BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031B20

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625446.1|  PREDICTED: sucrose synthase                        256   6e-76   Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        255   9e-76   Nicotiana sylvestris
ref|NP_001275286.1|  sucrose synthase                                   251   2e-74   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            251   3e-74   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       251   3e-74   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   251   3e-74   
gb|AAA97571.1|  sucrose synthase                                        251   5e-74   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    249   2e-73   Solanum tuberosum [potatoes]
gb|ABV02029.1|  sucrose sythase                                         247   1e-72   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        247   1e-72   Sesamum indicum [beniseed]
gb|AHL84158.1|  sucrose synthase                                        246   2e-72   Nicotiana tabacum [American tobacco]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        246   2e-72   Nicotiana tomentosiformis
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           246   2e-72   
ref|NP_001274911.1|  sucrose synthase 2                                 246   2e-72   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    246   3e-72   Solanum tuberosum [potatoes]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             246   4e-72   
ref|NP_001234804.1|  sucrose synthase                                   245   4e-72   
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        244   8e-72   Nicotiana sylvestris
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        244   1e-71   
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    243   5e-71   Daucus carota [carrots]
emb|CAI56307.1|  sucrose synthase                                       241   2e-70   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       241   2e-70   Coffea arabica [arabica coffee]
gb|ABI17891.1|  sucrose synthase                                        239   1e-69   Coffea canephora [robusta coffee]
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    236   1e-68   Daucus carota [carrots]
gb|AHL29281.1|  sucrose synthase 1                                      235   3e-68   Camellia sinensis [black tea]
gb|AEN79500.1|  sucrose synthase 1                                      234   5e-68   Phelipanche ramosa
gb|ADR00484.1|  sucrose synthase                                        228   7e-68   Arachis hypogaea var. vulgaris [Spanish peanut]
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        221   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AFS17277.1|  sucrose synthase 1                                      233   2e-67   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
gb|AGH29112.1|  sucrose synthase                                        232   3e-67   Jatropha curcas
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        232   3e-67   Fragaria vesca subsp. vesca
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         232   3e-67   Jatropha curcas
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        232   3e-67   Populus euphratica
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        232   4e-67   Populus euphratica
gb|ADA68250.1|  sucrose synthase                                        214   4e-67   Schiedea globosa
gb|ABD61653.1|  sucrose synthase                                        232   4e-67   Cichorium intybus [radicchio]
gb|ADW80556.1|  sucrose synthase 1                                      232   4e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      232   5e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      231   5e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      231   5e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      231   5e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
dbj|BAN18500.1|  sucrose synthase                                       214   6e-67   Schiedea pentandra
gb|ADW80550.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    231   6e-67   Gossypium raimondii
gb|ADV71181.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      231   6e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      231   7e-67   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      231   7e-67   Populus tomentosa [Chinese white poplar]
dbj|BAN18504.1|  sucrose synthase                                       213   1e-66   Schiedea trinervis
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       231   1e-66   Theobroma cacao [chocolate]
emb|CAA67195.1|  sucrose synthase                                       214   1e-66   Pisum sativum [garden pea]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       230   1e-66   
gb|AIJ28960.1|  sucrose synthase                                        230   1e-66   Manihot esculenta subsp. flabellifolia
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        230   2e-66   
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        230   2e-66   Cicer arietinum [garbanzo]
gb|AFO84090.1|  sucrose synthase                                        230   2e-66   Actinidia chinensis
gb|KHN17754.1|  Sucrose synthase                                        230   2e-66   Glycine soja [wild soybean]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        230   2e-66   Cicer arietinum [garbanzo]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    229   2e-66   Gossypium raimondii
gb|AEV40460.1|  sucrose synthase 1                                      229   3e-66   Gossypium arboreum [tree cotton]
dbj|BAM68521.1|  sucrose synthase                                       229   3e-66   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       229   3e-66   Mangifera indica
gb|AHA41509.1|  sucrose synthase                                        229   3e-66   Populus deltoides
gb|KHG00606.1|  Sucrose synthase                                        229   3e-66   Gossypium arboreum [tree cotton]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             229   3e-66   Phaseolus vulgaris [French bean]
gb|AAN76498.1|AF315375_1  sucrose synthase                              229   3e-66   Phaseolus vulgaris [French bean]
dbj|BAA88905.1|  sucrose synthase                                       229   4e-66   Citrus unshiu [satsuma mandarin]
emb|CAB39757.2|  sucrose synthase                                       216   4e-66   Lotus japonicus
dbj|BAA89049.1|  sucrose synthase                                       229   4e-66   Citrus unshiu [satsuma mandarin]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             229   4e-66   Citrus clementina [clementine]
gb|ADW80545.1|  sucrose synthase 1                                      229   4e-66   Populus tomentosa [Chinese white poplar]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        229   4e-66   Citrus sinensis [apfelsine]
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   229   4e-66   Citrus sinensis [apfelsine]
gb|ADA68252.1|  sucrose synthase                                        211   4e-66   Honckenya peploides
gb|AEV40463.1|  sucrose synthase 4                                      229   5e-66   Gossypium arboreum [tree cotton]
gb|AEQ94149.1|  sucrose synthase1                                       215   5e-66   Elaeis guineensis
gb|ADA68251.1|  sucrose synthase                                        211   8e-66   Schiedea membranacea
gb|AEV40464.1|  sucrose synthase 5                                      228   9e-66   Gossypium arboreum [tree cotton]
gb|AEF56625.1|  sucrose synthase                                        228   1e-65   Arachis hypogaea var. vulgaris [Spanish peanut]
dbj|BAM68520.1|  sucrose synthase                                       227   2e-65   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                       227   2e-65   Mangifera indica
gb|ADR81996.1|  sucrose synthase 1                                      227   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002324136.2|  sucrose synthase family protein                    227   2e-65   
gb|AGO61958.1|  sucrose synthase                                        220   2e-65   Prunus serrulata
dbj|BAM68526.1|  sucrose synthase                                       227   3e-65   Mangifera indica
gb|AAK59464.1|  putative sucrose synthase                               222   3e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AEN71066.1|  sucrose synthase Sus1                                   227   3e-65   Gossypium darwinii
gb|ADY68848.1|  sucrose synthase                                        227   3e-65   Gossypium hirsutum [American cotton]
gb|AEK81520.1|  sucrose synthase isoform B                              227   3e-65   Gossypium hirsutum [American cotton]
gb|ACV72640.1|  sucrose synthase 1                                      226   3e-65   Gossypium hirsutum [American cotton]
gb|AEN71067.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium tomentosum
gb|AEV40462.1|  sucrose synthase 3                                      226   3e-65   Gossypium arboreum [tree cotton]
gb|AEN71080.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium gossypioides
gb|ADY68844.1|  sucrose synthase                                        226   3e-65   Gossypium barbadense [Egyptian cotton]
gb|AEN71068.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium tomentosum
gb|AEN71061.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium schwendimanii
gb|AEN71059.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium thurberi
gb|AAD28641.1|  sucrose synthase                                        226   3e-65   Gossypium hirsutum [American cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium mustelinum
gb|AEN71079.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium aridum
gb|AEN71078.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium klotzschianum
gb|AEN71075.1|  sucrose synthase Sus1                                   226   3e-65   Gossypium armourianum
gb|ADY68846.1|  sucrose synthase                                        226   3e-65   Gossypium herbaceum subsp. africanum
gb|ADY68845.1|  sucrose synthase                                        226   3e-65   Gossypium barbadense [Egyptian cotton]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        226   4e-65   
gb|AAR19769.1|  sucrose synthase                                        226   4e-65   Beta vulgaris [beet]
gb|AEK81522.1|  sucrose synthase isoform D                              226   4e-65   Gossypium hirsutum [American cotton]
gb|AAR03498.1|  sucrose synthase                                        226   4e-65   Populus tremuloides
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        226   5e-65   Eucalyptus grandis [rose gum]
gb|AGM14949.1|  sucrose synthase 4                                      226   5e-65   Hevea brasiliensis [jebe]
gb|AIJ28962.1|  sucrose synthase                                        226   6e-65   Manihot esculenta [manioc]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        226   6e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        225   9e-65   Vitis vinifera
emb|CAN82840.1|  hypothetical protein VITISV_024563                     225   9e-65   Vitis vinifera
gb|ABD96570.1|  sucrose synthase                                        225   1e-64   Manihot esculenta [manioc]
gb|AIJ28961.1|  sucrose synthase                                        225   1e-64   Manihot esculenta [manioc]
ref|NP_001237525.1|  sucrose synthase                                   225   1e-64   Glycine max [soybeans]
ref|NP_001289655.1|  sucrose synthase                                   225   1e-64   Eucalyptus grandis [rose gum]
gb|AGM14948.1|  sucrose synthase 3                                      225   1e-64   Hevea brasiliensis [jebe]
ref|XP_006381564.1|  sucrose synthase family protein                    224   2e-64   Populus trichocarpa [western balsam poplar]
gb|ADR81997.1|  sucrose synthase 2                                      224   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        224   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      224   2e-64   Tarenaya hassleriana [spider flower]
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          213   2e-64   
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                224   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             224   2e-64   Phaseolus vulgaris [French bean]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             224   3e-64   Capsella rubella
gb|AEN71060.1|  sucrose synthase Sus1                                   224   3e-64   Gossypium laxum
gb|ADW80593.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADK98097.1|  sucrose synthase                                        207   3e-64   Schiedea globosa
gb|ADW80586.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      224   3e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ABW76422.1|  sucrose synthase                                        224   4e-64   Populus tremuloides
gb|ADW80610.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      224   4e-64   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      223   4e-64   Populus tomentosa [Chinese white poplar]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        223   5e-64   Malus domestica [apple tree]
gb|AIJ28959.1|  sucrose synthase                                        223   5e-64   Manihot esculenta subsp. flabellifolia
gb|KHN49081.1|  Sucrose synthase                                        223   5e-64   Glycine soja [wild soybean]
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        223   5e-64   
gb|ADW80596.1|  sucrose synthase 2                                      223   5e-64   Populus tomentosa [Chinese white poplar]
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 223   6e-64   Camelina sativa [gold-of-pleasure]
gb|ADW80602.1|  sucrose synthase 2                                      223   6e-64   Populus tomentosa [Chinese white poplar]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      223   6e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003609947.1|  Sucrose synthase                                   218   6e-64   
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    223   6e-64   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                          223   6e-64   
gb|ADK98109.1|  sucrose synthase                                        206   6e-64   Schiedea globosa
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      223   7e-64   Camelina sativa [gold-of-pleasure]
gb|ADW09901.1|  putative sucrose synthase                               206   7e-64   Schiedea globosa
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    223   7e-64   Vigna radiata var. radiata [golden gram]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        223   7e-64   Glycine max [soybeans]
emb|CDX70945.1|  BnaC03g10290D                                          223   7e-64   
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        223   7e-64   Populus euphratica
gb|KHN47619.1|  Sucrose synthase                                        223   8e-64   Glycine soja [wild soybean]
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      223   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      223   8e-64   Camelina sativa [gold-of-pleasure]
gb|ADW09936.1|  putative sucrose synthase                               206   8e-64   Schiedea globosa
dbj|BAH56282.1|  sucrose synthase                                       223   8e-64   Vigna angularis [azuki bean]
emb|CDY16569.1|  BnaC09g37040D                                          223   9e-64   Brassica napus [oilseed rape]
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 223   9e-64   Tarenaya hassleriana [spider flower]
ref|NP_566865.2|  sucrose synthase 4                                    223   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             222   1e-63   
gb|AGQ57012.1|  sucrose synthase 1                                      222   1e-63   Hevea brasiliensis [jebe]
gb|ADW80603.1|  sucrose synthase 2                                      222   1e-63   Populus tomentosa [Chinese white poplar]
gb|ADW09933.1|  putative sucrose synthase                               205   1e-63   Schiedea globosa
gb|ADW80599.1|  sucrose synthase 2                                      222   1e-63   Populus tomentosa [Chinese white poplar]
ref|NP_197583.1|  sucrose synthase 1                                    222   2e-63   Arabidopsis thaliana [mouse-ear cress]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    222   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80579.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ACP17902.1|  sucrose synthase                                        222   2e-63   Phaseolus vulgaris [French bean]
gb|AFI57908.1|  sucrose synthase 1                                      222   2e-63   Prunus persica
emb|CAA09910.1|  sucrose synthase                                       222   2e-63   Pisum sativum [garden pea]
gb|ADW80577.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             222   2e-63   Prunus persica
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        222   2e-63   Prunus mume [ume]
gb|ADK98116.1|  sucrose synthase                                        205   2e-63   Schiedea globosa
gb|ADW80601.1|  sucrose synthase 2                                      222   2e-63   Populus tomentosa [Chinese white poplar]
gb|ADW09904.1|  putative sucrose synthase                               205   2e-63   Schiedea globosa
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      222   2e-63   Brassica rapa
gb|ADK98101.1|  sucrose synthase                                        204   2e-63   Schiedea globosa
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        222   2e-63   Pisum sativum [garden pea]
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          213   2e-63   
emb|CDX88838.1|  BnaA03g08110D                                          221   2e-63   
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    221   2e-63   Alnus glutinosa
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    221   2e-63   Vicia faba [broad bean]
gb|ADK98120.1|  sucrose synthase                                        204   3e-63   Schiedea adamantis
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   221   3e-63   
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   221   3e-63   
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             221   4e-63   
gb|ADK98103.1|  sucrose synthase                                        204   4e-63   Schiedea globosa
gb|ADW09903.1|  putative sucrose synthase                               204   4e-63   Schiedea globosa
gb|ADW09926.1|  putative sucrose synthase                               204   4e-63   Schiedea globosa
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   221   5e-63   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   221   5e-63   Pyrus x bretschneideri [bai li]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   220   6e-63   Pyrus x bretschneideri [bai li]
gb|ABP88869.1|  sucrose synthase                                        220   6e-63   Medicago falcata [sickle alfalfa]
gb|ADW80583.1|  sucrose synthase 2                                      220   6e-63   Populus tomentosa [Chinese white poplar]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    220   7e-63   Gossypium raimondii
gb|AIL23782.1|  sucrose synthase                                        220   7e-63   Prunus serrulata
ref|XP_002516210.1|  sucrose synthase, putative                         219   8e-63   
gb|AII19313.1|  sucrose synthase 1                                      220   8e-63   Ricinus communis
gb|KEH37657.1|  sucrose synthase                                        220   8e-63   Medicago truncatula
emb|CDO97805.1|  unnamed protein product                                219   9e-63   Coffea canephora [robusta coffee]
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             220   9e-63   Eutrema salsugineum [saltwater cress]
gb|ADK98112.1|  sucrose synthase                                        203   1e-62   Schiedea globosa
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      219   1e-62   Phoenix dactylifera
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   219   1e-62   Pyrus x bretschneideri [bai li]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    219   1e-62   Medicago sativa [alfalfa]
gb|AAM22755.1|  sucrose synthase                                        204   2e-62   Deschampsia antarctica
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        219   2e-62   
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        219   2e-62   
ref|XP_010107074.1|  Sucrose synthase                                   219   2e-62   Morus notabilis
gb|ADW80576.1|  sucrose synthase 2                                      219   2e-62   Populus tomentosa [Chinese white poplar]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             219   2e-62   Arabidopsis lyrata subsp. lyrata
emb|CAB40795.1|  sucrose synthase                                       219   2e-62   Medicago truncatula
ref|XP_003609949.1|  Sucrose synthase                                   219   2e-62   Medicago truncatula
gb|AGV22112.1|  sucrose synthase 2                                      219   2e-62   Betula luminifera [liang ye hua]
gb|ADW09905.1|  putative sucrose synthase                               202   2e-62   Schiedea globosa
emb|CAA57881.1|  sucrose synthase                                       218   3e-62   Oxybasis rubra [pigweed]
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      219   3e-62   
gb|AFA36485.1|  putative sucrose synthase 2                             206   3e-62   Lolium perenne [perennial ryegrass]
gb|ACF80843.1|  unknown                                                 204   3e-62   Zea mays [maize]
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    218   4e-62   Tulipa gesneriana
ref|XP_003609946.1|  Sucrose synthase                                   218   5e-62   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      218   6e-62   Phoenix dactylifera
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      218   6e-62   Phoenix dactylifera
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        218   6e-62   Pyrus x bretschneideri [bai li]
gb|ABR25521.1|  sucrose synthase metabolism                             204   6e-62   Oryza sativa Indica Group [Indian rice]
gb|ADW09891.1|  putative sucrose synthase                               201   7e-62   Schiedea membranacea
gb|ACF85812.1|  unknown                                                 201   8e-62   Zea mays [maize]
dbj|BAM05649.1|  sucrose synthase 3                                     217   8e-62   Eucalyptus globulus subsp. globulus
gb|ADW09914.1|  putative sucrose synthase                               200   9e-62   Schiedea globosa
gb|ACF78506.1|  unknown                                                 213   9e-62   Zea mays [maize]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        217   1e-61   Cucumis melo [Oriental melon]
gb|ADM77474.1|  sucrose synthase-like protein                           202   1e-61   Picea sitchensis
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        217   1e-61   
gb|AEN83999.1|  sucrose synthase                                        217   1e-61   Cucumis sativus [cucumbers]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       216   1e-61   Cucumis sativus [cucumbers]
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   217   1e-61   Cucumis sativus [cucumbers]
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 217   1e-61   Elaeis guineensis
gb|ADM77484.1|  sucrose synthase-like protein                           202   1e-61   
emb|CAA09680.1|  sucrose synthase                                       209   1e-61   
gb|ADW09895.1|  putative sucrose synthase                               200   1e-61   
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          210   1e-61   
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    217   1e-61   
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    216   1e-61   
gb|AAA34305.1|  sucrose synthase type 2                                 204   2e-61   
dbj|BAA89232.1|  wsus                                                   216   2e-61   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 207   2e-61   
gb|AFM52233.1|  putative sucrose synthase 2                             216   2e-61   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    216   2e-61   
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        216   2e-61   
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like                 204   3e-61   
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 216   3e-61   
gb|AGM14947.1|  sucrose synthase 2                                      215   5e-61   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      215   5e-61   
gb|KJB54541.1|  hypothetical protein B456_009G038000                    215   6e-61   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      215   6e-61   
gb|KJB54539.1|  hypothetical protein B456_009G038000                    215   6e-61   
emb|CAA50317.1|  sucrose synthase                                       214   8e-61   
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   214   8e-61   
ref|NP_001289661.1|  sucrose synthase-like                              214   8e-61   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 214   9e-61   
gb|AGQ57013.1|  sucrose synthase 2                                      214   9e-61   
emb|CAC32462.1|  sucrose synthase isoform 3                             214   9e-61   
gb|AFW88069.1|  sucrose synthase1                                       206   1e-60   
gb|ABE73120.1|  SUS1                                                    209   1e-60   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          214   2e-60   
gb|ADW09921.1|  putative sucrose synthase                               197   2e-60   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 213   2e-60   
gb|ADE77562.1|  unknown                                                 202   2e-60   
gb|ABK23178.1|  unknown                                                 197   2e-60   
ref|NP_001268888.1|  sucrose synthase 2-like                            213   2e-60   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       213   3e-60   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                      201   3e-60   
ref|NP_001105194.1|  sucrose synthase2                                  213   3e-60   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 213   3e-60   
gb|ADY02961.1|  sucrose synthase                                        213   3e-60   
dbj|BAM75184.1|  sucrose synthase                                       204   3e-60   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      213   3e-60   
gb|ADW09887.1|  putative sucrose synthase                               196   3e-60   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      213   3e-60   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    212   4e-60   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          212   5e-60   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   210   6e-60   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             210   6e-60   
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   212   6e-60   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      212   6e-60   
gb|ADW09917.1|  putative sucrose synthase                               196   7e-60   
dbj|BAE06059.1|  sucrose synthase                                       212   8e-60   
gb|ABY82048.1|  sucrose synthase                                        204   8e-60   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   211   8e-60   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         211   9e-60   
dbj|BAM05651.1|  sucrose synthase 3                                     211   9e-60   
dbj|BAM05650.1|  sucrose synthase 3                                     211   9e-60   
gb|AAM95944.1|  sucrose synthase                                        211   1e-59   
gb|AAL27096.1|  sucrose synthase                                        211   1e-59   
gb|ADW09918.1|  putative sucrose synthase                               195   1e-59   
gb|AEV40461.1|  sucrose synthase 2                                      211   1e-59   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    211   1e-59   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   211   1e-59   
gb|ADW09907.1|  putative sucrose synthase                               195   1e-59   
gb|ABR15470.1|  sucrose synthase                                        211   1e-59   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 211   2e-59   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      211   2e-59   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             211   2e-59   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      211   2e-59   
ref|XP_002516963.1|  sucrose synthase, putative                         210   2e-59   
dbj|BAA88904.1|  sucrose synthase                                       211   2e-59   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   211   2e-59   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 211   2e-59   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             211   2e-59   
gb|AGM14950.1|  sucrose synthase 5                                      210   2e-59   
gb|ACN36258.1|  unknown                                                 206   2e-59   
gb|EMT20174.1|  Sucrose synthase 2                                      209   2e-59   
gb|AGW23638.1|  sucrose synthase                                        210   3e-59   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   210   3e-59   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      210   3e-59   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          210   3e-59   
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        210   4e-59   
dbj|BAJ10424.1|  sucrose synthase                                       209   5e-59   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             209   6e-59   
gb|AHM02468.1|  sucrose synthase                                        209   6e-59   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   209   7e-59   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 207   7e-59   
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             209   8e-59   
gb|AFY03626.1|  sucrose synthase                                        209   8e-59   
gb|AJA37527.1|  sucrose synthase                                        209   9e-59   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like                 197   1e-58   
gb|AEN71099.1|  sucrose synthase SusA1                                  209   1e-58   
ref|XP_010092252.1|  Sucrose synthase 2                                 208   1e-58   
gb|AEN71096.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71086.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEV40896.1|  sucrose synthase                                        208   1e-58   
gb|AEN71084.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71101.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71094.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71090.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEZ00745.1|  SusA1                                                   208   1e-58   
gb|AEN71092.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71085.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEV40894.1|  sucrose synthase                                        208   1e-58   
gb|AEN71093.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71105.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEZ00746.1|  SusA1                                                   208   1e-58   
gb|AEN71089.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71106.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71104.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71091.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEN71083.1|  sucrose synthase SusA1                                  208   1e-58   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 208   1e-58   
gb|AEN71088.1|  sucrose synthase SusA1                                  208   1e-58   
gb|AEV40893.1|  sucrose synthase                                        208   1e-58   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             206   1e-58   
gb|AEN71103.1|  sucrose synthase SusA1                                  208   1e-58   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      208   1e-58   
gb|EMS65561.1|  Sucrose synthase 2                                      208   1e-58   
gb|AEO09338.2|  sucrose synthase                                        208   1e-58   
dbj|BAA88981.1|  sucrose synthase                                       208   2e-58   
emb|CAL25362.2|  sucrose synthase                                       208   2e-58   
gb|AFM52237.1|  putative sucrose synthase 6                             207   2e-58   
ref|NP_001050064.1|  Os03g0340500                                       207   2e-58   
gb|EPS58089.1|  sucrose synthase                                        202   2e-58   
ref|NP_001280838.1|  sucrose synthase 3                                 207   2e-58   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      207   2e-58   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 207   3e-58   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 207   3e-58   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      207   3e-58   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    205   3e-58   
gb|AIL88517.1|  sucrose synthase type 2-2                               207   3e-58   
ref|XP_010482198.1|  PREDICTED: sucrose synthase 2-like                 191   4e-58   
gb|AIL88516.1|  sucrose synthase type 2-1                               207   4e-58   
gb|AEN71087.1|  sucrose synthase SusA1                                  207   4e-58   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             207   4e-58   
gb|AFK45264.1|  unknown                                                 193   5e-58   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      206   5e-58   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           206   7e-58   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       206   7e-58   
gb|ADW09927.1|  putative sucrose synthase                               190   7e-58   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      206   7e-58   
gb|AAL50570.1|AF412037_1  sucrose synthase                              206   8e-58   
ref|XP_010088307.1|  Sucrose synthase 2                                 205   8e-58   
gb|AAA34304.1|  sucrose synthase type 1                                 194   8e-58   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      206   9e-58   
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g             198   9e-58   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 206   9e-58   
gb|AIS75087.1|  sus1                                                    206   9e-58   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      206   9e-58   
gb|ADW09923.1|  putative sucrose synthase                               190   1e-57   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 206   1e-57   
dbj|BAB20799.1|  sucrose synthase 1                                     206   1e-57   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    206   1e-57   
gb|AEV40895.1|  sucrose synthase                                        206   1e-57   
gb|AGI56230.1|  sucrose synthase 1                                      206   1e-57   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          206   1e-57   
gb|AFR41908.1|  sucrose synthase                                        191   1e-57   
gb|KEH24408.1|  sucrose synthase                                        205   1e-57   
gb|AGV22111.1|  sucrose synthase 1                                      205   2e-57   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 205   2e-57   
ref|NP_001060278.1|  Os07g0616800                                       205   2e-57   
ref|XP_002302727.1|  sucrose synthase family protein                    205   2e-57   
gb|AAC41682.1|  sucrose synthase 3                                      205   2e-57   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          205   2e-57   
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   205   2e-57   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      205   2e-57   
dbj|BAE06058.1|  sucrose synthase                                       205   2e-57   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 205   2e-57   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      204   2e-57   
gb|AEA76429.1|  sucrose synthase 1                                      204   2e-57   
gb|AFR41929.1|  sucrose synthase                                        190   2e-57   
gb|AAM95943.1|  sucrose synthase                                        204   3e-57   
emb|CDX86250.1|  BnaA06g29670D                                          204   3e-57   
ref|NP_001105323.1|  sucrose synthase 2                                 204   3e-57   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      204   3e-57   
gb|EAY90371.1|  hypothetical protein OsI_11950                          204   3e-57   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   204   3e-57   
ref|NP_001050319.1|  Os03g0401300                                       204   3e-57   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      204   4e-57   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      204   4e-57   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 204   4e-57   
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     204   4e-57   
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        204   4e-57   
emb|CAA03935.1|  sucrose synthase type 2                                204   4e-57   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 204   5e-57   
gb|KHN43494.1|  Sucrose synthase 2                                      204   5e-57   
ref|XP_002523115.1|  sucrose synthase, putative                         204   5e-57   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      204   5e-57   
gb|AIL88515.1|  sucrose synthase type 3                                 204   5e-57   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      204   5e-57   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 204   5e-57   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 204   6e-57   
gb|AFR41915.1|  sucrose synthase                                        189   6e-57   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 203   6e-57   
gb|AFY03625.1|  sucrose synthase                                        199   6e-57   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                     202   6e-57   
gb|AFR41912.1|  sucrose synthase                                        189   7e-57   
gb|AFR41917.1|  sucrose synthase                                        188   7e-57   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                     200   8e-57   
gb|AAA68209.1|  sus1                                                    203   8e-57   
gb|AFR41916.1|  sucrose synthase                                        188   8e-57   
gb|AFR41922.1|  sucrose synthase                                        188   9e-57   
dbj|BAM05645.1|  sucrose synthase 1                                     203   9e-57   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             203   1e-56   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    203   1e-56   
dbj|BAM05652.1|  sucrose synthase 3                                     202   1e-56   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      203   1e-56   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      202   1e-56   
gb|AIO11846.1|  sucrose synthase                                        202   1e-56   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    202   1e-56   
gb|EMS66266.1|  Sucrose synthase 1                                      202   1e-56   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 202   1e-56   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      202   1e-56   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 202   1e-56   
dbj|BAK02964.1|  predicted protein                                      202   2e-56   
gb|AAL50572.2|AF412039_1  sucrose synthase                              202   2e-56   
gb|AAL50571.1|AF412038_1  sucrose synthase                              202   2e-56   
emb|CDX85398.1|  BnaC07g27090D                                          202   2e-56   
gb|EMT06653.1|  Sucrose synthase 1                                      202   2e-56   
gb|EMT33394.1|  Sucrose synthase 1                                      202   2e-56   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             202   2e-56   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       202   2e-56   



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELL DFFE+CKK+PSHWE I
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLADFFERCKKEPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEA  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   255 bits (652),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHG+QAAELL DFFEKCKK+PSHWE I
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGDQAAELLADFFEKCKKEPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEA  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  SMGGLKRIEEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCK++PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKREPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  SMGGLKRIEEKYTWQIYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY+GEQ AE+LVDFFEKCK DPSHWETI
Sbjct  680  VEAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYNGEQVAEVLVDFFEKCKHDPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRIQEKYTWQIYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE 
Sbjct  740  SAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEA  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK  PSHWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTQPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE I
Sbjct  680  VEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ 
Sbjct  740  SEGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQL  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE I
Sbjct  680  VEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ 
Sbjct  740  SEGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQL  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE I
Sbjct  680  VEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ 
Sbjct  740  SEGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQL  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE I
Sbjct  680  VEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE 
Sbjct  740  SKGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEL  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM+CGLPTFATN GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE I
Sbjct  680  VEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE 
Sbjct  740  SKGGLKRIQEKYTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEL  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   244 bits (624),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +P HWETI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPYHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  STGGLKRIQEKYTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY+GEQ AE LV+FFEKCKKDPSHWETI
Sbjct  680  VEAMTCGLPTFATVHGGPAEIIVHGKSGFHIDPYNGEQVAETLVNFFEKCKKDPSHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRI EKYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE 
Sbjct  740  SAGGLKRIMEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHGEQ AELLV+FFEKCK DPS W+ I
Sbjct  682  VEAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYHGEQVAELLVNFFEKCKTDPSQWDAI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRIQEKYTWQIYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE 
Sbjct  742  SAGGLKRIQEKYTWQIYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAES  801

Query  322  VPLA  311
            VPLA
Sbjct  802  VPLA  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE 
Sbjct  740  SAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE 
Sbjct  740  SAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFATNHGGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI
Sbjct  680  VEAMTCGLPTFATNHGGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
             AGGLKRIQEKYTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE 
Sbjct  740  PAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT HGGPAEIIVHG SGFHIDPYHGE+AAEL+V+FFE+CK +PSHWETI
Sbjct  676  IEAMTCGLPTFATIHGGPAEIIVHGTSGFHIDPYHGEKAAELIVNFFERCKTEPSHWETI  735

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE 
Sbjct  736  SAGGLKRIQEKYTWQIYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAES  795

Query  322  VPLAIE  305
            VPLA++
Sbjct  796  VPLAVD  801



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT++GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+E+C KDPSHW+ I
Sbjct  680  VEAMTCGLPTFATSYGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYERCSKDPSHWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            SAGGL+RI EKYTWQIYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SAGGLQRIMEKYTWQIYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMT GLPTFAT HGGPAEIIV GKSGFHIDPY+GEQ AE LV FFEKC KDPSHWE I
Sbjct  680  VEAMTRGLPTFATLHGGPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCNKDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE 
Sbjct  740  STGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ I
Sbjct  364  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDNI  423

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  424  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  483

Query  322  VPLAIE  305
            VPLA+E
Sbjct  484  VPLAVE  489



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  153  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  212

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  213  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  272

Query  322  VPLA  311
            VPLA
Sbjct  273  VPLA  276



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+MTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AAELLVDFF+K K DP+HWETI
Sbjct  677  VESMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAAELLVDFFKKSKADPTHWETI  736

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE 
Sbjct  737  SKGGLKRIEEKYTWQIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAES  796

Query  322  VPLAIE  305
            VPLAIE
Sbjct  797  VPLAIE  802



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ I
Sbjct  681  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGEQAAEILVDFFEKCKKDPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ 
Sbjct  741  SQGGLKRIEEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADS  800

Query  322  VPLAIE  305
            VPLA E
Sbjct  801  VPLAEE  806



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE I
Sbjct  687  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKI  746

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  747  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  806

Query  322  VPLAIE  305
            VPL  E
Sbjct  807  VPLTKE  812



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADA68250.1| sucrose synthase, partial [Schiedea globosa]
 dbj|BAN18490.1| sucrose synthase, partial [Schiedea spergulina]
 dbj|BAN18491.1| sucrose synthase, partial [Schiedea kealiae]
 dbj|BAN18492.1| sucrose synthase, partial [Schiedea mannii]
 dbj|BAN18493.1| sucrose synthase, partial [Schiedea menziesii]
 dbj|BAN18494.1| sucrose synthase, partial [Schiedea hookeri]
 dbj|BAN18495.1| sucrose synthase, partial [Schiedea sarmentosa]
 dbj|BAN18496.1| sucrose synthase, partial [Schiedea lydgatei]
 dbj|BAN18497.1| sucrose synthase, partial [Schiedea haleakalensis]
 dbj|BAN18498.1| sucrose synthase, partial [Schiedea salicaria]
 dbj|BAN18499.1| sucrose synthase, partial [Schiedea globosa]
Length=118

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  655  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  476
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIE  60

Query  475  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG+Q  +LLV FFEK K DPSHWE I
Sbjct  680  VEAMTCGLPTFATLHGGPAEIIVHGKSGFHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G  +RIQEKYTWQIYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE 
Sbjct  740  SKGAEQRIQEKYTWQIYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAES  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>dbj|BAN18500.1| sucrose synthase, partial [Schiedea pentandra]
 dbj|BAN18501.1| sucrose synthase, partial [Schiedea kauaiensis]
 dbj|BAN18502.1| sucrose synthase, partial [Schiedea perlmanii]
 dbj|BAN18509.1| sucrose synthase, partial [Schiedea stellarioides]
Length=118

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  655  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  476
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIE  60

Query  475  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>dbj|BAN18504.1| sucrose synthase, partial [Schiedea trinervis]
 dbj|BAN18505.1| sucrose synthase, partial [Schiedea obovata]
 dbj|BAN18506.1| sucrose synthase, partial [Schiedea viscosa]
 dbj|BAN18507.1| sucrose synthase, partial [Schiedea verticillata]
Length=118

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  655  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  476
            TFAT HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGQSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIE  60

Query  475  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  I
Sbjct  726  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKI  785

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  786  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  845

Query  322  VPLAIE  305
            VPLA+E
Sbjct  846  VPLAVE  851



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHGE AA+LLV+FFEK K DPSHW+ I
Sbjct  37   VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGEGAADLLVEFFEKVKSDPSHWDKI  96

Query  502  S-AGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  326
            S  GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RK AE
Sbjct  97   SLKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKSAE  156

Query  325  DVPLAIE  305
             VPLA+E
Sbjct  157  SVPLAVE  163



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETI
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SKAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM CGLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ I
Sbjct  680  VEAMGCGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEII+HGKSGFHIDPYHG+Q AELLV+F+EKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCHGGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYEKCKVDPSHWDAI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRILEKYTWQIYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEA  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETI
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SKAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM CGLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ I
Sbjct  680  VEAMGCGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ I
Sbjct  675  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKI  734

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  735  SQGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAES  794

Query  322  VPLAIE  305
            VPLA+E
Sbjct  795  VPLAVE  800



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ I
Sbjct  675  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKI  734

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  735  SQGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAES  794

Query  322  VPLAIE  305
            VPLA+E
Sbjct  795  VPLAVE  800



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  I
Sbjct  688  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKI  747

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  748  SEGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  807

Query  322  VPLAIE  305
            VPLA+E
Sbjct  808  VPLAVE  813



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TI
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TI
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SLGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE LV+FFEK K DPS+W+ I
Sbjct  107  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAETLVEFFEKSKADPSYWDKI  166

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTW+IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE 
Sbjct  167  SQGGLQRIHEKYTWKIYSDRLLTLTGVYGFWKHVTNLDRRENKRYLEMFYALKYSKLAES  226

Query  322  VPLAIE  305
            VPLA+E
Sbjct  227  VPLAVE  232



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SLGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SLGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIHEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SLGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ I
Sbjct  658  VEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKI  717

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  718  SLGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  777

Query  322  VPLAIE  305
            VPLA+E
Sbjct  778  VPLAVE  783



>gb|ADA68252.1| sucrose synthase, partial [Honckenya peploides]
Length=118

 Score =   211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  655  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  476
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIK  60

Query  475  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            EKYTWQIYSDRLLTLA VYGFWK+VS LD LE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDHLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEQ94149.1| sucrose synthase1 [Elaeis guineensis]
Length=235

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+MTCGLPTFAT HGGPAEIIVHG SGFHIDPY G++AAELLVDFFEKCK+DPSHW  I
Sbjct  101  VESMTCGLPTFATCHGGPAEIIVHGVSGFHIDPYQGDKAAELLVDFFEKCKEDPSHWAKI  160

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW++YS+RL+TL+ VYGFWK+VS LDR E RRYLEMFYALK+R LA+ 
Sbjct  161  SQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMFYALKYRNLAKS  220

Query  322  VPL  314
            VPL
Sbjct  221  VPL  223



>gb|ADA68251.1| sucrose synthase, partial [Schiedea membranacea]
 dbj|BAN18503.1| sucrose synthase, partial [Schiedea helleri]
 dbj|BAN18508.1| sucrose synthase, partial [Schiedea membranacea]
Length=118

 Score =   211 bits (536),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  655  TFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQ  476
            TFAT HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D SHWE IS GGLKRI+
Sbjct  1    TFATCHGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSHWEAISLGGLKRIE  60

Query  475  EKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            EKYTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   EKYTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  I
Sbjct  707  VEAMTCGLPTFATCKGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDI  766

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  767  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  826

Query  322  VPLAIE  305
            VPLA E
Sbjct  827  VPLAEE  832



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ I
Sbjct  675  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKI  734

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  735  SQGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAES  794

Query  322  VPLAIE  305
            VPLA+E
Sbjct  795  VPLAVE  800



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ I
Sbjct  675  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKI  734

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  735  SQGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAES  794

Query  322  VPLAIE  305
            VPLA+E
Sbjct  795  VPLAVE  800



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SHGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ I
Sbjct  311  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKI  370

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  371  SQGGLQRIFEKYTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  430

Query  322  VPLAIE  305
            VPLA E
Sbjct  431  VPLAEE  436



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ I
Sbjct  675  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKVDPSYWDKI  734

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  735  SQGGLKRIEEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAES  794

Query  322  VPLAIE  305
            VPLA+E
Sbjct  795  VPLAVE  800



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ I
Sbjct  406  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQI  465

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  466  SLGGLERIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  525

Query  322  VPLAIE  305
            VPLA E
Sbjct  526  VPLAHE  531



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+L DFF+KCKKDPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILADFFDKCKKDPSHWNDI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE 
Sbjct  740  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  681  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  741  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  800

Query  322  VPLAIE  305
            VPLA E
Sbjct  801  VPLAEE  806



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE I
Sbjct  677  VEAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENI  736

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE 
Sbjct  737  SKGGLQRIEEKYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAES  796

Query  322  VPLAIE  305
            VPLAIE
Sbjct  797  VPLAIE  802



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE I
Sbjct  677  VEAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENI  736

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE 
Sbjct  737  SKGGLQRIEEKYTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAES  796

Query  322  VPLAIE  305
            VPLAIE
Sbjct  797  VPLAIE  802



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK D S+W  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDSSYWTKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SEGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  740  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL  E
Sbjct  800  VPLTKE  805



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RI+EKYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGAMQRIKEKYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEK K DPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKSKADPSHWNNI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPPHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIVHGKSGFHIDPY G++AAELLV FFEKCK+DPSHWE I
Sbjct  680  VEAMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYQGDRAAELLVHFFEKCKEDPSHWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ 
Sbjct  740  SQGGLKRIHEKYTWQIYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQM  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GLKRI+EKYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ 
Sbjct  740  SKAGLKRIEEKYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQS  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GLKRI+EKYTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ 
Sbjct  740  SKAGLKRIEEKYTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQS  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SKAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAAE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RI++KYTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGAMQRIKDKYTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEKCK DPS+W  I
Sbjct  684  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKCKVDPSYWNNI  743

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE 
Sbjct  744  SHGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAES  803

Query  322  VPLAIE  305
            VPL +E
Sbjct  804  VPLTVE  809



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+MTCGLPTFAT HGGPAEIIVHGKSGFHIDPYHG++AAELLV+FFEK K+DP++WE I
Sbjct  680  VESMTCGLPTFATCHGGPAEIIVHGKSGFHIDPYHGDRAAELLVNFFEKSKEDPTYWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIHEKYTWQIYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEM  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SHGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAQE  805



>tpg|DAA45272.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=282

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEII HG SGFHIDPYH EQAA L+ DFFE+CK+DP HW  I
Sbjct  154  VEAMTCGLPTFATLHGGPAEIIEHGVSGFHIDPYHPEQAANLMADFFERCKQDPDHWVKI  213

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI EKYTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ 
Sbjct  214  SGAGLQRIYEKYTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKT  273

Query  322  VPLAIE  305
            VPLAI+
Sbjct  274  VPLAID  279



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEIIV G SGFHIDPY+GE  AE+L+ FFEKC KDPSHWE I
Sbjct  741  VEAMTCGLPTFATLHGGPAEIIVDGISGFHIDPYNGESVAEILIGFFEKCTKDPSHWEAI  800

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTWQIYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE 
Sbjct  801  STGGLKRIREKYTWQIYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEA  860

Query  322  VPLAIE  305
            VPLA+E
Sbjct  861  VPLAVE  866



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATFNGGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIQEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEII HGKSGFHIDPYHG+QAAE L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCNGGPAEIIEHGKSGFHIDPYHGDQAAETLADFFTKCKQDPSHWDQI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SLGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAQE  807



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFE CKKDPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEVCKKDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIEEKYTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADK98097.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98098.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98099.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98100.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98104.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98105.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98106.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98107.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98108.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98110.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98111.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98114.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98115.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98117.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98119.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09893.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09894.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09899.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09900.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09902.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09909.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09910.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09919.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09920.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09931.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09932.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09935.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09937.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09938.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ I
Sbjct  681  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV FF KCK DPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFVKCKADPSHWTKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAQE  807



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFH+DPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHVDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAQE  807



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  406  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKI  465

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  466  SQGGLQRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  525

Query  322  VPLAIE  305
            VPLA+E
Sbjct  526  VPLAVE  531



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAQE  805



>gb|ADK98109.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98118.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAXLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAQE  807



>gb|ADW09901.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (523),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SQAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHGEQAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGEQAADTLADFFTKCKEDPSHWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEK+TW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLAE 
Sbjct  738  SQGGLQRIQEKHTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLAES  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  712  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  771

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  772  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  831

Query  322  VPLAIE  305
            VPLA E
Sbjct  832  VPLAQE  837



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  736  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  795

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  796  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  855

Query  322  VPLAIE  305
            VPLA E
Sbjct  856  VPLAQE  861



>gb|ADW09936.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SEAGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDQI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAQE  805



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ I
Sbjct  681  VEAMTCGLPTFATCNGGPAEIIVNGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  741  SHGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  800

Query  322  VPLAIE  305
            VPLA E
Sbjct  801  VPLAQE  806



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SLGGLERIQEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAHE  807



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMT GLPTFAT +GGPAEIIVHGKSGFHIDPYHG+QAAE L DFF KCK DPSHW+ I
Sbjct  682  VEAMTSGLPTFATCNGGPAEIIVHGKSGFHIDPYHGDQAAETLADFFTKCKHDPSHWDQI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SLGGLERIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQA  801

Query  322  VPLAIE  305
            VPLA E
Sbjct  802  VPLAQE  807



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGK GF+IDPYHG QAAELLVDFFEK K DPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKPGFNIDPYHGGQAAELLVDFFEKSKADPSHWNNI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S G ++RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE 
Sbjct  740  SRGAMQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFW+HVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWEHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW09933.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09934.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  1    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  60

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  61   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
             PL IE
Sbjct  798  APLTIE  803



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  801

Query  322  VPLA  311
            VPLA
Sbjct  802  VPLA  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  682  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  741

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  742  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  801

Query  322  VPLA  311
            VPLA
Sbjct  802  VPLA  805



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKH S LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWRIYSQRLLTLTGVYGFWKHASNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHWE I
Sbjct  680  VEAMTCGLPTFATFNGGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWEKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRIQEKYTWQ+YSDRLLTL  VYGFWKHV+ L+R E +R LEMFYALK+RKLAE 
Sbjct  740  SQGGLKRIQEKYTWQVYSDRLLTLTGVYGFWKHVTNLERRESKRSLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLAIE
Sbjct  800  VPLAIE  805



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VP A E
Sbjct  800  VPRAEE  805



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLE+FYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEVFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VP A E
Sbjct  800  VPRAEE  805



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VP A E
Sbjct  800  VPRAEE  805



>gb|ADK98116.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSGFHIDPYHG++AA+LL DFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLXDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKY W+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYAWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|ADW09904.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09911.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09912.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09913.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09925.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09929.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09930.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>gb|ADK98101.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98102.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+G SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGXSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>tpg|DAA45273.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=383

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEII HG SGFHIDPYH EQAA L+ DFFE+CK+DP HW  I
Sbjct  255  VEAMTCGLPTFATLHGGPAEIIEHGVSGFHIDPYHPEQAANLMADFFERCKQDPDHWVKI  314

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI EKYTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ 
Sbjct  315  SGAGLQRIYEKYTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKT  374

Query  322  VPLAIE  305
            VPLAI+
Sbjct  375  VPLAID  380



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  617  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  676

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  677  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKA  736

Query  322  VPLAIE  305
            VPLA E
Sbjct  737  VPLAEE  742



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+MTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHGEQAA+LLVDFFEK K DPSHW  I
Sbjct  678  VESMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGEQAAQLLVDFFEKTKADPSHWAKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTW+IYS+RLLTL  V  FWKHVS LDRLE RRY+EMFYALK+RKLAE 
Sbjct  738  SLGGLQRIHEKYTWKIYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAES  797

Query  322  VPLAIE  305
            VPLA+E
Sbjct  798  VPLAVE  803



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SLGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|ADK98120.1| sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09897.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09898.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (519),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  724  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEI  783

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ 
Sbjct  784  SLGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQA  843

Query  322  VPLA  311
            VPLA
Sbjct  844  VPLA  847



>gb|ADK98103.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98113.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09889.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09890.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09915.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09916.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPAEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09903.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGP EIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09926.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGP EIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTW
Sbjct  2    HGGPXEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTW  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHWE I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWEKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCMGGPAEIIVNGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALK+RKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKYRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEK K DPSHW+ I
Sbjct  679  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKVKADPSHWDKI  738

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  739  SQGGLQRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  798

Query  322  VPLAIE  305
            VPLA+E
Sbjct  799  VPLAVE  804



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGFHI PYHG QAAELLVDFFEKCK DP++W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGFHIVPYHGVQAAELLVDFFEKCKADPTYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ 
Sbjct  738  SQGGLQRIQEKYTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADS  797

Query  322  VPLAIE  305
            VPL IE
Sbjct  798  VPLTIE  803



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  I
Sbjct  680  VEAMTCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  326
            S GGLKRIQEKYTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKL +
Sbjct  740  SEGGLKRIQEKYTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLVD  798



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIFEKYTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAEE  805



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+M+CGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ I
Sbjct  648  VESMSCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEI  707

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ 
Sbjct  708  SKGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADS  767

Query  322  VPLAIE  305
            VPL +E
Sbjct  768  VPLTVE  773



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VE+M+CGLPTFAT +GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ I
Sbjct  680  VESMSCGLPTFATCNGGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RIQEKYTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ 
Sbjct  740  SKGGLQRIQEKYTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADS  799

Query  322  VPLAIE  305
            VPL +E
Sbjct  800  VPLTVE  805



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIVHGKSG+HIDPYHG+QAAE LV+FFEK K DPS+W+ I
Sbjct  678  VEAMTCGLPTFATCNGGPAEIIVHGKSGYHIDPYHGDQAAETLVEFFEKSKADPSYWDKI  737

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI EKYTWQIYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE 
Sbjct  738  SHGGLKRIHEKYTWQIYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYSKLAES  797

Query  322  VPLAIE  305
            VPLA+E
Sbjct  798  VPLAVE  803



>emb|CDO97805.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   219 bits (558),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT +GGPAEIIV+GKSGFHIDPY GEQ AE+LVDFFE+CK+D S+WETI
Sbjct  607  VEAMTCGLPTFATINGGPAEIIVNGKSGFHIDPYKGEQVAEVLVDFFERCKEDASYWETI  666

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S+GGLKRIQEKYTWQIYSDR+LTLA VYGFWK VS+ DRL+++RYLEMFY L +RKLAE 
Sbjct  667  SSGGLKRIQEKYTWQIYSDRILTLAGVYGFWKEVSRPDRLKMQRYLEMFYLLNYRKLAES  726

Query  322  VPLA  311
            VP+A
Sbjct  727  VPVA  730



>ref|XP_006400648.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
 gb|ESQ42101.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
Length=806

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT  GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ I
Sbjct  680  VEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDEI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTWQIYS RLLTL  VYGFWKHVS LD LE RRYLEMFYALK+R LA+ 
Sbjct  740  SKGGLQRIEEKYTWQIYSQRLLTLTGVYGFWKHVSNLDHLESRRYLEMFYALKYRPLAQA  799

Query  322  VPLAIE  305
            VPLA E
Sbjct  800  VPLAQE  805



>gb|ADK98112.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  640  HGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  461
            HGGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT 
Sbjct  2    HGGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTX  61

Query  460  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  305
            QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   QIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_008797380.1| PREDICTED: sucrose synthase 1-like isoform X2 [Phoenix dactylifera]
Length=814

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT++GGPAEIIVHG SGFHIDPY G++AAELLV FFEKC++DP+HW  I
Sbjct  680  IEAMTCGLPTFATSNGGPAEIIVHGVSGFHIDPYQGDKAAELLVSFFEKCREDPNHWNKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGLKRI+EKYTW++YS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+R LA  
Sbjct  740  SQGGLKRIEEKYTWKLYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRNLATS  799

Query  322  VPLAIE  305
            VPLA++
Sbjct  800  VPLAVD  805



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+GKSG+HIDPY G+QAAE+LVDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGKSGYHIDPYQGDQAAEILVDFFEKSKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAM  GLPTFAT +GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ I
Sbjct  680  VEAMATGLPTFATLNGGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKI  739

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI+EKYTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE 
Sbjct  740  SQGGLQRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAES  799

Query  322  VPLAIE  305
            VPLA+E
Sbjct  800  VPLAVE  805



>gb|AAM22755.1| sucrose synthase [Deschampsia antarctica]
Length=159

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            VEAMTCGLPTFAT HGGPAEII HG SGFHIDPYH +QAA L+VDFFE+CK+DP+HW  I
Sbjct  31   VEAMTCGLPTFATLHGGPAEIIEHGISGFHIDPYHPDQAATLMVDFFEQCKQDPNHWVKI  90

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S  GL+RI +KYTW+IYS+RL+TLA VYGFWK+VSKL+R E RRYLEMFY LKFR+L + 
Sbjct  91   SDRGLQRIYDKYTWKIYSERLMTLAGVYGFWKYVSKLERRETRRYLEMFYILKFRELVKS  150

Query  322  VPLAIE  305
            VPLA++
Sbjct  151  VPLALD  156



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+G SG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGISGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  682  VEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETI  503
            +EAMTCGLPTFAT  GGPAEIIV+G SG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ I
Sbjct  681  IEAMTCGLPTFATCKGGPAEIIVNGISGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKI  740

Query  502  SAGGLKRIQEKYTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAED  323
            S GGL+RI EKYTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  
Sbjct  741  SQGGLQRIYEKYTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAAS  800

Query  322  VPLAIE  305
            VPLA+E
Sbjct  801  VPLAVE  806



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060