ref|NP_194096.1|  calcium-dependent protein kinase 6                    244   5e-73    
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           244   5e-73    
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...    244   5e-73    
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         243   6e-73    
ref|XP_004972225.1|  PREDICTED: calcium-dependent protein kinase ...    239   6e-73    
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    243   7e-73    
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    243   7e-73    
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...    243   7e-73    
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    243   7e-73    
gb|KJB19075.1|  hypothetical protein B456_003G084000                    243   8e-73    
ref|XP_006653668.1|  PREDICTED: calcium-dependent protein kinase ...    242   8e-73    
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    243   9e-73    
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg             243   9e-73    
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...    243   1e-72    
gb|ACR36994.1|  unknown                                                 231   1e-72    
gb|AIU98505.1|  calcium-dependent protein kinase                        243   1e-72    
gb|KCW45109.1|  hypothetical protein EUGRSUZ_L012821                    236   1e-72    
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             243   1e-72    
gb|KJB83565.1|  hypothetical protein B456_013G253100                    242   2e-72    
ref|NP_192383.1|  calcium-dependent protein kinase 23                   242   2e-72    
ref|NP_001053548.1|  Os04g0560600                                       242   3e-72    
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    242   3e-72    
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    242   3e-72    
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                241   4e-72    
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     239   5e-72    
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    241   5e-72    
gb|KHN48531.1|  Calcium-dependent protein kinase 29                     236   5e-72    
ref|XP_006452355.1|  hypothetical protein CICLE_v10010314mg             240   5e-72    
ref|XP_006452347.1|  hypothetical protein CICLE_v10008020mg             240   6e-72    
gb|EEC79448.1|  hypothetical protein OsI_20437                          241   6e-72    
ref|XP_002313265.1|  calcium-dependent protein kinase                   241   7e-72    
emb|CDY54853.1|  BnaC01g15460D                                          241   7e-72    
gb|AHN16201.1|  CPK3-2.1                                                241   7e-72    
gb|EEE64198.1|  hypothetical protein OsJ_19030                          240   7e-72    
gb|AAT69647.1|  hypothetical protein                                    241   8e-72    
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     240   8e-72    
emb|CDY62741.1|  BnaC07g50270D                                          243   9e-72    
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    241   9e-72    
gb|KDO62705.1|  hypothetical protein CISIN_1g040917mg                   239   1e-71    
gb|ABY59010.1|  calcium-dependent protein kinase                        240   1e-71    
ref|NP_001055912.1|  Os05g0491900                                       241   1e-71    
gb|ACA63885.1|  calcium-dependent protein kinase                        240   1e-71    
gb|EAY76207.1|  hypothetical protein OsI_04143                          239   1e-71    
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    240   1e-71    
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    239   1e-71    
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    240   1e-71    
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    240   2e-71    
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                240   2e-71    
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    240   2e-71    
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    239   2e-71    
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                240   2e-71    
ref|NP_001044575.1|  Os01g0808400                                       239   2e-71    
gb|KJB35709.1|  hypothetical protein B456_006G124800                    239   2e-71    
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg             239   2e-71    
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     240   2e-71    
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...    239   2e-71    
ref|XP_006452359.1|  hypothetical protein CICLE_v10007873mg             240   3e-71    
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    239   3e-71    
ref|XP_010422291.1|  PREDICTED: calcium-dependent protein kinase ...    238   3e-71    
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                239   3e-71    
ref|XP_006475078.1|  PREDICTED: calcium-dependent protein kinase ...    239   3e-71    
gb|AGT15898.1|  calcium-dependent protein kinase                        239   3e-71    
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    239   3e-71    
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    239   4e-71    
ref|XP_010432452.1|  PREDICTED: calcium-dependent protein kinase ...    238   4e-71    
ref|XP_006475079.1|  PREDICTED: calcium-dependent protein kinase ...    238   4e-71    
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    239   4e-71    
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                   237   5e-71    
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    238   5e-71    
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    238   5e-71    
gb|AGT17376.1|  calcium-dependent protein kinase                        239   5e-71    
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    238   5e-71    
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    238   6e-71    
ref|XP_010061107.1|  PREDICTED: calcium-dependent protein kinase ...    238   6e-71    
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                238   6e-71    
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                238   6e-71    
gb|AGT17166.1|  calcium-dependent protein kinase                        237   6e-71    
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    238   7e-71    
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    238   7e-71    
dbj|BAJ96684.1|  predicted protein                                      238   7e-71    
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    238   7e-71    
ref|XP_010455760.1|  PREDICTED: calcium-dependent protein kinase ...    237   7e-71    
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     238   8e-71    
gb|KCW68006.1|  hypothetical protein EUGRSUZ_F01695                     237   8e-71    
emb|CDX78468.1|  BnaA03g03800D                                          238   8e-71    
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    238   9e-71    
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     238   9e-71    
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    238   9e-71    
ref|NP_197437.1|  calcium-dependent protein kinase 34                   238   9e-71    
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    238   1e-70    
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             238   1e-70    
emb|CAG27840.1|  calcium-dependent protein kinase 17                    238   1e-70    
gb|AHG06449.1|  calcium-dependent protein kinase 17                     238   1e-70    
ref|XP_002873943.1|  calcium-dependent protein kinase 34                238   1e-70    



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA
Sbjct  338  AVLSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  397

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG
Sbjct  398  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  457

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQ KLF
Sbjct  458  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQAKLF  514



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTDNSGTITYEELK GLA
Sbjct  347  AVLTRMKQFRAMNKLKKLALKVIAENLSTEEIQGLKAMFTNMDTDNSGTITYEELKAGLA  406

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLM+AADVDGNGSIDYIEFITATMH+HRLEREENLYKAFQYFDKDSSG
Sbjct  407  RLGSKLTEAEVRQLMDAADVDGNGSIDYIEFITATMHRHRLEREENLYKAFQYFDKDSSG  466

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAM+E+GI DA+TIKEII+EVD D+DGRINYEEFCTMMR+G  QQPKLF
Sbjct  467  FITRDELETAMQEYGIGDASTIKEIIAEVDTDNDGRINYEEFCTMMRTGNPQQPKLF  523



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  346  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKSMFHNIDTDNSGTITYEELKSGLA  405

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKD SG
Sbjct  406  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDGSG  465

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAM+EHGI DAA+I+EIISEVDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  466  FITRDELETAMEEHGIGDAASIREIISEVDADNDGRINYEEFCTMMRSGAKQPGKLF  522



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  346  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKSMFHNIDTDNSGTITYEELKSGLA  405

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKD SG
Sbjct  406  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDGSG  465

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAM+EHG+ DAA+I+EIISEVDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  466  FITRDELETAMEEHGVGDAASIREIISEVDADNDGRINYEEFCTMMRSGAKQPGKLF  522



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAENLS EEIHGLKAMF NIDTDNSGTITYEELK GL
Sbjct  344  GAVLSRMKQFRAMNKLKKLALKVIAENLSAEEIHGLKAMFHNIDTDNSGTITYEELKSGL  403

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER+ENLY AFQYFDKDSS
Sbjct  404  AKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLERDENLYTAFQYFDKDSS  463

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            GFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFCTMMRSG KQ  K+F
Sbjct  464  GFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEEFCTMMRSGAKQPGKVF  521



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAENLS EEIHGLKAMF NIDTDNSGTITYEELK GL
Sbjct  344  GAVLSRMKQFRAMNKLKKLALKVIAENLSAEEIHGLKAMFHNIDTDNSGTITYEELKSGL  403

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER+ENLY AFQYFDKDSS
Sbjct  404  AKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLERDENLYTAFQYFDKDSS  463

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            GFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFCTMMRSG KQ  K+F
Sbjct  464  GFITRDELEAAMEEHGIGDPSCIREIISEVDTDNDGRINYEEFCTMMRSGAKQPGKVF  521



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  346  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKSMFHNIDTDNSGTITYEELKSGLA  405

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRL  EENLYKAFQYFDKDSSG
Sbjct  406  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLNSEENLYKAFQYFDKDSSG  465

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAM+EHGI DAA+I+EI+S+VDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  466  FITRDELETAMEEHGIGDAASIREIMSDVDADNDGRINYEEFCTMMRSGAKQPGKLF  522



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLS +EI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKRLALKVIAENLSADEIQGLKSMFHNIDTDNSGTITYEELKSGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER+ENLYKAFQYFDKD SG
Sbjct  416  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLERDENLYKAFQYFDKDGSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELET+M+EHGI D A+I+EIISEVDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  476  FITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEEFCTMMRSGAKQPGKLF  532



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score =   318 bits (815),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAENLS EEIHGLKAMF NIDTDNSGTITYEEL+ GL
Sbjct  344  GAVLSRMKQFRAMNKLKKLALKVIAENLSAEEIHGLKAMFHNIDTDNSGTITYEELRSGL  403

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER+ENLY AFQYFDKD S
Sbjct  404  AKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLERDENLYTAFQYFDKDGS  463

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            GFITRDELETAM+EHGI D A I+EIISEVD D+DGRINY+EFC MMRSG KQ  KLF
Sbjct  464  GFITRDELETAMEEHGIGDPACIREIISEVDTDNDGRINYDEFCAMMRSGVKQPGKLF  521



>gb|AAD28192.2| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ABF56558.1| calcium-dependent protein kinase 1 [Solanum tuberosum]
Length=532

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLS +EI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKRLALKVIAENLSADEIQGLKSMFHNIDTDNSGTITYEELKSGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER+ENLYKAFQYFDKD SG
Sbjct  416  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLERDENLYKAFQYFDKDGSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELET+M+EHGI D A+I+EII+EVDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  476  FITRDELETSMEEHGIGDPASIREIIAEVDADNDGRINYEEFCTMMRSGAKQPGKLF  532



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLS +EI GLK+MF NIDTDNSGTITYEELK GLA
Sbjct  350  AVLSRMKQFRAMNKLKRLALKVIAENLSADEILGLKSMFHNIDTDNSGTITYEELKSGLA  409

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER+ENLYKAFQYFDKD SG
Sbjct  410  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLERDENLYKAFQYFDKDGSG  469

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELET+M+EHGI D A+I+EIISEVDAD+DGRINYEEFCTMMRSG KQ  KLF
Sbjct  470  FITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEEFCTMMRSGAKQPGKLF  526



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAENLS EEIHGLKAMF NIDTDNSGTITYEEL+ GL
Sbjct  344  GAVLSRMKQFRAMNKLKKLALKVIAENLSAEEIHGLKAMFHNIDTDNSGTITYEELRSGL  403

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER+ENLY AFQYFDKD S
Sbjct  404  AKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLERDENLYTAFQYFDKDGS  463

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            GFITRDELETAM+EHGI D A I+EII+EVD D+DGRINYEEFC MMRSG KQ  KLF
Sbjct  464  GFITRDELETAMEEHGIGDPACIREIITEVDTDNDGRINYEEFCAMMRSGVKQPGKLF  521



>gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=391

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTNIDTDNSGTITYEEL+ GL 
Sbjct  215  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQ  274

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD SG
Sbjct  275  RLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLERDEHLHKAFQYFDKDGSG  334

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ D ATI+EIISEVD D+DGRINY+EFCTMMRSGT+QQ KLF
Sbjct  335  YITRDELETAMKEYGMGDEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKLF  391



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LS EEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  344  AVLSRMKQFRAMNKLKKLALKVIAESLSAEEIQGLKAMFQNMDTDNSGTITYEELKSGLA  403

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMHKH+LEREENLY AFQYFDKD+SG
Sbjct  404  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHKHKLEREENLYTAFQYFDKDNSG  463

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMK++G+ D ATIKEIISEVD D+DGRINYEEFCTMMRSGTKQ  KLF
Sbjct  464  FITRDELETAMKDYGMGDPATIKEIISEVDTDNDGRINYEEFCTMMRSGTKQPNKLF  520



>gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=404

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTNIDTDNSGTITYEEL+ GL 
Sbjct  228  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQ  287

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EV+QLM+AADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQYFDKD SG
Sbjct  288  RLGSKLTETEVRQLMDAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQYFDKDGSG  347

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D ATI+EIISEVD D+DGRINYEEFCTMMRSGT+QQ KLF
Sbjct  348  YITRDELEIAMKEYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF  404



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSE+EIHGLKAMFTN+DTDNSGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAENLSEDEIHGLKAMFTNMDTDNSGTITYEELKSGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDG+G+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD+SG
Sbjct  429  RLGSKLTEAEVKQLMEAADVDGSGAIDYIEFITATMHRHRLERDEHLFKAFQYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF TMMRSGT+ QPKLF
Sbjct  489  FITRDELESAMKEYGMGDDATIREIISEVDTDNDGRINYEEFSTMMRSGTQPQPKLF  545



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  366  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLA  425

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD SG
Sbjct  426  RLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSG  485

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC MMRSGT+ QPKLF
Sbjct  486  FITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF  542



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  358  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLA  417

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD SG
Sbjct  418  RLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSG  477

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC MMRSGT+ QPKLF
Sbjct  478  FITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF  534



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  364  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLA  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD SG
Sbjct  424  RLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC MMRSGT+ QPKLF
Sbjct  484  FITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF  540



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAENLS EEIHGLKAMF NIDTDNSGTITYEELK GL
Sbjct  344  GAVLSRMKQFRAMNKLKKLALKVIAENLSAEEIHGLKAMFHNIDTDNSGTITYEELKSGL  403

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER+ENLY AFQYFDKD S
Sbjct  404  AKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLERDENLYTAFQYFDKDGS  463

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            GFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFCTMMRSG K
Sbjct  464  GFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEEFCTMMRSGAK  515



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEIHGLKAMFTN+DTDNSGTITY+ELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIHGLKAMFTNLDTDNSGTITYDELKSGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDG+GSIDY+EFITATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  428  RLGSKLTEAEVKQLMEAADVDGSGSIDYLEFITATMHRHRLERDEHLYKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF TMMRSG + Q KLF
Sbjct  488  FITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEEFSTMMRSGMQPQAKLF  544



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKSGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER+E+LYK FQYFDKD+SG
Sbjct  423  RIGSRLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRHRLERDEHLYKVFQYFDKDNSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKEHGI D A IKEIISEVD D+DGRI+Y EFCTMMRSGT+Q  KLF
Sbjct  483  FITRDELETAMKEHGIGDEANIKEIISEVDTDNDGRIDYTEFCTMMRSGTQQSTKLF  539



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEIHGLKAMFTN+DTDNSGTITY+ELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIHGLKAMFTNLDTDNSGTITYDELKSGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDG+GSIDYIEFITATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  428  RLGSKLTEAEVKQLMEAADVDGSGSIDYIEFITATMHRHRLERDEHLYKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF TMM+SG + Q KLF
Sbjct  488  FITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEEFSTMMKSGMQPQAKLF  544



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEIHGLKAMF N+DTD SGTITY+ELK GLA
Sbjct  365  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIHGLKAMFANMDTDKSGTITYDELKSGLA  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG IDYIEFITATMH+H+LER+E+LYKAFQYFD D+SG
Sbjct  425  RLGSKLTEAEVKQLMEAADVDGNGGIDYIEFITATMHRHKLERDEHLYKAFQYFDTDNSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE AMKE+G+ D ATI++IISEVD D+DGRINYEEFCTMMRSGT+QQ KLF
Sbjct  485  FITRDELEKAMKEYGMGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF  541



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEIHGLKAMFTN+DTDNSGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIHGLKAMFTNMDTDNSGTITYEELKSGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDG+G+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD+SG
Sbjct  429  RLGSKLTEAEVKQLMEAADVDGSGAIDYIEFITATMHRHRLERDEHLFKAFQYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AMKE+G+ D  TI+EIISEVD D+DGRINYEEF TMMRSGT+ Q KLF
Sbjct  489  FITRDELESAMKEYGMGDDQTIREIISEVDTDNDGRINYEEFSTMMRSGTQPQAKLF  545



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTNIDTDNSGTITYEEL+ GL 
Sbjct  352  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQ  411

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQYFDKD SG
Sbjct  412  RLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLERDEHLHKAFQYFDKDGSG  471

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ + ATI+EIISEVD D+DGRINY+EFCTMMRSGT+QQ KLF
Sbjct  472  YITRDELETAMKEYGMGNEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKLF  528



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLA K IAENLSEEEI GLKAMFTNIDTDNSGTITY+ELK GLA
Sbjct  372  AVLSRMKQFRAMNKLKKLAFKVIAENLSEEEIQGLKAMFTNIDTDNSGTITYDELKSGLA  431

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLEREE+L+KAFQ+FDKDSSG
Sbjct  432  RLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLEREEHLFKAFQFFDKDSSG  491

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMK++G+ D ATI+EIISEVD D+DGRINY EFC MMRSGT+ Q KLF
Sbjct  492  FITRDELETAMKDYGMGDEATIREIISEVDTDNDGRINYSEFCAMMRSGTQHQGKLF  548



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTD SGTITYEEL+ GL 
Sbjct  364  AVLSRMKQFRAMNKLKKLALKVIAENLSSEEIQGLKAMFTNMDTDKSGTITYEELRAGLQ  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  424  RLGSKLTEAEVRQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQYFDKDNSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKE+G+ D  TI+EIISEVD D+DGRINYEEFCTMMRSG +QQ KLF
Sbjct  484  FITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEEFCTMMRSGVQQQGKLF  540



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IA++LSEEEI GLKAMFTNIDTD SGTITYEELK GLA
Sbjct  365  AVLSRMKQFRAMNKLKKLALKVIAQSLSEEEIKGLKAMFTNIDTDRSGTITYEELKSGLA  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER+E+L+KAFQ+FDKDSSG
Sbjct  425  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLERDEHLFKAFQFFDKDSSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ D ATIKEIISEVD D+DGRINYEEFC MMRSGT+QQ KLF
Sbjct  485  YITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF  541



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  376  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANIDTDNSGTITYEELKTGLA  435

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+HRLER+E+LYKAFQ+FDKDSSG
Sbjct  436  RLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHRLERDEHLYKAFQFFDKDSSG  495

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELETAMK++G+ D A+I+EIISEVD D+DGRINY+EFC MMRSGT Q  KLF
Sbjct  496  YITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF  552



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  376  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANIDTDNSGTITYEELKTGLA  435

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+HRLER+E+LYKAFQ+FDKDSSG
Sbjct  436  RLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHRLERDEHLYKAFQFFDKDSSG  495

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELETAMK++G+ D A+I+EIISEVD D+DGRINY+EFC MMRSGT Q  KLF
Sbjct  496  YITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF  552



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLKAMFTNIDTDNSGTITYEELK GLA
Sbjct  372  AVLSRMKQFRAMNKLKKLALKGIAESLSEEEIKGLKAMFTNIDTDNSGTITYEELKSGLA  431

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER+E+LYKAFQYFDKDSSG
Sbjct  432  RLGSKLSEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLERDEHLYKAFQYFDKDSSG  491

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELE+AMKE+G+ D ATIKEIISEVD D+DGRINYEEFCTMMRSGT Q 
Sbjct  492  FITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCTMMRSGTTQH  544



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTNIDTDNSGTITYEELK GLA
Sbjct  373  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNIDTDNSGTITYEELKSGLA  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNGSIDYIEFITATMH+HRLER+E+LYKAFQ+FD D SG
Sbjct  433  RLGSKLSENEVKQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLYKAFQHFDTDHSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AM E+G+ D ATIKEIISEVD D+DGRINYEEFC MMRSGT  Q KLF
Sbjct  493  FITRDELESAMMEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTAAQGKLF  549



>gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
 gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
Length=293

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLK MFTNIDTDNSGTITYEELK GLA
Sbjct  117  AVLSRMKQFRAMNKLKKLALKVIAENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLA  176

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER+++LYKAFQ+FDKD+SG
Sbjct  177  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSG  236

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC MMRSGT+ Q KLF
Sbjct  237  FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF  293



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  372  AVLSRMKQFRAMNKLKKMALKVIAENLSEEEIKGLKQMFANMDTDNSGTITYEELKTGLA  431

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQYFDKDSSG
Sbjct  432  RLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQYFDKDSSG  491

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AM+EHGI DA+TIKEIISEVDAD+DGRINYEEFC MM+ G +Q  KL 
Sbjct  492  FITRDELESAMEEHGIGDASTIKEIISEVDADNDGRINYEEFCAMMKGGIQQPVKLM  548



>ref|XP_007212312.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
 gb|EMJ13511.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
Length=397

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  221  AVLSRMKQFRAMNKLKQLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  280

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  281  RIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  340

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKEH + D  TI+EIISEVDAD+DGRINY EFC MMRSGT+Q  KLF
Sbjct  341  YITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSEFCAMMRSGTQQPGKLF  397



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEEL++GLA
Sbjct  358  AVLSRMKQFRAMNKLKKLALKVIAENIDSEEIQGLKAMFANIDTDNSGTITYEELREGLA  417

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE+EVKQLMEAADVDGNGSIDYIEFITATMH+HRLE +ENLYKAFQ+FDKD SG
Sbjct  418  KLGSKLTESEVKQLMEAADVDGNGSIDYIEFITATMHRHRLESDENLYKAFQHFDKDGSG  477

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKEI+S+VD+D+DGRINYEEFCTMMRSG  QQP+LF
Sbjct  478  YITIDELEAALKEYGMGDDATIKEILSDVDSDNDGRINYEEFCTMMRSGNPQQPRLF  534



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   306 bits (783),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SG+ITYEELK GLA
Sbjct  362  AVLFRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGSITYEELKTGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQYFDKD SG
Sbjct  422  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQYFDKDHSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKE+G+ D A+IKEIISEVD D+DGRINYEEFCTMMRSG +Q  KL 
Sbjct  482  FITRDELETAMKEYGMGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGMQQPVKLI  538



>ref|XP_009406510.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   305 bits (781),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNK+KK+ALK IAENLSEEEI GLK MFTN+DTD SGTITY+ELK GLA
Sbjct  343  AVLSRMKQFRAMNKMKKMALKVIAENLSEEEIKGLKQMFTNMDTDKSGTITYDELKTGLA  402

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAE+KQLM+AADVDGNGSIDYIEFITATMH+H+LEREE+LY+AFQYFDKD SG
Sbjct  403  RLGSKLSEAEIKQLMDAADVDGNGSIDYIEFITATMHRHKLEREEHLYRAFQYFDKDRSG  462

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITR+ELE+AMK+HG+ DA TIKEIISEVDADHDGRINYEEFC+MMRSG  QQP L 
Sbjct  463  FITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEEFCSMMRSGM-QQPVLL  518



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  357  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLA  416

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER+E+LYKAFQYFDKDSSG
Sbjct  417  RLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSG  476

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DGRINYEEFC MMRSGT+   KLF
Sbjct  477  YITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEEFCAMMRSGTQHAGKLF  533



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  359  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  418

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  419  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  478

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG  QQP+LF
Sbjct  479  YITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQPRLF  535



>gb|AIU98507.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=519

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNK+KK+ALK IAENLSEEEI GLK MFTN+DTD SGTITY+ELK GLA
Sbjct  343  AVLSRMKQFRAMNKMKKMALKVIAENLSEEEIKGLKQMFTNMDTDKSGTITYDELKTGLA  402

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAE+KQLM+AADVDGNGSIDYIEFITATMH+H+LEREE+LY+AFQYFDKD SG
Sbjct  403  RLGSKLSEAEIKQLMDAADVDGNGSIDYIEFITATMHRHKLEREEHLYRAFQYFDKDRSG  462

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITR+ELE+AMK+HG+ DA TIKEIISEVDADHDGRINYEEFC+MMRSG +Q  +L
Sbjct  463  FITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEEFCSMMRSGMQQPVQL  518



>gb|KEH33831.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=538

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLKAMFTN+DTDNSGTITYEELK GL 
Sbjct  355  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIRGLKAMFTNMDTDNSGTITYEELKAGLQ  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER+++LYKAFQYFDKDSSG
Sbjct  415  RLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLERDDHLYKAFQYFDKDSSG  474

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAMKE+G+ D ATIKE       IISEVD DHDGRINYEEFC MMRSG +QQ
Sbjct  475  FITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFCAMMRSGNQQQ  534

Query  257  PKLF  246
             KLF
Sbjct  535  VKLF  538



>gb|ABE72958.1| calcium dependent protein kinase 3 [Medicago truncatula]
Length=538

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLKAMFTN+DTDNSGTITYEELK GL 
Sbjct  355  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIRGLKAMFTNMDTDNSGTITYEELKAGLQ  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER+++LYKAFQYFDKDSSG
Sbjct  415  RLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLERDDHLYKAFQYFDKDSSG  474

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAMKE+G+ D ATIKE       IISEVD DHDGRINYEEFC MMRSG +QQ
Sbjct  475  FITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFCAMMRSGNQQQ  534

Query  257  PKLF  246
             KLF
Sbjct  535  VKLF  538



>emb|CAA65500.1| protein kinase [Medicago sativa]
Length=542

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLKAMFTN+DTDNSGTITYEELK GL 
Sbjct  359  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIRGLKAMFTNMDTDNSGTITYEELKAGLQ  418

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER+++LYKAFQYFDKDSSG
Sbjct  419  RLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLERDDHLYKAFQYFDKDSSG  478

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAMKE+G+ D ATIKE       IISEVD DHDGRINYEEFC MMRSG +QQ
Sbjct  479  FITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFCAMMRSGNQQQ  538

Query  257  PKLF  246
             KLF
Sbjct  539  VKLF  542



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER+E+LYKAFQYFDKDSSG
Sbjct  428  RLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DGRINYEEFC MMRSGT+   KLF
Sbjct  488  YITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEEFCAMMRSGTQHAGKLF  544



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IA++LSEEEI GLKAMF N+DTD SGTITYEELK GLA
Sbjct  367  AVLSRMKQFRAMNKLKKLALKVIAQSLSEEEIKGLKAMFANMDTDKSGTITYEELKSGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER+E+LY AFQYFDKDSSG
Sbjct  427  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLERDEHLYSAFQYFDKDSSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ D ATIKEIISEVD D+DGRINY+EFC MMRSGT+Q  KLF
Sbjct  487  YITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTQQPVKLF  543



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  376  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFHNIDTDNSGTITYEELKSGLA  435

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNGSIDYIEFITATMH+HRLER+E+L+KAFQ+FDKD SG
Sbjct  436  RLGSKLTETEVKQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLFKAFQHFDKDHSG  495

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
            FITRDELE AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC MMRSGT Q Q KLF
Sbjct  496  FITRDELENAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTTQPQQKLF  553



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  423  RIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            +ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC MMRSG   Q
Sbjct  483  YITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQ  535



>gb|KHN35744.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=404

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTD+SGTITYEELK GLA
Sbjct  228  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLA  287

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  288  RIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  347

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC MMRSG   Q +L 
Sbjct  348  YITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQGQLL  404



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  361  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  420

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  421  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  480

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D  TIKE++S+VD+D+DGRINYEEFC MMRSG  QQPKLF
Sbjct  481  YITIDELEVALKEYGMGDDETIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQPKLF  537



>ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica]
Length=397

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  221  AVLSRMKQFRAMNKLKQLALKVIAENLSEEEIKGLKTMFTNMDTDNSGTITYEELKTGLA  280

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  281  RIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  340

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D  TI+EIISEVDAD+DG+INY EFC MMRSGT+Q  KLF
Sbjct  341  YITRDELEAAMKEYGMGDDNTIREIISEVDADNDGKINYSEFCAMMRSGTQQPAKLF  397



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLY+AFQ+FDKD SG
Sbjct  405  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYRAFQHFDKDGSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKEI+S+VDAD+DGRINYEEFC MMRSG  QQP+LF
Sbjct  465  YITIDELEAALKEYGMGDDATIKEILSDVDADNDGRINYEEFCAMMRSGNPQQPRLF  521



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  375  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLA  434

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER+++L+KAFQ+FD D SG
Sbjct  435  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLERDDHLFKAFQFFDTDHSG  494

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT+DELE+AMKE+G+ D ATIKEII+EVD DHDGRINYEEFC MMRSGT+ Q K+F
Sbjct  495  FITKDELESAMKEYGMGDEATIKEIIAEVDTDHDGRINYEEFCAMMRSGTQPQEKIF  551



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER+E+LYKAFQYFDKDSSG
Sbjct  416  RLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DG+INYEEFC MMRSGT+   KLF
Sbjct  476  YITRDELESAMKEYGMGDEATIKEIIAEVDADNDGKINYEEFCAMMRSGTQHAGKLF  532



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score =   303 bits (776),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  363  AVLFRMKQFRAMNKLKKLALKVIAENLSAEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER+E+LYKAFQ+FDKD SG
Sbjct  423  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLERDEHLYKAFQHFDKDQSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKE+G+ D A+I+EIISEVD D+DGRINYEEFCTMMRSG +Q  KLF
Sbjct  483  FITRDELETAMKEYGMGDEASIREIISEVDTDNDGRINYEEFCTMMRSGLQQHAKLF  539



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IA++LSE+EI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  326  AVLSRMKQFRAMNKLKKLALKVIAQSLSEDEIKGLKAMFANMDTDNSGTITYEELKTGLA  385

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+ AFQ+FD D+SG
Sbjct  386  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFGAFQFFDTDNSG  445

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP-KLF  246
            +ITRDELETAMK++G+ D ATI+EIISEVD D+DGRINYEEFCTMMRSGT QQP KLF
Sbjct  446  YITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTTQQPVKLF  503



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  EN+YKAFQ+FDKD SG
Sbjct  405  KLGSRLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENVYKAFQHFDKDGSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKEI+S+VDAD+DGRINY+EFC MMRSG  QQP+LF
Sbjct  465  YITTDELEAALKEYGMGDDATIKEILSDVDADNDGRINYDEFCAMMRSGNPQQPRLF  521



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLS +EI GLK+MF NIDTDNSGTITY+ELK GLA
Sbjct  357  AVLSRMKQFRAMNKLKKMALKVIAENLSSDEIQGLKSMFANIDTDNSGTITYDELKAGLA  416

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLM+AADVDGNG+IDY+EFITATMH+HRLEREE+LYKAFQYFDKD+SG
Sbjct  417  RLGSKLTETEVKQLMDAADVDGNGTIDYLEFITATMHRHRLEREEHLYKAFQYFDKDNSG  476

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMK++ + D ATIKEIISEVDAD+DGRINYEEFCTMM++G + Q KLF
Sbjct  477  FITRDELETAMKDYEMGDDATIKEIISEVDADNDGRINYEEFCTMMKTGNQHQGKLF  533



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  380  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  439

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKDSSG
Sbjct  440  RLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQYFDKDSSG  499

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AM E+G+ D A+IKEIISEVD D+DG+INYEEFCTMMRSG +Q  KLF
Sbjct  500  YITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEEFCTMMRSGVQQPGKLF  556



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER+++L+KAFQYFD D SG
Sbjct  429  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLERDDDLFKAFQYFDTDHSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT+DELE+AMKE+G+ D  TI+EII EVD DHDGRINYEEFC MMRSGT+ Q KLF
Sbjct  489  FITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEEFCAMMRSGTQPQDKLF  545



>gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLS +EI GLK+MF NIDTDNSGTITY+ELK GLA
Sbjct  359  AVLSRMKQFRAMNKLKKMALKVIAENLSNDEIQGLKSMFANIDTDNSGTITYDELKTGLA  418

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLEREE+LYKAFQYFDKD+SG
Sbjct  419  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLEREEHLYKAFQYFDKDNSG  478

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELETAMK+ G+ D ATIKEIISEVD D+DGRINYEEFC MMR+G + Q +LF
Sbjct  479  FITTDELETAMKDFGMGDDATIKEIISEVDTDNDGRINYEEFCAMMRTGNQHQGRLF  535



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MFTNIDTD SGTITYEELK GLA
Sbjct  327  AVLSRMKQFRAMNKLKKMALKVIAENLSEEEIKGLKQMFTNIDTDKSGTITYEELKSGLA  386

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LER+E+LYKAFQYFDKD+SG
Sbjct  387  RLGSRLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLERDEHLYKAFQYFDKDNSG  446

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+AMKEHGI DA+TIKEIISEVD D+DGRINYEEFC MM+ G  QQP
Sbjct  447  FITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEEFCAMMKGGI-QQP  499



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  362  AVLSRLKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKAGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  422  RLGSKLSEAEVKQLMQAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELETAMKE+G+ D A+I+E+ISEVD D+DG+INYEEFCTMMRSGT+Q  K F
Sbjct  482  YITKDELETAMKEYGMGDEASIREVISEVDTDNDGKINYEEFCTMMRSGTQQTGKPF  538



>gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium catenatum]
Length=534

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF+N+DTD SG+ITYEELK GLA
Sbjct  358  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKQMFSNLDTDKSGSITYEELKTGLA  417

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH+H+LER+ENLY AFQYFDKD SG
Sbjct  418  RLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRHKLERDENLYSAFQYFDKDDSG  477

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETA++EHG+ DAATIKEIISEVDAD+DGRINYEEFC MM+SG +Q  K+ 
Sbjct  478  FITRDELETALEEHGMGDAATIKEIISEVDADNDGRINYEEFCAMMKSGLQQPAKII  534



>ref|XP_009388872.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388873.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388874.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  381  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKQMFTNLDTDKSGTITYEELKTGLA  440

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDYIEFITATM++H+LER+E+LY+AFQYFDKD+SG
Sbjct  441  RLGSKLSEAEVKQLMDAADVDGNGSIDYIEFITATMNRHKLERDEHLYRAFQYFDKDNSG  500

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE+AM+EHG+ D ATIKEIISEVD D+DGRINY+EFC MMRSG +Q  KL 
Sbjct  501  FITRDELESAMQEHGMGDIATIKEIISEVDTDNDGRINYQEFCAMMRSGVQQPAKLI  557



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  344  AVLSRMKQFRVMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  403

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKD SG
Sbjct  404  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDGSG  463

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+GI D ATIKEI+S+VD+D+DG+INYEEFC MMRSG  QQP+LF
Sbjct  464  YITIDELEAALKEYGIGDDATIKEILSDVDSDNDGKINYEEFCAMMRSGNPQQPRLF  520



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  384  AVLSRMKQFRAMNKLKQLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  443

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  444  RIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  503

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKEH + D  TI+EIISEVDAD+DGRINY EFC MMRSGT+Q  KLF
Sbjct  504  YITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSEFCAMMRSGTQQPGKLF  560



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTD+SGTITYEELK GLA
Sbjct  353  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLA  412

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  413  RIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  472

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC MMRSG   Q +L 
Sbjct  473  YITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQGQLL  529



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  364  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  424  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG   +QQP+LF
Sbjct  484  YITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRLF  542



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER+++L+KAFQYFD D SG
Sbjct  423  RLGSKLSEVEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLERDDHLFKAFQYFDTDHSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT+DELE+AMKE+G+ D ATIK+II+EVD DHDGRINYEEFC MMRSGT+ Q K F
Sbjct  483  FITKDELESAMKEYGMGDEATIKDIIAEVDTDHDGRINYEEFCAMMRSGTQPQEKKF  539



>ref|XP_010923909.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Elaeis guineensis]
Length=551

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MFTNIDTD SGTITYEELK GLA
Sbjct  375  AVLSRMKQFRAMNKLKKMALKVIAENLSEEEIKGLKQMFTNIDTDKSGTITYEELKSGLA  434

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LER+E+LYKAFQYFDKD+SG
Sbjct  435  RLGSRLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLERDEHLYKAFQYFDKDNSG  494

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+AMKEHGI DA+TIKEIISEVD D+DGRINYEEFC MM+ G  QQP
Sbjct  495  FITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEEFCAMMKGGI-QQP  547



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKL KLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLMKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVK LMEAADVDGNGSIDYIEFI+ATMH+++LER+E+LYKAFQYFDKDSSG
Sbjct  416  RLGSKLSEAEVKNLMEAADVDGNGSIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D ++IKEII+EVDAD+DGRINYEEFC MMRSGT   P L+
Sbjct  476  YITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEEFCAMMRSGTPHAPSLY  532



>ref|XP_004491400.1| PREDICTED: calcium-dependent protein kinase 9-like [Cicer arietinum]
Length=559

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTD SGTITYEEL+ GL 
Sbjct  383  AVLSRMKQFRAMNKLKKLALKVIAENLSSEEIQGLKAMFTNMDTDKSGTITYEELRAGLQ  442

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER+++LYKAFQYFD+D+SG
Sbjct  443  RLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLERDDHLYKAFQYFDRDNSG  502

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELETAMKE+G+ D  TI+EIIS+VD D+DGRINYEEFC MMRSG +QQ KLF
Sbjct  503  FITRDELETAMKEYGMGDEDTIREIISDVDKDNDGRINYEEFCAMMRSGVQQQGKLF  559



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  380  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  439

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKDSSG
Sbjct  440  RLGSRLSETEVKQLMEAADVDGNGAIDYIEFISATMHRYRLERDEHLYKAFQYFDKDSSG  499

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AM E+G+ D A+IKEIISEVD D+DG+INYEEFCTMMR G +Q  KLF
Sbjct  500  YITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEEFCTMMRRGVQQPGKLF  556



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  423  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            +IT DELE+A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG   +QQP+LF
Sbjct  483  YITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRLF  541



>emb|CAN60225.1| hypothetical protein VITISV_039919 [Vitis vinifera]
Length=467

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  291  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKSGLA  350

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAF YFDKD+SG
Sbjct  351  RLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFNYFDKDNSG  410

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFCTMMRSGT+   KLF
Sbjct  411  FITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFCTMMRSGTQPPVKLF  467



>ref|XP_004231610.1| PREDICTED: calcium-dependent protein kinase 2-like [Solanum lycopersicum]
Length=527

 Score =   300 bits (768),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  351  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLA  410

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER+++L+KAFQYFD D SG
Sbjct  411  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLERDDDLFKAFQYFDTDHSG  470

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT+DELE+AMKE+G+ D  TI+EII EVD DHDGRINYEEFC MMRSGT+ Q K F
Sbjct  471  FITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEEFCAMMRSGTQPQDKPF  527



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS+EEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  349  AVLSRMKQFRAMNKLKKLALKVIAENLSKEEIQGLKAMFTNMDTDKSGTITYEELKDGLA  408

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLM+AADVDG+G+IDYIEFITATMH+HRLEREENLYKAFQYFDKDSSG
Sbjct  409  RLGSKLSETEVRQLMDAADVDGDGTIDYIEFITATMHRHRLEREENLYKAFQYFDKDSSG  468

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELE AM+EH + D +TIK+II+EVD D+DGRINYEEFC MMR+G+ QQ
Sbjct  469  FITRDELEAAMQEHNVGDQSTIKDIIAEVDTDNDGRINYEEFCNMMRTGSTQQ  521



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  367  AVLSRMKQFRAMNKLKQLALKVIAENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  427  RIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKEHG+ D  TI+EIISEVDAD+DGRINY EFC MMRSG +Q  KLF
Sbjct  487  YITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPAKLF  543



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 163/184 (89%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLK+MFTN+DTDNSGTITYEELK GL 
Sbjct  365  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIRGLKSMFTNMDTDNSGTITYEELKAGLQ  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER+++LYKAFQYFDKD+SG
Sbjct  425  RLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLERDDHLYKAFQYFDKDNSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIIS-------EVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAMKE+G+ D ATIKEIIS       EVD DHDGRINYEEFC MMRSG + Q
Sbjct  485  FITRDELETAMKEYGMGDDATIKEIISEVDTIIFEVDTDHDGRINYEEFCAMMRSGNQPQ  544

Query  257  PKLF  246
             KLF
Sbjct  545  VKLF  548



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKL KLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLMKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEV+ LMEAADVDGNGSIDYIEFI+ATMH+++LEREE+LYKAFQYFDKDSSG
Sbjct  416  RLGSKLSEAEVENLMEAADVDGNGSIDYIEFISATMHRYKLEREEHLYKAFQYFDKDSSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D ++IKEII+EVDAD+DGRINYEEFC MMRSGT   P L+
Sbjct  476  YITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEEFCAMMRSGTPPAPSLY  532



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  362  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  422  RIGSKLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AM ++G+ D ATIKEIISEVDAD+DGRINYEEFC MMRSG   Q +L 
Sbjct  482  YITRDELEIAMTQNGMGDEATIKEIISEVDADNDGRINYEEFCAMMRSGMPHQGQLL  538



>ref|XP_008804309.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Phoenix 
dactylifera]
Length=538

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  362  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQMFINMDTDKSGTITYEELKTGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH++RLER+E+LY+AFQYFDKD+SG
Sbjct  422  RLGSRLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRNRLERDEHLYRAFQYFDKDNSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+AMKEHGI DA+TIKEIISE+D D+DGRINYEEFC MM+ G +Q  KL
Sbjct  482  FITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEEFCAMMKGGIQQPVKL  537



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  E+LYKAFQ+FDKD SG
Sbjct  405  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNESLYKAFQHFDKDGSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC MMRSG  QQP+LF
Sbjct  465  YITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFCAMMRSGNPQQPRLF  521



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSG+ITYEELK+GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGSITYEELKEGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  423  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            +IT DELE+A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG   +QQP+LF
Sbjct  483  YITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRLF  541



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  338  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKSGLA  397

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAF YFDKD+SG
Sbjct  398  RLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFNYFDKDNSG  457

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFCTMMRSGT+   KLF
Sbjct  458  FITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFCTMMRSGTQPPVKLF  514



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLK MFTNIDTDNSGTITYEELK GLA
Sbjct  353  AVLSRMKQFRAMNKLKKLALKVIAENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLA  412

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER+++LYKAFQ+FDKD+SG
Sbjct  413  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSG  472

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC MMRSGT+ Q KLF
Sbjct  473  FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF  529



>emb|CBI26637.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  155  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNMDTDKSGTITYEELKSGLA  214

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER+E+L+KAFQYFDKDSSG
Sbjct  215  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLERDEHLFKAFQYFDKDSSG  274

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC+MMR GT+Q  K+F
Sbjct  275  FITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFCSMMRGGTQQGLKVF  331



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  363  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKDSSG
Sbjct  423  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRIN+EEFC MMRSG   +QQP+LF
Sbjct  483  YITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINHEEFCAMMRSGNPQQQQPRLF  541



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  362  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENLYKAFQ+FDKD SG
Sbjct  422  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDGSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG   +QQP+LF
Sbjct  482  YITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRLF  540



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKSGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAF YFDKD+SG
Sbjct  429  RLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFNYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFCTMMRSGT+   KLF
Sbjct  489  FITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFCTMMRSGTQPPVKLF  545



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  370  AVLSRMKQFRAMNKLKQLALKVIAENLSEEEIKGLKTMFANMDTDNSGTITYEELKTGLA  429

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  430  RIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  489

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKEHG+ D  TI+EIISEVDAD+DG+INY EFC MMRSGT+Q   LF
Sbjct  490  YITRDELEAAMKEHGMGDDNTIREIISEVDADNDGKINYSEFCAMMRSGTQQPAMLF  546



>gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum hybrid cultivar]
Length=531

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  773  VXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLAQ  594
            V SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA+
Sbjct  356  VLSRMKQFRAMNKLKKMALKVIAENLSEEEIKGLKQMFTNMDTDKSGTITYEELKTGLAR  415

Query  593  LGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSGF  414
            LG+ L+EAEVKQLMEAADVDGNGSIDYIEFITATMH+HRLER+E+L+KAFQYFDKD+SGF
Sbjct  416  LGSKLSEAEVKQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLFKAFQYFDKDNSGF  475

Query  413  ITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            ITRDELE AMKEHG+ D +TIK+IISEVD+D+DGRINY+EFC MM+ G +Q  KL
Sbjct  476  ITRDELELAMKEHGLGDDSTIKDIISEVDSDNDGRINYDEFCAMMKGGAQQPLKL  530



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNK KKLALK +AENLSEEEI GLKAMF N+DTD+SGTITYEELK GLA
Sbjct  363  AVLSRMKQFRAMNKFKKLALKVMAENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  423  RIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITR+ELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC MMRSG   Q  LF
Sbjct  483  HITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQGPLF  539



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  E+LYKAFQ+FDKD SG
Sbjct  405  KLGSKLTETEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNESLYKAFQHFDKDGSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC MMRSG  QQP+LF
Sbjct  465  YITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFCAMMRSGNPQQPRLF  521



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQLRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  428  RIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +ITRDELE AMKEHG+ D  TIKEIISEVDAD+DGRINY EFCTMMRSG + 
Sbjct  488  YITRDELEAAMKEHGMGDDNTIKEIISEVDADNDGRINYTEFCTMMRSGNQP  539



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAE LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKMALKVIAEALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  428  RLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFCTMMRSGT Q  KL 
Sbjct  488  YITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGTPQPAKLI  544



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  336  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  395

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  ENL KAFQ+FDKD SG
Sbjct  396  KLGSKLTETEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNENLDKAFQHFDKDGSG  455

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT DELE A+KE+G+ D  TIKEI+S+VDAD+DGRINYEEFC MMRSG  QQP+LF
Sbjct  456  YITIDELEAALKEYGMGDDTTIKEILSDVDADNDGRINYEEFCAMMRSGNPQQPRLF  512



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLK+LALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  367  AVLSRMKQSRAMNKLKQLALKVIAENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER+E+LYKAFQYFDKDSSG
Sbjct  427  RIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKEHG+ D  TI+EIISEVDAD+DGRINY EFC MMRSG +Q  KLF
Sbjct  487  YITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPAKLF  543



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAE LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKMALKVIAEALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  428  RLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFCTMMRSGT Q  KL 
Sbjct  488  YITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGTPQPAKLI  544



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAE LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKMALKVIAEALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  428  RLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFCTMMRSGT Q  KL 
Sbjct  488  YITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGTPQPAKLI  544



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTD+SGTITYEEL+ GL 
Sbjct  350  AVLSRMKQFRAMNKLKKLALKVIAENLSVEEIQGLKAMFTNMDTDHSGTITYEELRAGLQ  409

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER+E+LY AFQYFDKD SG
Sbjct  410  RLGSKLTEAEVRQLMDAADVDGNGTIDYIEFITATMHRHRLERDEHLYGAFQYFDKDGSG  469

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ D ATIK+IISEVD D+DGRINYEEF TMMRSGT QQ KLF
Sbjct  470  YITRDELETAMKENGMGDEATIKDIISEVDTDNDGRINYEEFSTMMRSGT-QQGKLF  525



>gb|EAZ40006.1| hypothetical protein OsJ_24444 [Oryza sativa Japonica Group]
Length=454

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  277  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYEELKAGLA  336

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  337  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  396

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC MMR G  QQP
Sbjct  397  FITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGGMQQP  450



>ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=551

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  375  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKVMFRNMDTDKSGTITYEELKTGLA  434

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQ+FDKDSSG
Sbjct  435  RLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFQHFDKDSSG  494

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE+AMKE+G+ D ATIKEIISEVD D+DGRINYEEFC MMRSG +Q  KLF
Sbjct  495  YITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGIQQAEKLF  551



>gb|AAP03014.1| seed calcium dependent protein kinase c [Glycine max]
Length=537

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLKAMFTN+DTD SGTITYEELK GL 
Sbjct  354  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKAMFTNMDTDKSGTITYEELKSGLH  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER++ L+KAFQYFDKD+SG
Sbjct  414  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLERDDQLFKAFQYFDKDNSG  473

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGRINYEEF  MM+SG +QQ
Sbjct  474  FITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFSAMMKSGNQQQ  533

Query  257  PKLF  246
             KLF
Sbjct  534  GKLF  537



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKKLALK IAE  SEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  349  AVLTRMKQFRAMNKLKKLALKVIAETFSEEEIKGLKQMFANMDTDGSGTITYEELKTGLA  408

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LEREENLY AFQYFDKD+SG
Sbjct  409  RLGSKLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLEREENLYGAFQYFDKDNSG  468

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAM+EHG+ DAATIKEII EVD D+DGRINYEEFC MMRSG  Q 
Sbjct  469  FITRDELETAMEEHGVGDAATIKEIILEVDTDNDGRINYEEFCAMMRSGLPQP  521



>ref|NP_001235641.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
 gb|AAB80693.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
Length=538

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLKAMFTN+DTD SGTITYEELK GL 
Sbjct  355  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKAMFTNMDTDKSGTITYEELKSGLH  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER++ L+KAFQYFDKD+SG
Sbjct  415  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLERDDQLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGRINYEEF  MM+SG +QQ
Sbjct  475  FITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFSAMMKSGNQQQ  534

Query  257  PKLF  246
             KLF
Sbjct  535  GKLF  538



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  367  AVLSRLKQFRAMNKLKKLALKVIAENLSEEEIKGLKVMFTNMDTDKSGTITYEELKTGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R+E LYKAFQYFDKD+SG
Sbjct  427  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDRDELLYKAFQYFDKDNSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELETAMKE+G+ D A+I+ +ISEVD D+DGRINYEEFCTMMRSGT+Q  K F
Sbjct  487  YITKDELETAMKEYGMVDEASIRAVISEVDTDNDGRINYEEFCTMMRSGTQQTEKAF  543



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNK KKLALK +AENLSEEEI GLKAMF N+DTD SGTITYEELK GLA
Sbjct  382  AVLSRMKQFRAMNKFKKLALKVMAENLSEEEIKGLKAMFANMDTDGSGTITYEELKSGLA  441

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+E EVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  442  RIGSRLSEPEVKQLMEAADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  501

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITR+ELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC MMRSG   Q +LF
Sbjct  502  HITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQAQLF  558



>gb|ACJ61504.1| calcium-dependent protein kinase [Glycine max]
 gb|KHM99562.1| Calcium-dependent protein kinase isoform 2 [Glycine soja]
Length=551

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLKAMFTN+DTD SGTITYEELK GL 
Sbjct  368  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKAMFTNMDTDKSGTITYEELKSGLH  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER++ L+KAFQYFDKD+SG
Sbjct  428  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLERDDQLFKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGRINYEEF  MM+SG +QQ
Sbjct  488  FITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFSAMMKSGNQQQ  547

Query  257  PKLF  246
             KLF
Sbjct  548  GKLF  551



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKAMFTNMDTDKSGTITYEELKSGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATM +HRLER+E+LYKAF YFDKD+SG
Sbjct  429  RLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMRRHRLERDEHLYKAFNYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFCTMMRSGT+   KLF
Sbjct  489  FITRDELENAMKEYGMGDGDSIKEIINEVDTDKDGRINYKEFCTMMRSGTQPPVKLF  545



>gb|KDP20751.1| hypothetical protein JCGZ_21222 [Jatropha curcas]
Length=562

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IA+NLSEEEI GLKAMF+N+DTD SGTITYEELK GLA
Sbjct  392  AVLSRMKQFRAMNKLKKLALKVIAKNLSEEEIKGLKAMFSNMDTDKSGTITYEELKTGLA  451

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+++LER+E+LYKAFQYFDKDSSG
Sbjct  452  RLGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSG  511

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +ITRDELE++MKE+G+ D A+IKEIISEVD D+DGRINYEEFCTMMRSG +
Sbjct  512  YITRDELESSMKEYGMGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGVQ  562



>emb|CAA57157.1| calcium-dependent protein kinase [Oryza sativa Japonica Group]
 gb|EAZ04052.1| hypothetical protein OsI_26188 [Oryza sativa Indica Group]
Length=533

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC MMR G  QQP
Sbjct  476  FITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGGMQQP  529



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEE+I G KAMF N+DTD SG+ITY+ELKKGLA
Sbjct  413  AVLSRMKQFRAMNKLKKLALKVIAENMSEEDIMGFKAMFANMDTDKSGSITYDELKKGLA  472

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            QLG+ LTEAEVKQLMEAADVDGNG+IDY EFITATM++HRLE +ENL KAF+YFDKD+SG
Sbjct  473  QLGSKLTEAEVKQLMEAADVDGNGTIDYTEFITATMNRHRLETDENLSKAFRYFDKDNSG  532

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELE AM E+GIAD ++IKEI+SEVD D+DGRINYEEFCTMMRSGT QQ KLF
Sbjct  533  FITMDELEVAMMEYGIADESSIKEILSEVDTDNDGRINYEEFCTMMRSGTTQQVKLF  589



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLAL+ IAE+LSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  381  AVLSRMKQFRAMNKLKKLALRVIAEDLSEEEIKGLKAMFENIDTDNSGTITYEELKSGLA  440

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LT  EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQ FDKD SG
Sbjct  441  RLGSKLTGTEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFKAFQNFDKDHSG  500

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
            FITRDELE AMKE+G+ D  TIKEII+EVD D+DGRINYEEFC MMRSGT Q Q KLF
Sbjct  501  FITRDELENAMKEYGMGDETTIKEIIAEVDTDNDGRINYEEFCAMMRSGTTQPQQKLF  558



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC MMR G  QQP
Sbjct  476  FITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGGMQQP  529



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMF N+DTDNSGTITYEELK GLA
Sbjct  364  AVLSRMKQFRAMNKLKKLALKIIAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLA  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            ++G+ L+E EVKQLME ADVDGNGSIDY+EFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  424  RIGSRLSETEVKQLMELADVDGNGSIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG  270
             ITR+ELETAM +HG+ D ATIK+IISEVD DHDGRINYEEFC MMRSG
Sbjct  484  HITREELETAMTQHGMGDEATIKDIISEVDTDHDGRINYEEFCAMMRSG  532



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 160/184 (87%), Gaps = 7/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLKAMFTN+DTD SG ITYEELK GL 
Sbjct  368  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKAMFTNMDTDKSGAITYEELKAGLH  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER++ L+KAFQYFDKD+SG
Sbjct  428  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLERDDQLFKAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            FITRDELETAMKE+G+ D ATIKE       IISEVD DHDGRINYEEF  MM+SG +QQ
Sbjct  488  FITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFSAMMKSGNQQQ  547

Query  257  PKLF  246
             KLF
Sbjct  548  GKLF  551



>ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula]
Length=1052

 Score =   305 bits (782),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLKAMFTN+DTD SGTITYEEL+ GL 
Sbjct  390  AVLSRMKQFRAMNKLKKLALKVIAENLSSEEIQGLKAMFTNMDTDKSGTITYEELRAGLQ  449

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  450  RLGSKLTEAEVRQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQYFDKDNSG  509

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPK  252
            FITRDELETAMKE+G+ D  TI+EIISEVD D+DGRINYEEFCTMMRSG +QQ K
Sbjct  510  FITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEEFCTMMRSGVQQQGK  564



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLS++EI GLK MF N+DTD SGTITYEELK GLA
Sbjct  368  AVLSRMKQFRAMNKLKKMALKVIAENLSKDEIKGLKQMFINMDTDKSGTITYEELKAGLA  427

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH HRLER+E+LY+AFQYFDKD+SG
Sbjct  428  RLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHWHRLERDEHLYRAFQYFDKDNSG  487

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+AMKEHGI DA+TIKEIISE+D D+DGRINYEEFC MM+ G +Q  +L
Sbjct  488  FITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEEFCAMMKGGMQQPVEL  543



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMNKLKKLALK IAENLSEEEI GLK MFTN+DTD SGTITYEELK GLA
Sbjct  366  AVLSRLKQFRAMNKLKKLALKVIAENLSEEEIKGLKVMFTNMDTDKSGTITYEELKTGLA  425

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R+E LYKAFQYFDKD+SG
Sbjct  426  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDRDELLYKAFQYFDKDNSG  485

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELETAMKE+G+ D A+I+ +ISEVD D+DGRINYEEFCTMMR GT+Q  K F
Sbjct  486  YITKDELETAMKEYGMGDEASIRAVISEVDTDNDGRINYEEFCTMMRGGTQQTEKAF  542



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKDSSG
Sbjct  416  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDSSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC MMR G  Q P+L
Sbjct  476  FITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGV-QPPRL  530



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +R+KQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITY ELK GLA
Sbjct  344  AVFTRLKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNMDTDKSGTITYAELKSGLA  403

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+++LE+EE+LYKAFQ+FDKD+SG
Sbjct  404  RLGSTLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRYKLEKEEHLYKAFQHFDKDNSG  463

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDEL+ AMK++G+ D  TI+EIISEVDAD+DGRINY+EFC+MMRSGT QQ KLF
Sbjct  464  YITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDEFCSMMRSGT-QQAKLF  519



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 ref|XP_004172987.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +R+KQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITY ELK GLA
Sbjct  344  AVFTRLKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNMDTDKSGTITYAELKSGLA  403

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+++LE+EE+LYKAFQ+FDKD+SG
Sbjct  404  RLGSTLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRYKLEKEEHLYKAFQHFDKDNSG  463

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDEL+ AMK++G+ D  TI+EIISEVDAD+DGRINY+EFC+MMRSGT QQ KLF
Sbjct  464  YITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDEFCSMMRSGT-QQAKLF  519



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 5/182 (3%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  358  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  417

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE +ENLYKAFQ+FDKD SG
Sbjct  418  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESDENLYKAFQHFDKDGSG  477

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK-----QQPK  252
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG       QQP+
Sbjct  478  YITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQQQQPR  537

Query  251  LF  246
            LF
Sbjct  538  LF  539



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 5/182 (3%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  350  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  409

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE +ENLYKAFQ+FDKD SG
Sbjct  410  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESDENLYKAFQHFDKDGSG  469

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK-----QQPK  252
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG       QQP+
Sbjct  470  YITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQQQQPR  529

Query  251  LF  246
            LF
Sbjct  530  LF  531



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  360  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNMDTDKSGTITYEELKSGLA  419

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER+E+L+KAFQYFDKDSSG
Sbjct  420  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLERDEHLFKAFQYFDKDSSG  479

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC+MMR GT+Q  K+F
Sbjct  480  FITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFCSMMRGGTQQGLKVF  536



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF+N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFSNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDG+GSIDY+EFITATMH+H+LER+E+L+KAFQYFDKDSSG
Sbjct  415  KLGSKLSEAEVKQLMDAADVDGSGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDSSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELETA+ EH + D  TIK+IISEVD D+DGRINY+EFC MMR G +QQP
Sbjct  475  FITRDELETALIEHEMGDTDTIKDIISEVDTDNDGRINYDEFCAMMRGGIQQQP  528



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITY+ELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYDELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FITRDELE+A+ EH + D +TIK+IISEVD ++DGRINYEEFC MMR G  QQP
Sbjct  476  FITRDELESALIEHEMGDTSTIKDIISEVDTNNDGRINYEEFCAMMRGGGMQQP  529



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  415  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  475  FITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRL  530



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLSEEEI GLKAMFTN+DTD SGTITYEELK GLA
Sbjct  360  AVLSRMKQFRAMNKLKKLALKVIAENLSEEEIQGLKAMFTNMDTDKSGTITYEELKSGLA  419

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER+E+L+K FQYFDKDSSG
Sbjct  420  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLERDEHLFKPFQYFDKDSSG  479

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC+MMR GT+Q  K+F
Sbjct  480  FITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFCSMMRGGTQQGLKVF  536



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  415  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  475  FITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRL  530



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  364  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAF++FDKDSSG
Sbjct  424  RLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLERDEHLYKAFKHFDKDSSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
            +ITRDELETAMKE+G+ D  +I+E+I+EVD D+DGRINY+EFC MMRSGT Q Q KLF +
Sbjct  484  YITRDELETAMKEYGMGDEDSIREVIAEVDTDNDGRINYQEFCAMMRSGTTQPQGKLFPI  543



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITY+ELK GLA
Sbjct  361  AVLSRMKQFRRMNKLKQLALKVIAENLSTEEIQGLKQMFANIDTDNSGTITYDELKNGLA  420

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  421  RLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSG  480

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELETAMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT QQ +LF
Sbjct  481  YITRDELETAMKEYGMGDNDTIKEIISEVDTDNDGKINYEEFRDMMRSGT-QQGQLF  536



>ref|XP_007146477.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
 gb|ESW18471.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
Length=459

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 160/184 (87%), Gaps = 8/184 (4%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+S EEI GLKAMFTN+DTD SGTITYEELK GL 
Sbjct  277  AVLSRMKQFRAMNKLKKLALKVIAENMSAEEIQGLKAMFTNMDTDKSGTITYEELKAGLH  336

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER++ L+KAFQYFDKD+SG
Sbjct  337  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLERDDQLFKAFQYFDKDNSG  396

Query  416  FITRDELETAMKEHGIADAATIKE-------IISEVDADHDGRINYEEFCTMMRSGTKQQ  258
            +ITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGRINYEEF  MM+SG  QQ
Sbjct  397  YITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGRINYEEFSAMMKSGN-QQ  455

Query  257  PKLF  246
             KLF
Sbjct  456  CKLF  459



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  352  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  411

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE +ENLYKAFQ+FDKD SG
Sbjct  412  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESDENLYKAFQHFDKDGSG  471

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG  270
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG
Sbjct  472  YITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSG  520



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  337  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  396

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  397  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  456

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TI+EIISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  457  FITRDELESALIEHEMGDTSTIREIISEVDTDNDGRINYEEFCAMMRGGMQQPMRL  512



>gb|KFK28778.1| hypothetical protein AALP_AA7G046400 [Arabis alpina]
Length=502

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  318  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIRGLKTMFANMDTDKSGTITYEELKTGLA  377

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R+ENL+KAFQYFDKD+SG
Sbjct  378  KLGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDRDENLFKAFQYFDKDNSG  437

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+ MKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSGT   QQ KLF 
Sbjct  438  FITMDELESTMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQPQQGKLFP  497

Query  242  LTL  234
              L
Sbjct  498  SPL  500



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN++ EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  360  AVLSRMKQFRAMNKLKKLALKVIAENINTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  419

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE +ENLYKAFQ+FDKD SG
Sbjct  420  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESDENLYKAFQHFDKDGSG  479

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG  270
            +IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC MMRSG
Sbjct  480  YITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFCAMMRSG  528



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E L+KAFQYFDKD+SG
Sbjct  415  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEYLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  475  FITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRL  530



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   294 bits (753),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAENLS EEI GLK MFTNIDTDNSGTITYEELK GLA
Sbjct  353  AVLSRMKQFRAMNKLKKLALKVIAENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLA  412

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER+++LYKAFQ+FDKD+SG
Sbjct  413  RLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSG  472

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPK  252
            FIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC MMRSGT+ Q K
Sbjct  473  FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAK  527


 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 90/187 (48%), Gaps = 44/187 (24%)
 Frame = -2

Query  674  LKAMFTNIDTDNSGTITYEE----LKKG--------------------LAQLGANLTEAE  567
            +K + + +DTDN G I Y+E    ++ G                    +  + AN+   E
Sbjct  494  IKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKSQEYRLTAVPFAVRIPWIFANIRVVE  553

Query  566  V------------------KQLMEAADVDGNGSIDYIEFITATMHKHRLEREEN--LYKA  447
                               +Q       D +G I Y EF      +   +R++   + + 
Sbjct  554  ASLSDEEFNSITTKNSSNHQQPYRKFGSDSDGRISYEEFCATIAMRLAFDRDQRFKVTEL  613

Query  446  FQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            F +  +    FIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC MMRSGT
Sbjct  614  FSFSLQCLYRFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGT  673

Query  266  KQQPKLF  246
            + Q KLF
Sbjct  674  QPQAKLF  680



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGMQQPIRL  531



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGMQQPIRL  531



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGMQQPIRL  531



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score =   290 bits (742),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  415  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  475  FITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRL  530



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   290 bits (742),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGMQQPIRL  531



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGPKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  +L
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGMQQPIRL  531



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  365  AVLSRMKQFRAMNKLKKLALKVIAENMSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E+EVKQLMEAADVDGNG+IDYIEFI+AT H++R+ER+++LYKAFQYFDKD+SG
Sbjct  425  RLGSKLSESEVKQLMEAADVDGNGTIDYIEFISATTHRYRMERDDHLYKAFQYFDKDNSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
            +ITRDELETAMKE+G+ D A+I+E+I+EVD D+DGRINYEEFC MMRSG+ Q + KLF
Sbjct  485  YITRDELETAMKEYGMGDEASIREVIAEVDTDNDGRINYEEFCAMMRSGSTQPEGKLF  542



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGT TYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTFTYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  249
            FITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC MMR G +Q  KL
Sbjct  476  FITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFCAMMRGGIQQPIKL  531



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITY+ELK GLA
Sbjct  349  AVLSRMKQFRRMNKLKQLALKVIAENLSTEEIQGLKQMFANIDTDNSGTITYDELKNGLA  408

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  409  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSG  468

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT QQ +LF
Sbjct  469  HITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRAMMRSGT-QQGQLF  524



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITYEELK GLA
Sbjct  362  AVLSRMKQFRRMNKLKQLALKVIAENLSSEEIQGLKQMFANIDTDNSGTITYEELKTGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  422  RLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT Q  +LF
Sbjct  482  YITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRDMMRSGT-QHTQLF  537



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITYEELK GLA
Sbjct  362  AVLSRMKQFRRMNKLKQLALKVIAENLSSEEIQGLKQMFANIDTDNSGTITYEELKTGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  422  RLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT Q  +LF
Sbjct  482  YITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRDMMRSGT-QHTQLF  537



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  377  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  436

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+SG
Sbjct  437  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSG  496

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSGT   QQ KL  
Sbjct  497  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQPQQGKLLP  556

Query  242  L  240
            +
Sbjct  557  I  557



>ref|XP_010439398.1| PREDICTED: calcium-dependent protein kinase 15-like [Camelina 
sativa]
Length=560

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  379  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  438

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+SG
Sbjct  439  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSG  498

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSGT   QQ KL  
Sbjct  499  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQPQQGKLLP  558

Query  242  L  240
            +
Sbjct  559  I  559



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITY+ELK GLA
Sbjct  349  AVLSRMKQFRRMNKLKQLALKVIAENLSTEEIQGLKQMFANIDTDNSGTITYDELKNGLA  408

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  409  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSG  468

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT QQ +LF
Sbjct  469  HITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRAMMRSGT-QQGQLF  524



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEE+I GLKAMF N+DTD SGTITYEELK GLA
Sbjct  316  AVLSRMKQFRAMNKLKRLALKVIAENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLA  375

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE +E+LYKAFQ+FDKD+SG
Sbjct  376  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSG  435

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC MMRSG + Q KLF
Sbjct  436  FITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFCAMMRSGNQHQGKLF  492



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMN+LKKLALK IAENLS EEI GLKAMF NIDTD SG+ITYEELK+GLA
Sbjct  351  AVLSRLKQFRAMNQLKKLALKVIAENLSAEEIQGLKAMFKNIDTDESGSITYEELKEGLA  410

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  411  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLERDEDLYKAFQYFDKDNSG  470

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELE AMK++ + D A+IK+IISEVD D+DG+INY+EFC MMR G  Q  KLF
Sbjct  471  FITMDELEAAMKDYRMGDEASIKQIISEVDTDNDGKINYDEFCAMMRGGAPQTAKLF  527



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  375  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  434

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+SG
Sbjct  435  RLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSG  494

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+AMK++G+ D A+IKEII+EVD D+DGRINYEEFC MMRSGT   QQ KL  
Sbjct  495  FITMDELESAMKKYGMGDEASIKEIIAEVDTDNDGRINYEEFCAMMRSGTTQPQQGKLLP  554

Query  242  L  240
             
Sbjct  555  F  555



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  389  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLA  448

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R+E+L+KAFQYFDKD+SG
Sbjct  449  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSG  508

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            FIT DELE+AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC MMRSGT Q
Sbjct  509  FITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQ  560



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IA++LSEEEI GLKAMF N+DTD SGTITYEELK GLA
Sbjct  362  AVLSRMKQFRAMNKLKKLALKVIAQSLSEEEIKGLKAMFANMDTDKSGTITYEELKSGLA  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFITATMH+H+LE++E+L+ AFQ+FDKDSSG
Sbjct  422  RLGSKLSETEVKQLMEAADVDGNGTIDYIEFITATMHRHKLEKDEHLFGAFQFFDKDSSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP-KLF  246
            +ITRDEL++AMKE+G+ D ATI+EIISEVD D+DG+INYEEFC MMRSGT Q   KLF
Sbjct  482  YITRDELKSAMKEYGMGDEATIEEIISEVDTDNDGKINYEEFCAMMRSGTTQPAVKLF  539



>emb|CDX79112.1| BnaA01g11790D [Brassica napus]
Length=563

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  379  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLA  438

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R+E+L+KAFQYFDKD+SG
Sbjct  439  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSG  498

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            FIT DELE+AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC MMRSGT Q
Sbjct  499  FITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQ  550



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMN++KKLALK IA N SEE+I GLKAMFTN+DTDNSGTIT+EELK GLA
Sbjct  370  AVLSRMKQFRAMNEMKKLALKVIATNFSEEDIKGLKAMFTNMDTDNSGTITFEELKSGLA  429

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER+++L+KAFQYFDKD SG
Sbjct  430  RLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLERDDHLHKAFQYFDKDGSG  489

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            +IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFCTMMRS ++   KLF
Sbjct  490  YITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFCTMMRSKSQHPEKLF  546



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAENLSEE+I GLKAMF N+DTD SGTITYEELK GLA
Sbjct  367  AVLSRMKQFRAMNKLKRLALKVIAENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE +E+LYKAFQ+FDKD+SG
Sbjct  427  RLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC MMRSG + Q KLF
Sbjct  487  FITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFCAMMRSGNQHQGKLF  543



>ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
 gb|EOA16344.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
Length=559

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E++ KAFQYFDKD+SG
Sbjct  429  KLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVSKAFQYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLF  246
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSGT   QQ KL 
Sbjct  489  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQPQQGKLL  547



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  388  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLA  447

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R+E+L+KAFQYFDKD+SG
Sbjct  448  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSG  507

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            FIT DEL++AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC MMRSGT Q
Sbjct  508  FITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQ  559



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  373  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLA  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R+E+L+KAFQYFDKD+SG
Sbjct  433  RLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            FIT DEL++AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC MMRSGT Q
Sbjct  493  FITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFCAMMRSGTTQ  544



>gb|KCW66998.1| hypothetical protein EUGRSUZ_F007612, partial [Eucalyptus grandis]
Length=170

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  755  QFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLAQLGANLT  576
            QFRAMNKLK+LALK IAENLSEE+I GLKAMF N+DTD SGTITYEELK GLA+LG+ LT
Sbjct  1    QFRAMNKLKRLALKVIAENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLARLGSKLT  60

Query  575  EAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSGFITRDEL  396
            EAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE +E+LYKAFQ+FDKD+SGFIT DE+
Sbjct  61   EAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSGFITMDEI  120

Query  395  ETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC MMRSG + Q KLF
Sbjct  121  ETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFCAMMRSGNQHQGKLF  170



>ref|XP_006413708.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
 gb|ESQ55161.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
Length=218

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 157/174 (90%), Gaps = 2/174 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  17   AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLA  76

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEF++ATMH++ ++R+E+L+KAFQYFDKD+SG
Sbjct  77   KLGSKLSEAEVKQLMEAADVDGNGTIDYIEFMSATMHRY-IDRDEHLFKAFQYFDKDNSG  135

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQ  258
            FIT DELE+AMKE+ + D A+IKEII+EVD D+DGRINYEEFC MMRSG TK Q
Sbjct  136  FITMDELESAMKEYDMGDEASIKEIIAEVDTDNDGRINYEEFCAMMRSGNTKPQ  189



>ref|NP_193925.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 sp|O49717.1|CDPKF_ARATH RecName: Full=Calcium-dependent protein kinase 15 [Arabidopsis 
thaliana]
 emb|CAA17161.1| calcium-dependent protein kinase - like protein [Arabidopsis 
thaliana]
 emb|CAB79149.1| calcium-dependent protein kinase-like protein [Arabidopsis thaliana]
 gb|AAK59500.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAL34178.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE84532.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=554

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  373  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLA  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+SG
Sbjct  433  KLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSG    QQ K+  
Sbjct  493  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGITLPQQGKILP  552

Query  242  L  240
            +
Sbjct  553  V  553



>emb|CAD70165.1| calcium-dependent protein kinase [Landoltia punctata]
Length=548

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAE+LSEEEI GL+ MF N+DTD SGTITYEELK GLA
Sbjct  373  AVLSRMKQFRAMNKLKKMALKVIAESLSEEEIKGLRQMFQNMDTDQSGTITYEELKTGLA  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVDGNGSIDYIEFITATMH+H+LEREE+LY AF YFDKD+SG
Sbjct  433  RLGSRLSEAEVKQLMDAADVDGNGSIDYIEFITATMHRHKLEREEHLYSAFSYFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            +ITRDEL+ A++EHG+ DA +I+EIISEVD D+DGRINY+EFC MMRSGT
Sbjct  493  YITRDELKQALEEHGMGDADSIREIISEVDTDNDGRINYDEFCAMMRSGT  542



>ref|NP_001190794.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 gb|AEE84533.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=561

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  373  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLA  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+SG
Sbjct  433  KLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT--KQQPKLFD  243
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSG    QQ K+  
Sbjct  493  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGITLPQQGKILP  552



>gb|AAQ17506.1| calcium dependent protein kinase 3 [Oryza sativa Japonica Group]
Length=527

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MFTN+DTDNSGTITYEELK GLA
Sbjct  356  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFTNMDTDNSGTITYEELKAGLA  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  416  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMM  279
            FITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC MM
Sbjct  476  FITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFCAMM  521



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+SEE+I G KAMF N+DTDNSG+ITY+ELKKGLA
Sbjct  367  AVLSRMKQFRAMNKLKKLALKVIAENMSEEDIKGFKAMFDNMDTDNSGSITYDELKKGLA  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDY EFITATM++HRLE +ENL KAF+YFDKD+SG
Sbjct  427  ELGSKLTETEVKQLMEAADVDGNGTIDYTEFITATMNRHRLETDENLLKAFRYFDKDNSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            FIT DELE+ M E+GIAD ++IKEI+SEVD D+DG+INY+EFC MM+SGT  Q KLF
Sbjct  487  FITMDELESEMMEYGIADESSIKEILSEVDTDNDGKINYDEFCAMMKSGTTAQVKLF  543



>ref|XP_002869856.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46115.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  369  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  428

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L EAEVKQLMEAADVDGNG+IDYIEFI+ TMH++RL+R+E+L+KAFQYFDKD+SG
Sbjct  429  KLGSKLNEAEVKQLMEAADVDGNGTIDYIEFISVTMHRYRLDRDEHLFKAFQYFDKDNSG  488

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG  270
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSG
Sbjct  489  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSG  537



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GL 
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLT  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  405  RLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSGT Q Q KLF  
Sbjct  465  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLFPF  524



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            GAV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL
Sbjct  357  GAVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGL  416

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
             +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+S
Sbjct  417  TRLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDRDEHVYKAFQHFDKDNS  476

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQPKLFD  243
            G ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSG T+ Q KL  
Sbjct  477  GHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQNKLLP  536

Query  242  L  240
             
Sbjct  537  F  537



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  767  SRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLAQLG  588
            SRMKQFRAMNKLK+LALK IAENLSEE+I GLKAMF N+DTD SGTITYEELK GLA+LG
Sbjct  377  SRMKQFRAMNKLKRLALKVIAENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLARLG  436

Query  587  ANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSGFIT  408
            + LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE +E+LYKAFQ+FDKD+SGFIT
Sbjct  437  SKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSGFIT  496

Query  407  RDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC MMRSG + Q KLF
Sbjct  497  MDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFCAMMRSGNQHQGKLF  550



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITY+ELK GLA
Sbjct  361  AVLSRMKQFRRMNKLKQLALKVIAENLSREEIQGLKQMFANIDTDNSGTITYDELKTGLA  420

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  421  RLGSKLTETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLERDEDLYKAFQHFDKDNSG  480

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT Q  +LF
Sbjct  481  HITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRDMMRSGT-QHGQLF  536



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  351  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  410

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKDSSG
Sbjct  411  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDSSG  470

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSG T+ Q KL   
Sbjct  471  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQGKLLPF  530



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  354  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  414  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  473

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSGT Q Q KL   
Sbjct  474  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF  533



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  354  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  414  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  473

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSGT Q Q KL   
Sbjct  474  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF  533



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENLS EEI GLK MF NIDTDNSGTITY+ELK GLA
Sbjct  361  AVLSRMKQFRRMNKLKQLALKVIAENLSTEEIQGLKQMFANIDTDNSGTITYDELKTGLA  420

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER+E+LYKAFQ+FDKD+SG
Sbjct  421  RLGSKLTETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLERDEDLYKAFQHFDKDNSG  480

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
             ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF  MMRSGT Q  +LF
Sbjct  481  HITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFRDMMRSGT-QHGQLF  536



>gb|KCW75309.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=536

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMN++KKLALK IA N SEE+I GLKAMFTN+DTDNSGTIT+EELK GLA
Sbjct  363  AVLSRMKQFRAMNEMKKLALKVIATNFSEEDIKGLKAMFTNMDTDNSGTITFEELKSGLA  422

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER+++L+KAFQYFDKD SG
Sbjct  423  RLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLERDDHLHKAFQYFDKDGSG  482

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRS  273
            +IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFCTMMRS
Sbjct  483  YITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFCTMMRS  530



>gb|KCW75310.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=543

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMN++KKLALK IA N SEE+I GLKAMFTN+DTDNSGTIT+EELK GLA
Sbjct  370  AVLSRMKQFRAMNEMKKLALKVIATNFSEEDIKGLKAMFTNMDTDNSGTITFEELKSGLA  429

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER+++L+KAFQYFDKD SG
Sbjct  430  RLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLERDDHLHKAFQYFDKDGSG  489

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRS  273
            +IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFCTMMRS
Sbjct  490  YITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFCTMMRS  537



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GL 
Sbjct  340  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLT  399

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  400  RLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  459

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSGT Q Q KL   
Sbjct  460  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF  519



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  351  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  410

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  411  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  470

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSG T+ Q KL   
Sbjct  471  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQGKLLPF  530



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GL 
Sbjct  355  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLT  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  415  RLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC MMRSGT Q Q KL   
Sbjct  475  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF  534



>ref|XP_006828852.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKKLALK IAENLSEEEI GLK MF N+DTD SGTITYEEL+ GL 
Sbjct  365  AVLTRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQMFKNMDTDGSGTITYEELRAGLN  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLM+AADVD +GSIDYIEFITATMH+HRLEREENLYKAFQYFD D+SG
Sbjct  425  RLGSRLSEAEVKQLMDAADVDRSGSIDYIEFITATMHRHRLEREENLYKAFQYFDTDNSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMR  276
            FITRDELE AMK++G+ D ATIKE+I EVD D+DGRINY+EF  MMR
Sbjct  485  FITRDELEIAMKDYGMGDDATIKEVIQEVDTDNDGRINYQEFVAMMR  531



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  356  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  415

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  416  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  475

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DG+IN+EEFC MMRSG T+ Q KL   
Sbjct  476  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLLPF  535



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  354  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  414  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  473

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG-TKQQPKLFDL  240
             ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DG+IN+EEFC MMRSG T+ Q KL   
Sbjct  474  HITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLLPF  533



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  761  MKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLAQLGAN  582
            MKQFRAMNKLK+LALK IAENLSEE+I GLKAMF N+DTD SGTITYEELK GLA+LG+ 
Sbjct  364  MKQFRAMNKLKRLALKVIAENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLARLGSK  423

Query  581  LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSGFITRD  402
            LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE +E+LYKAFQ+FDKD+SGFIT D
Sbjct  424  LTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSGFITMD  483

Query  401  ELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  246
            E+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC MMRSG + Q KLF
Sbjct  484  EIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFCAMMRSGNQHQGKLF  535



>ref|XP_010100127.1| Calcium-dependent protein kinase 29 [Morus notabilis]
 gb|EXB81510.1| Calcium-dependent protein kinase 29 [Morus notabilis]
Length=526

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR++QFRAMNK+KKLALK +AENLSEEEIHGLK MF N+DTD SGTIT+EELK GL+
Sbjct  352  AVLSRIRQFRAMNKMKKLALKVMAENLSEEEIHGLKQMFNNMDTDGSGTITFEELKTGLS  411

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAE++QLMEAADVD NGSIDYIEFITATMH+HRLER+ENL+KAFQYFDKD SG
Sbjct  412  KLGSKLSEAEIRQLMEAADVDHNGSIDYIEFITATMHRHRLERDENLFKAFQYFDKDGSG  471

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FITR+EL  AM +HG+ D ATI EII++VD D DGRINYEEF  MMR GT+
Sbjct  472  FITREELRQAMTQHGMGDEATIDEIINDVDTDKDGRINYEEFVAMMRKGTQ  522



>ref|XP_010501945.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=582

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAEN+  EEI GLKAMF NIDTDNSGTITYEELK+GLA
Sbjct  345  AVLSRMKQFRAMNKLKKLALKVIAENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLA  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE  E+LYKAFQ+FDKD SG
Sbjct  405  KLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLESNESLYKAFQHFDKDGSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMR  276
            +IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC M R
Sbjct  465  YITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFCAMXR  511



>ref|XP_002869854.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46113.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTITYEELK GLA
Sbjct  683  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLA  742

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R+E+++KAFQYFDKD+S 
Sbjct  743  KLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSW  802

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSG  270
            FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC MMRSG
Sbjct  803  FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSG  851


 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRA+NKLKKLALK IAE+LSEEEI GLK MFTN+DTD SGTI+YEELK GLA
Sbjct  479  AVLSRMKQFRAVNKLKKLALKVIAESLSEEEIKGLKTMFTNMDTDKSGTISYEELKTGLA  538

Query  596  QLGANLTEAEVKQLMEAADV  537
            +LG+ LTEAEVKQLMEA  +
Sbjct  539  KLGSKLTEAEVKQLMEAVSI  558



>ref|XP_004957848.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Setaria italica]
Length=559

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 158/204 (77%), Gaps = 28/204 (14%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IA NL+EEEI GLK MF N+DTDNSGTITYEELK GLA
Sbjct  355  AVLSRMKQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLA  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKD+SG
Sbjct  415  KLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADH---------------------------  318
            FITRDELE+A+ EH + D +TIKEIISEVD D+                           
Sbjct  475  FITRDELESALIEHEMGDTSTIKEIISEVDTDNVSCLHYRLFCCITCIPSIFLMLVICLS  534

Query  317  -DGRINYEEFCTMMRSGTKQQPKL  249
             DGRINYEEFC MMR G +Q  +L
Sbjct  535  QDGRINYEEFCAMMRGGMQQPMRL  558



>ref|XP_011083439.1| PREDICTED: calcium-dependent protein kinase 29 [Sesamum indicum]
Length=524

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLSEEEI GL+ MF N+DTD SGTITYEEL+ GL+
Sbjct  344  AVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLRQMFNNMDTDGSGTITYEELRTGLS  403

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAE+KQLMEAADVD NG+IDYIEFITATMH+HRLE+EENLYKAFQYFDKD+SG
Sbjct  404  KLGSKLSEAEIKQLMEAADVDKNGTIDYIEFITATMHRHRLEKEENLYKAFQYFDKDNSG  463

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            +ITRDEL  AM+++G+ D ATI E++ +VD D DGRINYEEF  MM+ GT
Sbjct  464  YITRDELRHAMQQYGMGDEATIDEVLDDVDTDKDGRINYEEFAAMMKKGT  513



>gb|KFK30982.1| hypothetical protein AALP_AA6G053400 [Arabis alpina]
Length=481

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V SR+KQFRAM+K KKLALK IAE LSEEEI GLK MF  +DTDNSG+ITYEELK GLA
Sbjct  301  VVLSRLKQFRAMSKFKKLALKVIAEGLSEEEIKGLKKMFEEMDTDNSGSITYEELKTGLA  360

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER+E+LYKAFQYFDKD+SG
Sbjct  361  KLGSKLSEDEVKQLMEAADVDGNGTIDYIEFISATMHRHRLERDEHLYKAFQYFDKDNSG  420

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT-KQQPKLFDL  240
             IT++ELE AMKEHG+ D A  KEIISEVD D+DG+I+YEEFC MMR+G    Q KL  +
Sbjct  421  HITKEELEIAMKEHGMGDEANAKEIISEVDKDNDGKIDYEEFCAMMRNGNLHPQGKLLGM  480



>ref|XP_004164365.1| PREDICTED: calcium-dependent protein kinase 3-like [Cucumis sativus]
Length=304

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  125  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLP  184

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNGSIDYIEFITATMH +R+ERE++L+KAF+YFDKD SG
Sbjct  185  KLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNRVEREDHLFKAFEYFDKDKSG  244

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELETA+K++ + D  TIKEII+EVD D+DGRINY+EF  MMR G ++
Sbjct  245  YITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYDEFVAMMRKGNQE  296



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALKFIA+NL EEE+ GLK MF NIDTD SGTITYEELK GL 
Sbjct  373  AVLSRMKQLRAMNKLKKLALKFIAQNLKEEELKGLKTMFANIDTDKSGTITYEELKTGLE  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+EREENL+KAFQ+FDKD+SG
Sbjct  433  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVEREENLFKAFQHFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK-QQPKL  249
            FITR ELETAMKE+ + D A IKEII EVDAD+DG INY+EFC MM+S ++ +Q KL
Sbjct  493  FITRQELETAMKEYNMGDDAMIKEIILEVDADNDGSINYQEFCNMMKSCSQSRQSKL  549



>emb|CDP12100.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  221  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  280

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LY+AF+YFDKD SG
Sbjct  281  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVEREDHLYRAFEYFDKDKSG  340

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPK  252
            +IT +ELE A+KE+ + D  TIKEII+EVD DHDGRINY+EF  MMR G  + P+
Sbjct  341  YITMEELEHALKEYNMGDEKTIKEIIAEVDTDHDGRINYDEFVAMMRKGQPEMPQ  395



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFR MNKLKKLALK IAENL +EEI GLK MF N+DTD SG+ITYEEL++GLA
Sbjct  357  AVLLRMKQFRVMNKLKKLALKVIAENLPDEEIQGLKQMFANMDTDGSGSITYEELREGLA  416

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVK LMEAAD DG+GSIDY EFITATMH++RLER+E+LYKAFQYFDKD+SG
Sbjct  417  RLGSKLTETEVKALMEAADQDGSGSIDYYEFITATMHRYRLERDEHLYKAFQYFDKDNSG  476

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP  255
            FIT DELETAMKE+GIAD   I EI+ EVD D+DGRINY+EF  MMRSGT Q P
Sbjct  477  FITTDELETAMKEYGIADENCIAEILLEVDTDNDGRINYDEFSAMMRSGT-QNP  529



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDN+GTITYEELK GL 
Sbjct  349  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIMGLKEMFKSMDTDNNGTITYEELKAGLP  408

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EVKQLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  409  KLGTKLSESEVKQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSG  468

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+KE+ + DA TIKEII+EVD DHDGRINYEEF  MMR G  +
Sbjct  469  YITMEELEHALKEYNMGDARTIKEIIAEVDTDHDGRINYEEFVAMMRKGNPE  520



>ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALKFIA+NL EEE+ GLK MF N+DTD SGTITYEELK GL 
Sbjct  373  AVLSRMKQLRAMNKLKKLALKFIAQNLKEEELKGLKTMFANMDTDKSGTITYEELKTGLE  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+EREENL+KAFQ+FDKD+SG
Sbjct  433  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVEREENLFKAFQHFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC MMRS +K
Sbjct  493  FISRQELETAMKEYNMGDDTMIKEIISEVDADNDGSINYQEFCNMMRSCSK  543



>ref|NP_177731.2| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
 gb|AAM13021.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AAN15720.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AEE35788.1| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
Length=323

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
             AV  RMKQFRAMNKLKKLALK IAENLSEEEI GLK  F N+DTD SGTIT++EL+ GL
Sbjct  144  SAVLVRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQTFKNMDTDESGTITFDELRNGL  203

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
             +LG+ LTE+E+KQLMEAADVD +G+IDYIEF+TATMH+HRLE+EENL +AF+YFDKD S
Sbjct  204  HRLGSKLTESEIKQLMEAADVDKSGTIDYIEFVTATMHRHRLEKEENLIEAFKYFDKDRS  263

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK-QQPKLF  246
            GFITRDEL+ +M E+G+ D ATI E+I++VD D+DGRINYEEF  MMR GT    PKL 
Sbjct  264  GFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEEFVAMMRKGTTDSDPKLI  322



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALKFIA+NL EEE+ GLK MF N+DTD SGTITYEELK GL 
Sbjct  367  AVLSRMKQLRAMNKLKKLALKFIAQNLKEEELKGLKTMFANMDTDKSGTITYEELKSGLE  426

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+EREENL+KAFQ+FDKD+SG
Sbjct  427  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVEREENLFKAFQHFDKDNSG  486

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FI+R ELETAMKE+ + D A IKEIISEVDAD+DG INY+EFC MM+S ++
Sbjct  487  FISRLELETAMKEYNMGDDAMIKEIISEVDADNDGSINYQEFCNMMKSCSQ  537



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 5/178 (3%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLA     +NLSEEEI GLKAMF NIDTDNSGTITYEELK GLA
Sbjct  381  AVLSRMKQFRAMNKLKKLA----LKNLSEEEIKGLKAMFDNIDTDNSGTITYEELKSGLA  436

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER+E+L+KAFQ+FDKD SG
Sbjct  437  RLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLERDEHLFKAFQHFDKDHSG  496

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
            FITRDELE AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC MMRSGT Q Q KLF
Sbjct  497  FITRDELENAMKEYGMGDEATIKEIITEVDTDNDGRINYEEFCAMMRSGTTQPQQKLF  554



>ref|XP_004238385.1| PREDICTED: calcium-dependent protein kinase 29 [Solanum lycopersicum]
Length=521

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMNK+KKLALK IAENLSE+EI GLK MF N+DTD SGTITYEELK GL+
Sbjct  345  AVLSRLKQFRAMNKMKKLALKVIAENLSEDEIKGLKQMFNNMDTDGSGTITYEELKTGLS  404

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE+E+KQLM+AADVD +G+IDYIEFITATMH+H+LEREENLYKAFQ+FDKDSSG
Sbjct  405  RLGSKLTESEIKQLMDAADVDNSGTIDYIEFITATMHRHKLEREENLYKAFQFFDKDSSG  464

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITRDEL  AM+E+G+ D ATI EI+ +VD + DG INY+EF  MMR GT
Sbjct  465  FITRDELRHAMEEYGMGDEATIDEILDDVDTNKDGLINYDEFVAMMRRGT  514



>ref|XP_011003084.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Populus euphratica]
Length=523

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V  RMKQFRAMNKLKKLALK IAENLSEEEI GL+ MF N+DTD SGTITYEELK GL+
Sbjct  354  VVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLRQMFNNMDTDRSGTITYEELKSGLS  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE E+KQLM+ ADVD +G+IDY+EFITATMH+HRLE+EENLYKAFQYFDKD++G
Sbjct  414  RLGSKLTEVEIKQLMDGADVDNSGTIDYVEFITATMHRHRLEKEENLYKAFQYFDKDNNG  473

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF TMMR G+
Sbjct  474  FITRDELRQAMSQYGMGDEATIDEVIKDVDTDKDGNINYEEFATMMRKGS  523



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFR MNKLK+LALK IAENL EEEI GLK MF N+DTD SG+ITYEELK+GLA
Sbjct  359  AVLSRMKQFRVMNKLKQLALKVIAENLPEEEIQGLKQMFANMDTDGSGSITYEELKEGLA  418

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVK LM+AAD DG+GSIDYIEFIT TMH++RLER++ LYKAFQYFDKD+SG
Sbjct  419  RLGSKLSETEVKALMDAADQDGSGSIDYIEFITVTMHRYRLERDDQLYKAFQYFDKDNSG  478

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQP--KLF  246
            FIT DELE AM+E+GIAD   IK+I+ EVD D+DGRIN+EEF  MMRSGT Q P  KLF
Sbjct  479  FITTDELEAAMREYGIADENCIKDILMEVDTDNDGRINFEEFVAMMRSGT-QNPGAKLF  536



>gb|KFK40633.1| hypothetical protein AALP_AA2G022000 [Arabis alpina]
Length=551

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALKFIA+NL EEE+ GLK MF N+DTD SGTITY+ELK GL 
Sbjct  374  AVLSRMKQLRAMNKLKKLALKFIAQNLKEEELKGLKTMFANMDTDKSGTITYDELKTGLE  433

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+ERE+NL+KAFQ+FDKD+SG
Sbjct  434  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVEREDNLFKAFQHFDKDNSG  493

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK-QQPKL  249
            FITR ELETAMKE+ + D A I+EIISEVDAD+DG INY+EFC MM+S +K  Q KL
Sbjct  494  FITRQELETAMKEYNMGDDAMIREIISEVDADNDGSINYQEFCNMMKSCSKSHQSKL  550



>ref|XP_002306955.1| hypothetical protein POPTR_0005s26640g [Populus trichocarpa]
 gb|EEE93951.1| hypothetical protein POPTR_0005s26640g [Populus trichocarpa]
Length=513

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V  RMKQFRAMNKLKKLALK IAENLSEEEI GL+ MF N+DTD SGTITYEELK GL 
Sbjct  346  VVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLRQMFNNMDTDRSGTITYEELKSGLL  405

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE E+KQLM+ ADVD NG+IDY+EFITATMH+HRLE+EENLYKAFQYFDKD+SG
Sbjct  406  RLGSKLTEVEIKQLMDGADVDNNGTIDYVEFITATMHRHRLEKEENLYKAFQYFDKDNSG  465

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMR  276
            FITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF TMMR
Sbjct  466  FITRDELRQAMSQYGMGDEATIDEVIEDVDTDKDGNINYEEFATMMR  512



>gb|KDP36877.1| hypothetical protein JCGZ_08168 [Jatropha curcas]
Length=519

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SR+KQFRAMNKLKKLALK IAENLSEEEI GLK MF NID D SGTITYEELK GLA
Sbjct  347  AVQSRLKQFRAMNKLKKLALKVIAENLSEEEIQGLKQMFNNIDIDRSGTITYEELKAGLA  406

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAE+KQLM+AADVD +G+IDY+EFI ATMH+H+LE+EE+LY+AFQYFDKD+SG
Sbjct  407  RLGSKLTEAEIKQLMDAADVDNSGTIDYVEFIAATMHRHKLEKEEHLYRAFQYFDKDNSG  466

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FITRDEL  AM ++G+ D ATI EII +VD + DG INYEEF  MMR GT+
Sbjct  467  FITRDELREAMAQYGMGDEATIDEIIDDVDTNKDGLINYEEFVEMMRKGTQ  517



>ref|XP_011003085.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Populus euphratica]
Length=523

 Score =   266 bits (681),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V  RMKQFRAMNKLKKLALK IAENLSEEEI GL+ MF N+DTD SGTITYEELK GL+
Sbjct  354  VVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLRQMFNNMDTDRSGTITYEELKSGLS  413

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE E+KQLM+ ADVD +G+IDY+EFITATMH+HRLE+EENLYKAFQYFDKD++G
Sbjct  414  RLGSKLTEVEIKQLMDGADVDNSGTIDYVEFITATMHRHRLEKEENLYKAFQYFDKDNNG  473

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            +ITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF TMMR G+
Sbjct  474  YITRDELRQAMSQYGMGDEATIDEVIKDVDTDKDGNINYEEFATMMRKGS  523



>ref|XP_002874810.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51069.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V SRMKQFRAMNKLKKLALK IAE LSEEEI GLK MF N+DTD +G+ITYEELK GL 
Sbjct  315  VVLSRMKQFRAMNKLKKLALKVIAEGLSEEEIKGLKTMFENMDTDKNGSITYEELKTGLN  374

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            + G+ L+E EV+QLMEAADVDGNG+IDYIEFI+ATM +HRLER+E+L+KAFQ+FDKD+SG
Sbjct  375  RHGSKLSETEVRQLMEAADVDGNGTIDYIEFISATMQRHRLERDEHLHKAFQHFDKDNSG  434

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
            +IT+DELE AMKEHG+ D A  KEIISEVD ++DG+I+YEEFCTMMR+G  Q Q KL 
Sbjct  435  YITKDELEIAMKEHGMGDEANAKEIISEVDKNNDGKIDYEEFCTMMRNGNLQPQGKLL  492



>gb|KHN35055.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=373

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  194  AVLSRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  253

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  ++E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  254  KLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSG  313

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE+A+K++ + D  TIKEII+EVDAD+DGRINY+EF  MMR G  
Sbjct  314  YITVEELESALKKYNMGDEKTIKEIIAEVDADNDGRINYDEFVAMMRKGNP  364



>emb|CDX94570.1| BnaC09g22660D [Brassica napus]
Length=742

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            G V SR+KQFRAMNKLKKLALK IAE LSEEEI  LK MF ++DTD SG+ITYEELK GL
Sbjct  288  GVVLSRLKQFRAMNKLKKLALKVIAEGLSEEEIRSLKTMFESMDTDKSGSITYEELKTGL  347

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
             +LG+ L EAEVKQLMEAADVDGNG+IDY EFITATMH+HRLER+E+L+KAF +FDKD+S
Sbjct  348  NRLGSKLPEAEVKQLMEAADVDGNGTIDYTEFITATMHRHRLERDEHLHKAFLHFDKDNS  407

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRS  273
            G+IT+DEL+ AMKEHG+ D A +KEIISEVD D+DGRINYEEFC MMRS
Sbjct  408  GYITKDELDIAMKEHGMGDEACVKEIISEVDKDNDGRINYEEFCAMMRS  456


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  743  MNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLAQLGANLTEAEV  564
            MNKLKK+AL  +A+NLSEEEI GLK  F NI+TD SGT+T EELK+ L  LG+ ++E EV
Sbjct  662  MNKLKKVALTVMAKNLSEEEIKGLKTTFNNINTDKSGTVTPEELKRCLTTLGSKVSETEV  721

Query  563  KQLMEAA  543
            KQL+EA 
Sbjct  722  KQLIEAG  728



>ref|XP_008221211.1| PREDICTED: calcium-dependent protein kinase 29 [Prunus mume]
Length=534

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLAL  IAENLSEEEIHGLK MF NIDTD SG+IT+EELK GLA
Sbjct  357  AVLIRMKQFRAMNKLKKLALMVIAENLSEEEIHGLKQMFNNIDTDRSGSITFEELKTGLA  416

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E E+KQLM+AAD+D NG+IDY EFITATMH+H+LE+EENL+KAFQ+FDKD SG
Sbjct  417  RLGSKLSETEIKQLMDAADIDKNGTIDYTEFITATMHRHKLEKEENLFKAFQFFDKDQSG  476

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FITRDEL  AM ++G+ D ATI EII +VD D DGRINYEEF  MMR G +
Sbjct  477  FITRDELRQAMTQYGMGDDATIDEIIDDVDTDKDGRINYEEFAAMMRQGVQ  527



>ref|XP_007222396.1| hypothetical protein PRUPE_ppa004027mg [Prunus persica]
 gb|EMJ23595.1| hypothetical protein PRUPE_ppa004027mg [Prunus persica]
Length=534

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLAL  IAENLSEEEIHGLK MF NIDTD SG+IT+EELK GL 
Sbjct  357  AVLIRMKQFRAMNKLKKLALMVIAENLSEEEIHGLKQMFNNIDTDGSGSITFEELKTGLT  416

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E E+KQLM+AAD+D NG+IDY EFITATMH+H+LE+EENLYKAFQ+FDKD SG
Sbjct  417  RLGSKLSETEIKQLMDAADIDKNGTIDYTEFITATMHRHKLEKEENLYKAFQFFDKDQSG  476

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FITRDEL  AM ++G+ D ATI EII +VD D DGRINYEEF  MMR G +
Sbjct  477  FITRDELRQAMTQYGMGDDATIDEIIDDVDTDKDGRINYEEFVAMMRQGVQ  527



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score =   273 bits (698),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF NIDTD SGTITYEELK GL 
Sbjct  693  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLT  752

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R+E++YKAFQ+FDKD+SG
Sbjct  753  RLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSG  812

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLF  246
             ITRDELE+AMKE+G+ D A+I+E+ISEVD D+DG+IN+EEFC MMRSG+ Q Q KL 
Sbjct  813  HITRDELESAMKEYGMGDEASIREVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLL  870



>gb|KHN16773.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=249

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMK FRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  68   AVLTRMKHFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  127

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E+EV+QLMEAAD+DGNG+IDYIEFITATMH +R+ERE+ LYKAF+YFD D SG
Sbjct  128  KLGSKLSESEVRQLMEAADIDGNGTIDYIEFITATMHMNRMEREDRLYKAFEYFDNDKSG  187

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE+A+K++ + D  TIKEII+EVD+D+DGRINY+EF  MMR G  
Sbjct  188  YITMEELESALKKYNMGDEKTIKEIIAEVDSDNDGRINYDEFVAMMRKGNP  238



>ref|XP_006342079.1| PREDICTED: calcium-dependent protein kinase 29-like [Solanum 
tuberosum]
Length=540

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +R+KQFRAMNK+KKLALK IAENLSE+EI GLK MF N+DTD SGTITY+ELK GL+
Sbjct  364  AVLTRLKQFRAMNKMKKLALKVIAENLSEDEIKGLKQMFNNMDTDGSGTITYDELKTGLS  423

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E+E+KQLM+AADVD +G+IDYIEFITATMH+H+LEREENLYKAFQ+FDKDSSG
Sbjct  424  RLGSKLSESEIKQLMDAADVDNSGTIDYIEFITATMHRHKLEREENLYKAFQFFDKDSSG  483

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITRDEL  AM+E+G+ D ATI EI+ +VD + DG INYEEF  MMR GT
Sbjct  484  FITRDELRHAMEEYGMGDEATIDEILDDVDTNKDGLINYEEFAAMMRRGT  533



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLKAMF ++DTDNSGTITYEELK GL 
Sbjct  355  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIMGLKAMFKSMDTDNSGTITYEELKAGLP  414

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EVKQLMEAADVDGNG+IDY+EFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  415  KLGTKLSESEVKQLMEAADVDGNGTIDYLEFITATMHLNRVEREDHLYKAFEYFDKDKSG  474

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K++ + D  TIKEII+EVD DHDGRINY+EF  MMR G  
Sbjct  475  YITMEELEHALKKYNMGDEKTIKEIIAEVDTDHDGRINYDEFVAMMRKGNP  525



>ref|XP_006386161.1| hypothetical protein POPTR_0002s01850g [Populus trichocarpa]
 gb|ERP63958.1| hypothetical protein POPTR_0002s01850g [Populus trichocarpa]
Length=542

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLSEEEI GLK MF N+DTD SGTITY+ELK GL+
Sbjct  365  AVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQMFNNMDTDESGTITYDELKSGLS  424

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+  E+KQLM+AADVD +G+IDY+EFITATMH+HRLE EENLYKAFQYFDKD SG
Sbjct  425  RLGSKLSGVEIKQLMDAADVDKSGTIDYLEFITATMHRHRLEMEENLYKAFQYFDKDGSG  484

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FI+RDEL  AM ++G+ D ATI E+I +VD D DG+INYEEF +MMR GT+
Sbjct  485  FISRDELRQAMAQYGMGDDATINEVIEDVDTDKDGKINYEEFASMMRKGTQ  535



>ref|XP_008387908.1| PREDICTED: calcium-dependent protein kinase 29 [Malus domestica]
Length=527

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLSEEEIHGLK MF NIDTD SG+IT EELK GLA
Sbjct  350  AVLIRMKQFRAMNKLKKLALKVIAENLSEEEIHGLKEMFNNIDTDGSGSITLEELKTGLA  409

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE E+KQLM+AAD+D NG+IDY EFITATMH+H+LE+EENLYKAF +FDKD SG
Sbjct  410  RLGSKLTETEIKQLMDAADIDKNGTIDYTEFITATMHRHKLEKEENLYKAFLFFDKDQSG  469

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +ITRDEL  AM E+G+ D ATI+EI+ +VD D DGRINYEEF  MMR G +
Sbjct  470  YITRDELRQAMTEYGMGDDATIEEILDDVDTDKDGRINYEEFEAMMRKGVQ  520



>sp|Q9ZSA3.2|CDPKM_ARATH RecName: Full=Calcium-dependent protein kinase 22 [Arabidopsis 
thaliana]
Length=498

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
             V SRMKQFRAMNKLKKLALK IAE LSEEEI GLK MF N+D D SG+ITYEELK GL 
Sbjct  317  VVLSRMKQFRAMNKLKKLALKVIAEGLSEEEIKGLKTMFENMDMDKSGSITYEELKMGLN  376

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            + G+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER+E+LYKAFQYFDKD SG
Sbjct  377  RHGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMHRHRLERDEHLYKAFQYFDKDGSG  436

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ-QPKLFDL  240
             IT++E+E AMKEHG+ D A  K++ISE D ++DG+I+YEEFCTMMR+G  Q Q KL  +
Sbjct  437  HITKEEVEIAMKEHGMGDEANAKDLISEFDKNNDGKIDYEEFCTMMRNGILQPQGKLVGI  496

Query  239  TL  234
             +
Sbjct  497  HI  498



>ref|XP_006413705.1| hypothetical protein EUTSA_v10027200mg, partial [Eutrema salsugineum]
 gb|ESQ55158.1| hypothetical protein EUTSA_v10027200mg, partial [Eutrema salsugineum]
Length=334

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKKLALK IAE+LSEEEI GLK MF N+DTD SGTIT EELK GLA
Sbjct  173  AVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMDTDQSGTITNEELKTGLA  232

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+EAEVKQLMEAADVDGNG+IDYIEF++ATMH++R++R+E+L+KAFQYFDKD+S 
Sbjct  233  KLGSKLSEAEVKQLMEAADVDGNGTIDYIEFMSATMHRYRVDRDEHLFKAFQYFDKDNSR  292

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEF  291
            FIT DELE+AMKE+ + D A+IKEII+EVD D+DGRINYEEF
Sbjct  293  FITMDELESAMKEYDMGDEASIKEIIAEVDTDNDGRINYEEF  334



>ref|XP_010430219.1| PREDICTED: calcium-dependent protein kinase 19 [Camelina sativa]
Length=482

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLALKFIA+NL EEE+ GLK MF N+DTD SGTITY+ELK GL 
Sbjct  300  AVLSRMKQLRAMNKLKKLALKFIAQNLKEEELKGLKTMFANMDTDKSGTITYDELKSGLE  359

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+EREENL+KAFQ+FDKD+SG
Sbjct  360  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVEREENLFKAFQHFDKDNSG  419

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMM  279
            FI+R ELETAMKE+ + D A IKEIISEVDAD+DG INY+EFC MM
Sbjct  420  FISRHELETAMKEYNMGDDAMIKEIISEVDADNDGSINYQEFCNMM  465



>emb|CBI34415.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +R+KQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTITYEELK GL 
Sbjct  220  AVLTRVKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITYEELKNGLP  279

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFI+ATMH +R+ERE++LY+AF+YFDKD SG
Sbjct  280  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNRMEREDHLYRAFEYFDKDKSG  339

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K + + D  TIKEII+EVD DHDGRINYEEF  MMR G  
Sbjct  340  YITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFAAMMRKGNP  390



>gb|EYU17566.1| hypothetical protein MIMGU_mgv1a004597mg [Erythranthe guttata]
Length=518

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAEN+SEEEI GL+ MF N+DTD SGTITYEEL+ GL+
Sbjct  339  AVLIRMKQFRAMNKLKKLALKVIAENMSEEEIKGLRQMFNNMDTDGSGTITYEELRTGLS  398

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E+E++QLMEAADVD NG+IDYIEFITATMH+HRL++EENLYKAFQYFDKD+SG
Sbjct  399  KLGSKLSESEIQQLMEAADVDKNGTIDYIEFITATMHRHRLDKEENLYKAFQYFDKDNSG  458

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITRDEL  AM ++GI D  TI E++ +VD D DGRINY+EF  MM+ GT
Sbjct  459  FITRDELRQAMTQYGIGDEETIDEVLDDVDIDKDGRINYDEFKAMMKKGT  508



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  341  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLP  400

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+EREE+LYKAF+YFDKD+SG
Sbjct  401  KLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSG  460

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF  MMR G  
Sbjct  461  YITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFAAMMRKGNP  511



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  341  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLP  400

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+EREE+LYKAF+YFDKD+SG
Sbjct  401  KLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSG  460

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF  MMR G  
Sbjct  461  YITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFAAMMRKGNP  511



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  341  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLP  400

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+EREE+LYKAF+YFDKD+SG
Sbjct  401  KLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSG  460

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF  MMR G  
Sbjct  461  YITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFAAMMRKGNP  511



>ref|XP_009114553.1| PREDICTED: calcium-dependent protein kinase 22 [Brassica rapa]
Length=480

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  779  GAVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            G V SR+KQFRAMNKLKKLALK IAE LSEEEI  LK MF ++DTD SG+ITYEELK GL
Sbjct  302  GVVLSRLKQFRAMNKLKKLALKVIAEGLSEEEIRSLKTMFESMDTDKSGSITYEELKTGL  361

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
             +LG+ L EAEVKQLMEAADVDGNG+IDYIEFI+ATM +HRLER+E+L+KAF +FDKD+S
Sbjct  362  NRLGSKLPEAEVKQLMEAADVDGNGTIDYIEFISATMQRHRLERDEHLHKAFLHFDKDNS  421

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRS  273
            G+IT+DELE AMKEHG+ D A  KEIISE+D ++DG+I+YEEFC MMRS
Sbjct  422  GYITKDELEIAMKEHGMGDEACAKEIISEIDKNNDGKIDYEEFCAMMRS  470



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDN+GTIT+EELK GL 
Sbjct  336  AVLTRMKQFRAMNKLKKIALKVIAENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLP  395

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  396  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSG  455

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+ ++ + D+ TIKEII+EVD DHDGRINYEEF  MMR G  +
Sbjct  456  YITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYEEFVAMMRKGNPE  507



>ref|XP_011034967.1| PREDICTED: calcium-dependent protein kinase 29 [Populus euphratica]
Length=539

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNKLKKLALK IAENLSEEEI GLK MF N+DTD SGTITYEELK GL+
Sbjct  362  AVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQMFHNMDTDESGTITYEELKSGLS  421

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L E E+KQLM+AADVD +G+I+Y+EFITATMH+++LE EENLYKAFQYFDKD SG
Sbjct  422  RLGSKLNEVEMKQLMDAADVDKSGTIEYLEFITATMHRYKLEMEENLYKAFQYFDKDGSG  481

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FITRDEL  AM +HG+ D ATI E+I +VD D DG+INYEEF +MMR GT+
Sbjct  482  FITRDELRQAMAQHGMGDDATINEVIEDVDTDKDGKINYEEFTSMMRKGTQ  532



>ref|XP_008239005.1| PREDICTED: calcium-dependent protein kinase 3 [Prunus mume]
Length=400

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  221  AVLSRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  280

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  281  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSG  340

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+K++ + D  TIKEII+EVD D DGRINY+EF  MMR G  +
Sbjct  341  YITMEELEQALKKYNMGDEKTIKEIIAEVDTDLDGRINYDEFAAMMRKGDPE  392



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDN+GTIT+EELK GL 
Sbjct  336  AVLTRMKQFRAMNKLKKIALKVIAENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLP  395

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  396  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSG  455

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+ ++ + D+ TIKEII+EVD DHDGRINYEEF  MMR G  +
Sbjct  456  YITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYEEFVAMMRKGNPE  507



>gb|AEY99978.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=515

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV  RMKQFRAMNK+KKLALK IA NLSEEEI GLK MF+NIDTD SGTITYEELK GL+
Sbjct  339  AVLVRMKQFRAMNKMKKLALKVIAGNLSEEEIKGLKQMFSNIDTDGSGTITYEELKTGLS  398

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAE+KQLMEAADVD +G+IDYIEFITAT H+HRLEREENL+KAF YFDKD SG
Sbjct  399  RLGSKLTEAEIKQLMEAADVDKSGTIDYIEFITATTHRHRLEREENLFKAFLYFDKDCSG  458

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITRDEL  AM E+G+ D ATI EI+ +VD D DG+IN++EF  MM+ GT
Sbjct  459  FITRDELRHAMTEYGMGDEATIDEILDDVDTDKDGKINHDEFVAMMKRGT  508



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+AL+ IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  343  AVLTRMKQFRAMNKLKKVALQVIAENLSEEEIMGLKEMFKSMDTDNSGTITFEELKVGLP  402

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  ++E+EVKQLMEAADVDGNG+IDYIEFITATMH +R+E+EE+LYKAF+YFDKD SG
Sbjct  403  KLGTKVSESEVKQLMEAADVDGNGTIDYIEFITATMHMNRMEKEEHLYKAFEYFDKDKSG  462

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+K++ + D  TIKEII+EVD DHDGRINY+EF  MMR G  +
Sbjct  463  YITMEELEQALKKYNMGDTKTIKEIIAEVDTDHDGRINYDEFVAMMRKGNPE  514



>ref|NP_176386.2| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 sp|Q1PFH8.1|CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19 [Arabidopsis 
thaliana]
 gb|ABE65733.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEE33906.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
Length=551

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLA KFIA+NL EEE+ GLK MF N+DTD SGTITY+ELK GL 
Sbjct  371  AVLSRMKQLRAMNKLKKLAFKFIAQNLKEEELKGLKTMFANMDTDKSGTITYDELKSGLE  430

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ERE+NL+KAFQ+FDKD+SG
Sbjct  431  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVEREDNLFKAFQHFDKDNSG  490

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC MM+S ++
Sbjct  491  FISRQELETAMKEYNMGDDIMIKEIISEVDADNDGSINYQEFCNMMKSCSQ  541



>gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKKLALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  346  AVLTRMKQFRAMNKLKKLALKVIAENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLP  405

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  406  KLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSG  465

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+K++ + D+ TIKEII+EVD D+DG+INYEEF  MMR G  
Sbjct  466  YITMEELEHALKQYNMGDSKTIKEIIAEVDTDNDGKINYEEFVAMMRKGNP  516



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  338  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  397

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  398  KLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVEREDHLYKAFEYFDKDKSG  457

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE A+KE+ + DA TIKEI++EVD DHDG+INY+EF  MMR G  
Sbjct  458  YITMEELEHALKEYNMGDAKTIKEILAEVDTDHDGKINYDEFVAMMRKGNP  508



>gb|KJB52214.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=374

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  195  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  254

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LY AFQYFDKD+SG
Sbjct  255  KLGTKLSEHEVRQLMEAADVDGNGAIDYIEFITATMHMNRMEREDHLYTAFQYFDKDNSG  314

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELE A+K++ + D  TIKEII+EVD D DGRINY+EF  MMR G  +
Sbjct  315  YITMEELEQALKKYNMGDEKTIKEIIAEVDTDRDGRINYDEFVAMMRKGNPE  366



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  348  AVLTRMKQFRAMNKLKKVALKVIAENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLP  407

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  L+E+EV+QLMEAADVDGNGSIDYIEFITATMH +R+ERE++L+KAF+YFDKD SG
Sbjct  408  KLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNRVEREDHLFKAFEYFDKDKSG  467

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQ  261
            +IT +ELETA+K++ + D  TIKEII+EVD D+DGRINY+EF  MMR G ++
Sbjct  468  YITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYDEFVAMMRKGNQE  519



>gb|AAC28510.1| Similar to gb|AF072908 calcium-dependent protein kinase from 
Nicotiana tabacum [Arabidopsis thaliana]
Length=553

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQ RAMNKLKKLA KFIA+NL EEE+ GLK MF N+DTD SGTITY+ELK GL 
Sbjct  373  AVLSRMKQLRAMNKLKKLAFKFIAQNLKEEELKGLKTMFANMDTDKSGTITYDELKSGLE  432

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ERE+NL+KAFQ+FDKD+SG
Sbjct  433  KLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVEREDNLFKAFQHFDKDNSG  492

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            FI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC MM+S ++
Sbjct  493  FISRQELETAMKEYNMGDDIMIKEIISEVDADNDGSINYQEFCNMMKSCSQ  543



>sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase; Short=CDPK [Daucus 
carota]
 emb|CAA39936.1| calcium- dependent protein kinase [Daucus carota]
Length=532

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLK+LALK IAE+LSEEEI GLK+MF N+DTD SGTITYEELK GLA
Sbjct  353  AVLSRMKQFRAMNKLKQLALKVIAESLSEEEIKGLKSMFANMDTDKSGTITYEELKSGLA  412

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ L+E EV+QLM+AADVDGNG+IDY+EFITATMH+H+LE  E  ++AFQYFDKD+SG
Sbjct  413  RLGSKLSEVEVQQLMDAADVDGNGTIDYLEFITATMHRHKLESYE--HQAFQYFDKDNSG  470

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLFDLT  237
            FIT+DELE+AMKE+G+ D ATIK+IISEVD+D+DGRINY+EFC MMR    ++ KLF ++
Sbjct  471  FITKDELESAMKEYGMGDEATIKDIISEVDSDNDGRINYDEFCAMMRRARNRR-KLFSVS  529

Query  236  L  234
            L
Sbjct  530  L  530



>ref|XP_006473713.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Citrus sinensis]
Length=466

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV +RMKQFRAMNK+KKLALK IAENLS EEI GLK MF NIDTD SGTIT EEL+ GL+
Sbjct  297  AVLTRMKQFRAMNKMKKLALKVIAENLSTEEIKGLKQMFNNIDTDASGTITCEELRDGLS  356

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG+ LTEAE++QLMEAADVD +G+IDY EFITATMH+H+LE+EENLYKAF+YFD+D SG
Sbjct  357  RLGSKLTEAEIRQLMEAADVDKSGTIDYTEFITATMHRHKLEKEENLYKAFKYFDEDDSG  416

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGT  267
            FITR+EL  AM ++G+ D ATI EI+ +VD D DGRINYEEF  MMR GT
Sbjct  417  FITREELRQAMTQYGMGDEATIDEILEDVDTDKDGRINYEEFVAMMRKGT  466



>gb|KHG01345.1| Calcium-dependent protein kinase 29 [Gossypium arboreum]
Length=298

 Score =   255 bits (651),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLS-EEEIHGLKAMFTNIDTDNSGTITYEELKKGL  600
            AV SR+KQFR MNKLKKLALK IAENLS EEE  GL+ MF NIDTD SGTIT EEL+ GL
Sbjct  122  AVLSRLKQFRVMNKLKKLALKVIAENLSSEEEKKGLQQMFNNIDTDGSGTITLEELRDGL  181

Query  599  AQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSS  420
            A+LG+ LTE E+KQLM+AADVD +G+IDYIEF+TATMH+HRL+RE+N+ KAF YFDKDS+
Sbjct  182  ARLGSKLTEPEIKQLMDAADVDKSGTIDYIEFVTATMHRHRLDREDNIRKAFNYFDKDSN  241

Query  419  GFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            GFITRDEL  AM ++G+ D ATI E+I +VD D DGRINYEEF  MM+ GT+
Sbjct  242  GFITRDELRQAMTQYGMGDEATIDEVIEDVDTDKDGRINYEEFVAMMKRGTQ  293



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  776  AVXSRMKQFRAMNKLKKLALKFIAENLSEEEIHGLKAMFTNIDTDNSGTITYEELKKGLA  597
            AV SRMKQFRAMNKLKK+ALK IAENLSEEEI GLK MF ++DTDNSGTIT+EELK GL 
Sbjct  326  AVLSRMKQFRAMNKLKKVALKVIAENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLP  385

Query  596  QLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSG  417
            +LG  ++E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ERE++LYKAF+YFDKD SG
Sbjct  386  KLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSG  445

Query  416  FITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCTMMRSGTK  264
            +IT +ELE+A+K++ + D  TIKEII+EVDAD+DGRINY+EF  MMR G  
Sbjct  446  YITVEELESALKKYNMGDEKTIKEIIAEVDADNDGRINYDEFVAMMRKGNP  496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360