BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF031B02

Length=727
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    265   2e-84   Nicotiana sylvestris
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    263   5e-84   Solanum tuberosum [potatoes]
emb|CAA56601.1|  36kDa porin I                                          263   6e-84   Solanum tuberosum [potatoes]
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    263   1e-83   Solanum lycopersicum
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    262   2e-83   Nicotiana tomentosiformis
emb|CDP00287.1|  unnamed protein product                                258   6e-82   Coffea canephora [robusta coffee]
emb|CDP00288.1|  unnamed protein product                                257   2e-81   Coffea canephora [robusta coffee]
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    256   3e-81   Morus notabilis
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    256   4e-81   Nicotiana sylvestris
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             255   7e-81   Citrus clementina [clementine]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    254   2e-80   Citrus sinensis [apfelsine]
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    254   4e-80   Eucalyptus grandis [rose gum]
ref|XP_002312708.1|  porin family protein                               253   5e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    253   5e-80   Populus euphratica
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    250   8e-79   Nicotiana tomentosiformis
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            249   2e-78   Gossypium arboreum [tree cotton]
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    249   2e-78   Ricinus communis
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    249   2e-78   Sesamum indicum [beniseed]
gb|KJB30018.1|  hypothetical protein B456_005G139100                    249   3e-78   Gossypium raimondii
gb|KJB30017.1|  hypothetical protein B456_005G139100                    248   4e-78   Gossypium raimondii
gb|KJB50697.1|  hypothetical protein B456_008G182700                    245   1e-77   Gossypium raimondii
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    247   2e-77   Cucumis melo [Oriental melon]
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    246   2e-77   Morus notabilis
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    246   3e-77   Vitis vinifera
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            246   3e-77   Gossypium arboreum [tree cotton]
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    246   4e-77   Prunus mume [ume]
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    246   4e-77   Sesamum indicum [beniseed]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    245   5e-77   Gossypium raimondii
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    245   8e-77   
gb|KJB50696.1|  hypothetical protein B456_008G182700                    245   8e-77   Gossypium raimondii
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    245   8e-77   
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            244   1e-76   Gossypium arboreum [tree cotton]
ref|XP_006378154.1|  porin family protein                               244   1e-76   Populus trichocarpa [western balsam poplar]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         244   1e-76   Jatropha curcas
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    244   1e-76   Malus domestica [apple tree]
gb|AAD38145.1|AF139498_1  porin                                         244   2e-76   Prunus armeniaca
gb|AID59897.1|  voltage-dependent anion channel protein                 244   2e-76   Prunus persica
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    243   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             245   4e-76   
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    243   8e-76   Cucumis melo [Oriental melon]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-75   Nelumbo nucifera [Indian lotus]
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-75   Populus euphratica
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-75   Cucumis sativus [cucumbers]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    241   3e-75   Pyrus x bretschneideri [bai li]
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    239   1e-74   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                239   2e-74   Erythranthe guttata [common monkey flower]
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                239   2e-74   Erythranthe guttata [common monkey flower]
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       241   2e-74   Cucumis sativus [cucumbers]
emb|CDP02196.1|  unnamed protein product                                239   3e-74   Coffea canephora [robusta coffee]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    239   3e-74   Malus domestica [apple tree]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    238   4e-74   Glycine max [soybeans]
gb|AAQ87019.1|  VDAC1.1                                                 238   5e-74   Lotus japonicus
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    238   5e-74   Fragaria vesca subsp. vesca
gb|KHN13242.1|  Outer plastidial membrane protein porin                 238   6e-74   Glycine soja [wild soybean]
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    238   7e-74   Malus domestica [apple tree]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    237   1e-73   Prunus mume [ume]
gb|AAA96275.1|  voltage-dependent anion channel protein                 237   1e-73   Spinacia oleracea
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    236   2e-73   Glycine soja [wild soybean]
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    236   2e-73   Nicotiana tomentosiformis
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          236   2e-73   Amborella trichopoda
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    236   2e-73   Glycine max [soybeans]
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    236   2e-73   Nicotiana sylvestris
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            236   3e-73   Gossypium arboreum [tree cotton]
gb|KJB33661.1|  hypothetical protein B456_006G024700                    236   3e-73   Gossypium raimondii
gb|ABB02635.1|  unknown                                                 232   4e-73   Solanum tuberosum [potatoes]
gb|KHN11584.1|  Outer plastidial membrane protein porin                 235   7e-73   Glycine soja [wild soybean]
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    235   7e-73   Glycine max [soybeans]
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    235   8e-73   Phaseolus coccineus [scarlet runner bean]
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             236   9e-73   
ref|XP_007032450.1|  Voltage dependent anion channel 1                  234   9e-73   
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    234   1e-72   Solanum tuberosum [potatoes]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    234   2e-72   Glycine max [soybeans]
gb|AFK39621.1|  unknown                                                 234   2e-72   Lotus japonicus
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    234   2e-72   Nicotiana tomentosiformis
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    233   3e-72   Nelumbo nucifera [Indian lotus]
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    233   3e-72   Solanum tuberosum [potatoes]
gb|ACU20122.1|  unknown                                                 233   4e-72   Glycine max [soybeans]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    233   5e-72   Solanum lycopersicum
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    233   6e-72   Nicotiana sylvestris
gb|AAQ87020.1|  VDAC1.2                                                 232   7e-72   Lotus japonicus
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        232   7e-72   Theobroma cacao [chocolate]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    232   8e-72   Vitis vinifera
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            232   9e-72   Solanum tuberosum [potatoes]
gb|AIL25718.1|  voltage-dependent anion channel                         231   2e-71   Nicotiana tabacum [American tobacco]
dbj|BAF95070.1|  voltage-dependent anion channel                        231   2e-71   Nicotiana tabacum [American tobacco]
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    231   2e-71   Solanum lycopersicum
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             231   3e-71   Phaseolus vulgaris [French bean]
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    229   5e-71   Gossypium arboreum [tree cotton]
gb|AFK40985.1|  unknown                                                 230   7e-71   Lotus japonicus
gb|ACU24178.1|  unknown                                                 229   8e-71   Glycine max [soybeans]
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            229   1e-70   Gossypium arboreum [tree cotton]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    229   2e-70   Sesamum indicum [beniseed]
gb|AAQ87021.1|  VDAC1.3                                                 228   3e-70   Lotus japonicus
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     228   3e-70   Eucalyptus grandis [rose gum]
gb|AAB38498.1|  porin                                                   228   4e-70   Mesembryanthemum crystallinum
gb|KJB11405.1|  hypothetical protein B456_001G256800                    225   7e-70   Gossypium raimondii
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    229   7e-70   Gossypium arboreum [tree cotton]
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    227   8e-70   Fragaria vesca subsp. vesca
gb|EPS68383.1|  hypothetical protein M569_06388                         227   1e-69   Genlisea aurea
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    226   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    226   2e-69   Elaeis guineensis
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    226   2e-69   Sesamum indicum [beniseed]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    226   3e-69   Elaeis guineensis
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             226   3e-69   Phaseolus vulgaris [French bean]
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    226   3e-69   Glycine max [soybeans]
gb|KJB11402.1|  hypothetical protein B456_001G256800                    225   4e-69   Gossypium raimondii
gb|KJB11404.1|  hypothetical protein B456_001G256800                    225   4e-69   Gossypium raimondii
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    225   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             224   1e-68   
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                224   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             224   1e-68   
ref|NP_001241054.1|  uncharacterized protein LOC100805016               224   2e-68   Glycine max [soybeans]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             224   2e-68   
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    223   3e-68   Elaeis guineensis
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    223   3e-68   Sesamum indicum [beniseed]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             225   4e-68   
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    223   4e-68   Eucalyptus grandis [rose gum]
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             222   6e-68   Capsella rubella
ref|NP_186777.1|  voltage dependent anion channel 1                     222   8e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    222   9e-68   Arabis alpina [alpine rockcress]
gb|AAM65525.1|  putative porin                                          221   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             221   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    221   1e-67   Brassica rapa
gb|EPS57816.1|  hypothetical protein M569_17001                         221   2e-67   Genlisea aurea
emb|CDY28690.1|  BnaCnng05760D                                          221   2e-67   Brassica napus [oilseed rape]
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         221   2e-67   Jatropha curcas
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    221   3e-67   Brassica rapa
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    221   3e-67   Phoenix dactylifera
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    220   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    220   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY66736.1|  BnaCnng52100D                                          219   6e-67   Brassica napus [oilseed rape]
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    219   7e-67   Populus euphratica
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    219   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    219   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    219   1e-66   Camelina sativa [gold-of-pleasure]
emb|CDY63765.1|  BnaCnng42590D                                          219   1e-66   Brassica napus [oilseed rape]
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    219   1e-66   Phoenix dactylifera
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    219   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    218   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    218   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    218   3e-66   Citrus sinensis [apfelsine]
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    218   3e-66   Cicer arietinum [garbanzo]
emb|CDX85566.1|  BnaA02g02470D                                          218   4e-66   
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    218   5e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    217   6e-66   Brassica rapa
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    216   1e-65   Cicer arietinum [garbanzo]
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       216   2e-65   Brassica rapa
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    216   2e-65   Setaria italica
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                216   2e-65   Erythranthe guttata [common monkey flower]
emb|CDY68122.1|  BnaA05g37480D                                          215   3e-65   Brassica napus [oilseed rape]
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             215   3e-65   Citrus clementina [clementine]
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    215   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY59668.1|  BnaCnng35410D                                          215   4e-65   Brassica napus [oilseed rape]
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    214   6e-65   Phoenix dactylifera
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    214   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11403.1|  hypothetical protein B456_001G256800                    214   8e-65   Gossypium raimondii
emb|CDX91952.1|  BnaC03g32540D                                          214   8e-65   
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            214   1e-64   Brassica napus [oilseed rape]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    214   1e-64   Camelina sativa [gold-of-pleasure]
emb|CDX74294.1|  BnaA03g27530D                                          213   2e-64   
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    213   2e-64   Brassica rapa
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    213   2e-64   Brassica rapa
gb|AFK34190.1|  unknown                                                 213   3e-64   Medicago truncatula
gb|AAS48868.1|  voltage-dependent anion-selective channel               213   4e-64   Brassica rapa subsp. pekinensis [bai cai]
gb|KJB31318.1|  hypothetical protein B456_005G186100                    210   1e-63   Gossypium raimondii
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    211   2e-63   Cicer arietinum [garbanzo]
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      210   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    209   5e-63   Oryza brachyantha
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             209   6e-63   Eutrema salsugineum [saltwater cress]
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    209   7e-63   
gb|ABK24200.1|  unknown                                                 209   9e-63   Picea sitchensis
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          209   1e-62   Oryza sativa Japonica Group [Japonica rice]
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    209   1e-62   Pisum sativum [garden pea]
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          209   1e-62   
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    209   1e-62   Ricinus communis
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          208   1e-62   Sorghum bicolor [broomcorn]
ref|NP_001062983.1|  Os09g0361400                                       208   2e-62   
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          208   2e-62   Zea mays [maize]
gb|EAZ08792.1|  hypothetical protein OsI_31052                          207   4e-62   Oryza sativa Indica Group [Indian rice]
gb|ACF85328.1|  unknown                                                 207   6e-62   Zea mays [maize]
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            204   1e-61   Gossypium arboreum [tree cotton]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    206   2e-61   Arabis alpina [alpine rockcress]
gb|ACJ85279.1|  unknown                                                 205   4e-61   Medicago truncatula
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    204   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    204   5e-61   Setaria italica
pir||B55017  porin, plastid - garden pea                                204   1e-60
ref|NP_001043433.1|  Os01g0588200                                       203   2e-60   
gb|KJB29688.1|  hypothetical protein B456_005G114000                    201   2e-60   Gossypium raimondii
ref|NP_001056162.1|  Os05g0536200                                       202   3e-60   
gb|ADE76112.1|  unknown                                                 199   3e-60   Picea sitchensis
gb|EYU34672.1|  hypothetical protein MIMGU_mgv1a021682mg                197   3e-60   Erythranthe guttata [common monkey flower]
gb|AFW82970.1|  outer membrane protein porin                            199   8e-60   
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          201   1e-59   Sorghum bicolor [broomcorn]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    201   2e-59   Triticum aestivum [Canadian hard winter wheat]
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    199   2e-59   
ref|XP_006826372.1|  hypothetical protein AMTR_s00004p00132460          196   3e-59   
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    200   3e-59   Oryza brachyantha
ref|NP_001104949.1|  voltage-dependent anion channel protein2           200   4e-59   Zea mays [maize]
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 199   4e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99489.1|  predicted protein                                      199   5e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    199   5e-59   Setaria italica
emb|CDM83072.1|  unnamed protein product                                199   7e-59   Triticum aestivum [Canadian hard winter wheat]
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    198   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197013.1|  voltage dependent anion channel 3                     198   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    197   3e-58   Oryza brachyantha
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    197   3e-58   Setaria italica
dbj|BAJ99317.1|  predicted protein                                      197   8e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 195   2e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EMS47295.1|  Outer plastidial membrane protein porin                 195   2e-57   Triticum urartu
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          195   2e-57   Sorghum bicolor [broomcorn]
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    195   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141587.1|  outer plastidial membrane protein porin            194   8e-57   Zea mays [maize]
gb|EEC71387.1|  hypothetical protein OsI_03508                          194   8e-57   Oryza sativa Indica Group [Indian rice]
gb|KDO82796.1|  hypothetical protein CISIN_1g0238542mg                  187   1e-56   Citrus sinensis [apfelsine]
ref|NP_001044063.2|  Os01g0715500                                       194   1e-56   
gb|ACG25664.1|  outer plastidial membrane protein porin                 192   2e-56   Zea mays [maize]
gb|EMT20213.1|  Mitochondrial outer membrane porin                      202   4e-56   
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              203   4e-56   Triticum urartu
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    192   5e-56   Brachypodium distachyon [annual false brome]
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         192   6e-56   Zea mays [maize]
gb|KJB30164.1|  hypothetical protein B456_005G132100                    193   8e-56   Gossypium raimondii
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    191   1e-55   Zea mays [maize]
gb|ACG45954.1|  outer plastidial membrane protein porin                 190   1e-55   Zea mays [maize]
gb|AFW83107.1|  outer plastidial membrane protein porin                 190   1e-55   
ref|XP_003621109.1|  Outer plastidial membrane protein porin            190   2e-55   Medicago truncatula
gb|ACJ85253.1|  unknown                                                 190   2e-55   Medicago truncatula
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    189   3e-55   Medicago truncatula
ref|NP_001278544.1|  outer plastidial membrane protein porin            189   4e-55   Zea mays [maize]
gb|AFK38338.1|  unknown                                                 187   2e-54   Medicago truncatula
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          182   3e-52   Sorghum bicolor [broomcorn]
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    182   7e-52   Brachypodium distachyon [annual false brome]
dbj|BAD87377.1|  putative 36kDA porin II                                183   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EMS51310.1|  Mitochondrial outer membrane porin                      187   2e-51   Triticum urartu
gb|EMT02908.1|  Mitochondrial outer membrane porin                      186   9e-51   
ref|XP_001781995.1|  predicted protein                                  176   4e-50   
ref|XP_001779057.1|  predicted protein                                  173   9e-49   
gb|ABK23226.1|  unknown                                                 172   2e-48   Picea sitchensis
emb|CBI32017.3|  unnamed protein product                                171   3e-48   Vitis vinifera
emb|CDY70638.1|  BnaCnng69120D                                          168   3e-47   Brassica napus [oilseed rape]
gb|EMS67817.1|  Mitochondrial outer membrane protein porin              164   1e-46   Triticum urartu
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    167   2e-46   Cucumis melo [Oriental melon]
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             166   3e-46   Selaginella moellendorffii
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    165   5e-46   
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             165   7e-46   Selaginella moellendorffii
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    165   8e-46   Cucumis sativus [cucumbers]
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    166   2e-45   Oryza brachyantha
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    164   2e-45   
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    164   3e-45   Elaeis guineensis
ref|XP_011465744.1|  PREDICTED: mitochondrial outer membrane prot...    159   5e-45   Fragaria vesca subsp. vesca
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             162   1e-44   Selaginella moellendorffii
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    161   2e-44   
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    161   3e-44   Phoenix dactylifera
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         161   4e-44   Zea mays [maize]
gb|ADE77918.1|  unknown                                                 160   7e-44   Picea sitchensis
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    160   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB42460.1|  hypothetical protein B456_007G244300                    154   1e-43   Gossypium raimondii
ref|XP_011463658.1|  PREDICTED: mitochondrial outer membrane prot...    154   1e-43   Fragaria vesca subsp. vesca
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    159   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    157   6e-43   Phoenix dactylifera
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             157   7e-43   
emb|CDP02971.1|  unnamed protein product                                158   9e-43   Coffea canephora [robusta coffee]
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    157   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    156   3e-42   Phoenix dactylifera
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    155   5e-42   Phoenix dactylifera
emb|CDY11866.1|  BnaC03g12920D                                          155   7e-42   Brassica napus [oilseed rape]
emb|CDX88625.1|  BnaA03g10240D                                          154   1e-41   
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    154   1e-41   Brassica rapa
ref|NP_001241153.1|  uncharacterized protein LOC100818855               153   2e-41   Glycine max [soybeans]
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            153   2e-41   Glycine soja [wild soybean]
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    153   3e-41   Prunus mume [ume]
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             153   3e-41   Prunus persica
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    153   3e-41   Cicer arietinum [garbanzo]
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    153   4e-41   Fragaria vesca subsp. vesca
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    152   8e-41   Elaeis guineensis
ref|NP_001239899.1|  uncharacterized protein LOC100790578               151   1e-40   Glycine max [soybeans]
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-40   Malus domestica [apple tree]
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       153   2e-40   
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-40   
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          151   2e-40   
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-40   
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    150   3e-40   
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    150   3e-40   
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    150   3e-40   
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    149   3e-40   
gb|AHH02397.1|  putative 34 kDa outer mitochondrial membrane prot...    145   4e-40   
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    150   4e-40   
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    150   4e-40   
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              149   4e-40   
ref|NP_001049301.1|  Os03g0202200                                       150   4e-40   
gb|ABI73982.1|  voltage-dependent anion-selective channel protein       143   8e-40   
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-39   
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-39   
gb|ABR25498.1|  voltage dependent anion channel                         143   1e-39   
ref|XP_006380609.1|  VDAC2.1 family protein                             149   1e-39   
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-39   
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             149   2e-39   
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      148   2e-39   
ref|XP_010551652.1|  PREDICTED: mitochondrial outer membrane prot...    145   3e-39   
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         148   3e-39   
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      148   3e-39   
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         147   4e-39   
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    147   5e-39   
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    147   6e-39   
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    147   6e-39   
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    147   7e-39   
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    146   1e-38   
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    146   1e-38   
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             146   1e-38   
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    146   1e-38   
gb|KJB23473.1|  hypothetical protein B456_004G100400                    146   1e-38   
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    147   1e-38   
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    146   1e-38   
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    145   1e-38   
ref|XP_007018499.1|  Voltage dependent anion channel 2                  146   2e-38   
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             146   2e-38   
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    145   3e-38   
emb|CAJ42303.1|  VDAC-like porin                                        144   3e-38   
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    145   5e-38   
gb|KJB58633.1|  hypothetical protein B456_009G219700                    145   5e-38   
ref|XP_006381815.1|  VDAC3.1 family protein                             144   6e-38   
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    144   6e-38   
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     145   7e-38   
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    144   7e-38   
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     145   8e-38   
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             144   1e-37   
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    144   1e-37   
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             144   1e-37   
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    144   1e-37   
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    143   2e-37   
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          143   2e-37   
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    143   2e-37   
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             142   3e-37   
ref|XP_007047520.1|  Voltage dependent anion channel 2                  142   3e-37   
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    142   3e-37   
gb|AAQ87022.1|  VDAC2.1                                                 142   4e-37   
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             142   4e-37   
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    142   4e-37   
ref|XP_007014286.1|  Voltage dependent anion channel 4                  144   5e-37   
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       142   7e-37   
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    142   7e-37   
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    142   7e-37   
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          141   8e-37   
dbj|BAJ91367.1|  predicted protein                                      141   1e-36   
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    141   1e-36   
gb|KJB48714.1|  hypothetical protein B456_008G082900                    141   1e-36   
gb|AFK33448.1|  unknown                                                 141   1e-36   
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    140   1e-36   
ref|XP_002325061.1|  VDAC3.1 family protein                             140   2e-36   
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         140   2e-36   
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    140   2e-36   
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         140   2e-36   
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    140   2e-36   
gb|ACG30926.1|  outer mitochondrial membrane protein porin              140   2e-36   
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             141   2e-36   
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    140   2e-36   
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    140   2e-36   
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-36   
gb|ABE77194.1|  putative voltage-dependent ion channel                  141   3e-36   
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-36   
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    140   3e-36   
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-36   
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    139   4e-36   
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    139   4e-36   
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       139   6e-36   
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    139   7e-36   
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    139   7e-36   
gb|ABB16970.1|  POM30-like protein                                      139   8e-36   
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              139   8e-36   
ref|NP_200557.1|  voltage dependent anion channel 4                     139   8e-36   
emb|CAA63968.1|  pom30                                                  139   1e-35   
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              139   1e-35   
tpg|DAA43264.1|  TPA: outer membrane protein porin                      139   1e-35   
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    139   1e-35   
emb|CAN64922.1|  hypothetical protein VITISV_017201                     139   1e-35   
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      138   1e-35   
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    138   1e-35   
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    138   1e-35   
gb|KJB43907.1|  hypothetical protein B456_007G223000                    138   1e-35   
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    138   1e-35   
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             137   3e-35   
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    139   3e-35   
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             137   4e-35   
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    137   4e-35   
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         137   4e-35   
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    137   5e-35   
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    137   5e-35   
ref|XP_010029026.1|  PREDICTED: mitochondrial outer membrane prot...    135   5e-35   
gb|AAP46186.1|  PgPOR29                                                 137   6e-35   
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                137   6e-35   
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          136   7e-35   
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    136   7e-35   
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             136   7e-35   
gb|AAW22622.1|  porin-like protein                                      135   1e-34   
ref|XP_002318608.2|  hypothetical protein POPTR_0012s07210g             135   2e-34   
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    135   2e-34   
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    135   2e-34   
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    134   2e-34   
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    135   3e-34   
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    134   4e-34   
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             134   4e-34   
emb|CDX81312.1|  BnaC09g07230D                                          134   5e-34   
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    134   5e-34   
emb|CDY18662.1|  BnaA09g07330D                                          134   5e-34   
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    134   6e-34   
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    134   7e-34   
ref|NP_201551.1|  voltage dependent anion channel 2                     134   7e-34   
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    134   7e-34   
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    134   8e-34   
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         134   8e-34   
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    134   8e-34   
tpg|DAA43927.1|  TPA: outer membrane protein porin                      134   8e-34   
ref|NP_001190641.1|  voltage dependent anion channel 2                  134   8e-34   
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    134   9e-34   
emb|CDY36497.1|  BnaC03g48560D                                          133   1e-33   
ref|XP_011044010.1|  PREDICTED: mitochondrial outer membrane prot...    132   1e-33   
emb|CDY25906.1|  BnaC09g32780D                                          134   1e-33   
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    132   2e-33   
emb|CDY08723.1|  BnaA06g25010D                                          132   2e-33   
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             132   3e-33   
gb|KHN48663.1|  Mitochondrial outer membrane protein porin 1            130   4e-33   
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    134   4e-33   
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    132   4e-33   
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    132   5e-33   
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    131   5e-33   
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    131   7e-33   
ref|XP_007211055.1|  hypothetical protein PRUPE_ppa018776mg             130   9e-33   
emb|CDP02599.1|  unnamed protein product                                130   1e-32   
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    130   2e-32   
ref|XP_007155337.1|  hypothetical protein PHAVU_003G192600g             129   2e-32   
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    129   3e-32   
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             129   3e-32   
gb|EPS73591.1|  pom30 protein                                           129   3e-32   
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...    128   4e-32   
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    129   5e-32   
gb|EYU44490.1|  hypothetical protein MIMGU_mgv1a0236611mg               125   5e-32   
ref|NP_001048902.1|  Os03g0137500                                       129   6e-32   
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    129   6e-32   
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             128   8e-32   
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             129   9e-32   
gb|EEC74475.1|  hypothetical protein OsI_09925                          128   1e-31   
ref|XP_003524958.1|  PREDICTED: mitochondrial outer membrane prot...    127   1e-31   
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    127   2e-31   
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    127   2e-31   
gb|KJB34748.1|  hypothetical protein B456_006G081500                    125   3e-31   
gb|AAQ87023.1|  VDAC3.1                                                 127   4e-31   
gb|ACU23163.1|  unknown                                                 126   4e-31   
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    126   5e-31   
emb|CDY02103.1|  BnaA03g40640D                                          126   5e-31   
gb|AFK40114.1|  unknown                                                 125   7e-31   
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             125   1e-30   
ref|XP_008239838.1|  PREDICTED: mitochondrial outer membrane prot...    124   1e-30   
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             124   2e-30   
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    124   3e-30   
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            124   4e-30   
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    124   4e-30   
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         123   5e-30   
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         123   6e-30   
ref|XP_006476654.1|  PREDICTED: mitochondrial outer membrane prot...    123   7e-30   
ref|XP_003549662.1|  PREDICTED: mitochondrial outer membrane prot...    122   9e-30   
gb|EEE58291.1|  hypothetical protein OsJ_09329                          128   1e-29   
gb|KDP31208.1|  hypothetical protein JCGZ_11584                         122   1e-29   
gb|ACU19720.1|  unknown                                                 120   1e-29   
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             122   1e-29   
ref|NP_001242630.1|  uncharacterized protein LOC100797369               122   1e-29   
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    122   1e-29   
ref|XP_007037222.1|  Porin/voltage-dependent anion-selective chan...    121   2e-29   
emb|CDY59666.1|  BnaCnng35390D                                          116   4e-29   
gb|ACJ85119.1|  unknown                                                 121   5e-29   
gb|KHN18528.1|  Mitochondrial outer membrane protein porin 1            122   6e-29   
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    120   8e-29   
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    120   9e-29   
ref|NP_001242891.1|  uncharacterized protein LOC100790270               120   1e-28   
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...    119   1e-28   
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    120   1e-28   
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    119   1e-28   
gb|KHG03239.1|  Mitochondrial outer membrane porin of 36 kDa            118   2e-28   
gb|KJB50870.1|  hypothetical protein B456_008G190600                    118   4e-28   
ref|NP_190561.1|  voltage dependent anion channel 5                     117   4e-28   
gb|EPS70241.1|  hypothetical protein M569_04517                         117   7e-28   
dbj|BAL41368.1|  porin                                                  115   7e-28   
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    117   1e-27   
ref|XP_006367075.1|  PREDICTED: mitochondrial outer membrane prot...    116   1e-27   
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                116   2e-27   
ref|XP_009801980.1|  PREDICTED: mitochondrial outer membrane prot...    115   2e-27   
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             116   3e-27   
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    117   3e-27   
emb|CDP01200.1|  unnamed protein product                                115   5e-27   
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            116   5e-27   
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    114   7e-27   
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    116   7e-27   
ref|XP_009614188.1|  PREDICTED: mitochondrial outer membrane prot...    114   8e-27   
gb|ABQ12735.1|  voltage-dependent anion channel                         109   8e-27   
ref|XP_008359117.1|  PREDICTED: mitochondrial outer membrane prot...    113   2e-26   
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              112   4e-26   
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    112   5e-26   
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5            112   7e-26   
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...    112   8e-26   
ref|XP_004301167.1|  PREDICTED: mitochondrial outer membrane prot...    108   9e-25   
ref|XP_004236191.1|  PREDICTED: mitochondrial outer membrane prot...    108   9e-25   



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNNT+ALGTD+SFDTA+G FTK NAGLSFSTSDLIASL LNDKGD L ASYYHT
Sbjct  130  NFSGVAGNNTVALGTDLSFDTASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P+TNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNNT+ALGTD+SFDTATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHT
Sbjct  130  NFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P+TNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNNT+ALGTD+SFDTATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHT
Sbjct  130  NFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P+TNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNN +ALGTDVSFDTATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHT
Sbjct  130  NFSGVAGNNIVALGTDVSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P+TNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNNT+ALGTD+SF+TA+G FTK NAGLSFSTSDLIASL LNDKGD L ASYYHT
Sbjct  130  NFSGVAGNNTVALGTDLSFNTASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P+TNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKACALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN+ LALGTDVSFDTATG FTKYNAGLSF+ SDLIA+LTLNDKGD L ASYYH+
Sbjct  130  NFSGVAGNDKLALGTDVSFDTATGNFTKYNAGLSFTNSDLIAALTLNDKGDTLTASYYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFS+NEN+LT+GTQH LDP TTVKA+VNN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSTNENSLTLGTQHLLDPLTTVKARVNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LLTISGEVDTRAIEKSAKIGLAVALKP  276



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN+ LALG D+SFDTATG FTKYNAG SF+ SDLIA+LTLNDKGD L ASYYH+
Sbjct  130  NFSGVAGNDKLALGADLSFDTATGNFTKYNAGFSFTNSDLIAALTLNDKGDTLTASYYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+H FSSNENTLTIGTQH LDP TT+KA+VNN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHGFSSNENTLTIGTQHSLDPLTTLKARVNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLAVALKP  276



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSG  GNNTLA+GTD+SFDTATG FTK+NAGL+F+ SDLIASLTLNDKGD L ASYYH+
Sbjct  130  NFSGAVGNNTLAIGTDLSFDTATGNFTKFNAGLNFTRSDLIASLTLNDKGDALTASYYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTLTIGTQH LDP TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTLKARVNNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNN +ALGTD+SFDT++G FTK NAGL+F+TSDLIASL LNDKGD L ASYYHT
Sbjct  130  NFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENT+TIGT H LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAELTHSFSSNENTMTIGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLAVALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLAVALKP  276



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN++ALGTD+SFDTATG FTK NAGLS++ +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN++ALGTD+SFDTATG FTK NAGLS++  DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHIDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTD+SFDTA+G FTK NAGLSF+ SDLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGNNLLALGTDLSFDTASGNFTKCNAGLSFTNSDLIASLTLNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAEL+HSFSSNEN LTIGTQH LDP T VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTSTAVGAELSHSFSSNENMLTIGTQHALDPLTNVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N ++LGTD+SFDTATG FTKYNAGLS++ +DLIASLT+NDKGD L ASYYHT
Sbjct  130  NFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            VRPLT+TAVGAELT SFSSNENTLTIGTQH LDP TTVKA++NN+GKA ALIQHEWRPKS
Sbjct  190  VRPLTSTAVGAELTRSFSSNENTLTIGTQHALDPLTTVKARLNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTKAIEKSAKIGLALALKP  276



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N ++LGTD+SFDTATG FTKYNAGLS++ +DLIASLT+NDKGD L ASYYHT
Sbjct  130  NFSGVIGSNVVSLGTDLSFDTATGNFTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            VRPLT+TAVGAELT SFSSNENTLTIGTQH LDP TTVKA++NN+GKA ALIQHEWRPKS
Sbjct  190  VRPLTSTAVGAELTRSFSSNENTLTIGTQHALDPLTTVKARLNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTKAIEKSAKIGLALALKP  276



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGNN +ALGTD+SFDT++G FTK NAGL+F+TSDLIASL LNDK D L ASYYHT
Sbjct  130  NFSGVAGNNKIALGTDLSFDTSSGNFTKCNAGLNFTTSDLIASLALNDKADTLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENT+TIGT H LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAELTHSFSSNENTMTIGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
            LFTISGEVDTRAIEKSAK+GLAVALK
Sbjct  250  LFTISGEVDTRAIEKSAKVGLAVALK  275



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +++GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP TTV+ ++NN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVRTRLNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G++ +ALGTD+SFDTA+G FTK NAGLS+S +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVIGSSAVALGTDLSFDTASGNFTKLNAGLSYSNTDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLT GTQH LDP TTVKA+VN++GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTFGTQHALDPLTTVKARVNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN+  A GTD+SFDTATG FTKYNAG+SF+T+DLIASL LNDKG  + ASY+HT
Sbjct  132  NFSGVAGNHKAAFGTDISFDTATGNFTKYNAGVSFTTTDLIASLILNDKGQTVTASYFHT  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + PLTNTAVGAELTHSFSSNENTLTIGTQH LDP T+VKA+VNN G+A ALIQHEWRPKS
Sbjct  192  ISPLTNTAVGAELTHSFSSNENTLTIGTQHSLDPLTSVKARVNNHGRASALIQHEWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAKIGLAVALKP
Sbjct  252  LITISGEVDTRAIEKSAKIGLAVALKP  278



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +++GTD+SFDT +G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA++NN+G+A  LIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLALALKP  276



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +++GTD+SFDT +G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  109  NFSGVVGNNCVSVGTDLSFDTGSGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  168

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA++NN+G+A  LIQHEWRPKS
Sbjct  169  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKS  228

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  229  LFTISGEVDTRAIEKSAKVGLALALKP  255



>gb|KJB50697.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=210

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN++ +GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  64   NFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  123

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKS
Sbjct  124  VSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKS  183

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT AIEKSAK+GLA+ALKP
Sbjct  184  LITISGEVDTGAIEKSAKVGLALALKP  210



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N LALGTD+SFDT TG FTK NAGLSF+ +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGSNLLALGTDLSFDTKTGNFTKVNAGLSFANADLIASLTLNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+ HSFSSNENT+T+GTQH LDP T+VKA+VNNFGKA ALIQHEWRPKS
Sbjct  190  VNPLTSTAVGAEVAHSFSSNENTITVGTQHALDPLTSVKARVNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTVSGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N +ALGTDVSFD+ TG+FTK NAGLSFS +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVFGTNVVALGTDVSFDSKTGQFTKLNAGLSFSNADLIASLTLNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+THSFS+NENT+T+GTQH LDP TTVKA+VNNFGKA+ALIQHEWRPKS
Sbjct  190  VNLLTNTAVGAEVTHSFSTNENTITVGTQHALDPLTTVKARVNNFGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTLSGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNNTL+LGTD+SFDTATG FTK NAGL FS +DLIA+LTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+H FS+NENTLTIGTQH LDP T VKA+ NN GK  ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHCFSTNENTLTIGTQHALDPLTKVKARANNSGKVSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVD RA+EKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDARAVEKSAKIGLALALKP  276



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            SFSGV GN+++++GTD+SFDTA+G F K NAGL+ + SDLIAS+TLNDKGD L ASYYH 
Sbjct  130  SFSGVIGNDSVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARMNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHT
Sbjct  130  NFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN   A GTD+SFDTATG FTK NAG+SF+T+DLIASL LNDKG+ + ASY+HT
Sbjct  132  NFSGVAGNQKAAFGTDISFDTATGNFTKCNAGVSFTTTDLIASLMLNDKGETVTASYFHT  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFS+NENTLTIGTQH LDP T+VKA+VNN+GK  ALIQHEWRPKS
Sbjct  192  VSPLTNTAVGAELTHSFSTNENTLTIGTQHLLDPLTSVKARVNNYGKVSALIQHEWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAK+GLAVALKP
Sbjct  252  LITISGEVDTRAIEKSAKVGLAVALKP  278



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            SFSGV GN+ +++GTD+SFDTA+G F K NAGL+ + SDLIAS+TLNDKGD L ASYYH 
Sbjct  130  SFSGVIGNDCVSVGTDLSFDTASGNFIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTTVKARMNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ SDLIASL LNDK D + ASYYHT
Sbjct  130  NFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKADTITASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN++ +GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT AIEKSAK+GLA+ALKP
Sbjct  250  LITISGEVDTGAIEKSAKVGLALALKP  276



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N LALGTD+SFDT TG FTK N GLSF+ +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGSNLLALGTDLSFDTKTGNFTKVNTGLSFANADLIASLTLNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+ HSFSSNENT+T+GTQH LDP T+VKA+VNNFGKA ALIQHEWRPKS
Sbjct  190  VNPLTSTAVGAEVAHSFSSNENTITVGTQHALDPLTSVKARVNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTVSGEVDTKAIEKSAKVGLALALKP  276



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN++ +GTD+SFDTA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH 
Sbjct  124  NFSGVVGNNSVTVGTDLSFDTASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHI  183

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKS
Sbjct  184  VSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKS  243

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT AIEKSAK+GLA+ALKP
Sbjct  244  LITISGEVDTGAIEKSAKVGLALALKP  270



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N +ALGTD+SFDTATG FTK NAGLS++ SDLIASLT+NDKGD L ASYYHT
Sbjct  130  NFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAELTHSFSSNEN LTIGTQH LDP TTVKA++NN+GK  ALIQ+EWRPKS
Sbjct  190  VSPLTSTAVGAELTHSFSSNENILTIGTQHALDPLTTVKARLNNYGKVSALIQNEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAK+GLA++LKP
Sbjct  250  LFTISGEVDTKAIEKSAKVGLALSLKP  276



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GN+T+ALGTD+SFDTA+G FTK NAGLS++ +DLIAS+TLNDKGD L ASYYHT
Sbjct  130  NFSGVVGNSTIALGTDLSFDTASGNFTKLNAGLSYTNADLIASVTLNDKGDTLNASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAELTHSFSSNENTLTIGT+H LDP TTVKA+ NN+G A ALIQHEWR KS
Sbjct  190  VSPLTDTAVGAELTHSFSSNENTLTIGTKHALDPLTTVKARANNYGIASALIQHEWRLKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ SDLIASL LNDK D + ASYYHTV
Sbjct  131  FSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFTHSDLIASLLLNDKADTITASYYHTV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PLTNTAVGAEL+HSFSSNEN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS 
Sbjct  191  SPLTNTAVGAELSHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSF  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  251  FTISGEVDTRAIEKSAKVGLALALKP  276



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F+ +DLIASL LNDK D + ASYYHT
Sbjct  130  NFSGVVGNNLLSLGTDLSFDTASGNFTKCNAGLNFTHTDLIASLILNDKADTVTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHT
Sbjct  130  NFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN+LTIGT+H LDP TTVK +VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENSLTIGTRHALDPLTTVKGRVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKIGLALALKP  276



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N LALGTDVSFDT TG FTK NAGLSF+  DLIASLTLNDKGD L  SYYH 
Sbjct  130  NFSGVVGSNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTLNGSYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAE++HSFS+NENT+T+GTQH LDP TTVKA+VNN GKA ALIQHEWRPKS
Sbjct  190  VNPLSNTAVGAEVSHSFSTNENTITVGTQHALDPLTTVKARVNNTGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHT
Sbjct  198  NFSGVVGNNLLSLGTDLSFDTASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHT  257

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS
Sbjct  258  VSPLTNTAVGAELSHSFSSNENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKS  317

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  318  FFTISGEVDTRAIEKSAKIGLALALKP  344



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+GV GN  L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFAGVIGNEKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHL  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAEL+HSFSSNENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAI+KSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIDKSAKIGLALALKP  276



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G +  ++GTD+SFDT+TGKF KYNAGLSFS +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGTSAASIGTDLSFDTSTGKFVKYNAGLSFSNADLIASLTLNDKGDKLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+T  FSS ENTLTIGTQH LDP T VKA++N++GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAEMTRIFSSKENTLTIGTQHALDPLTMVKARLNSYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N +ALGTD+SFDTATG FTK NAGLS++ SDLIASLT+NDKGD L ASYYHT
Sbjct  130  NFSGVVGSNVVALGTDLSFDTATGNFTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAELTHSFS+NEN LTIGTQH LDP TTVKA++NN+GK  ALIQ+EWRPK+
Sbjct  190  VSPLTSTAVGAELTHSFSNNENILTIGTQHALDPLTTVKARLNNYGKGSALIQNEWRPKA  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAK+GLA++LKP
Sbjct  250  LFTISGEVDTKAIEKSAKVGLALSLKP  276



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT TG FTK NAGLSF+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFDTKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAE++HSFS+NENT+T+GTQH LDP T VKA+VNN GKA ALIQHEWRPKS
Sbjct  190  VNPLSNTAVGAEVSHSFSTNENTITVGTQHALDPLTAVKARVNNAGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKIGLALALKP  276



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+GV GN+ L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHL  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAEL+HSFSSNENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAI+KSAKIGLA+ LKP
Sbjct  250  LFTISGEVDTRAIDKSAKIGLALVLKP  276



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN L+LGTD+SFDTA+G FTK NAGL+F   DLIASL LNDK D + ASYYHT
Sbjct  130  NFSGVVGNNLLSLGTDLSFDTASGNFTKVNAGLNFIHCDLIASLLLNDKADTITASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL HSFSSNEN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELAHSFSSNENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKVGLALALKP  276



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GN+TLALGTD+SFDTA+G FTK NAGL+F+ +DLIASL +NDK D L ASYYH 
Sbjct  130  NFSGVIGNSTLALGTDLSFDTASGNFTKCNAGLNFTNTDLIASLNVNDKADILNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTLTIGTQH LDP T+VKA+VNN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT AIEKSAK+GLA+ LKP
Sbjct  250  TVTISGEVDTSAIEKSAKLGLALVLKP  276



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN+T A GTDVSFDT TG F K NA LSF+T+DL+ASL L+DKG+ + ASY+HT
Sbjct  132  NFSGVAGNHTFAFGTDVSFDTETGNFIKSNAALSFTTADLVASLGLSDKGETVTASYFHT  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+ HSFS+NENTLTIGTQH LDP T VKA+VNN+GKA ALIQHEWRPKS
Sbjct  192  VSPLTNTAVGAEMVHSFSTNENTLTIGTQHLLDPLTAVKARVNNYGKASALIQHEWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAK+GLAVALKP
Sbjct  252  LITISGEVDTRAIEKSAKVGLAVALKP  278



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAG++  A GTDVSFDTATG FTKYNAG+SF+T+DLIAS  LNDKG  L ASY+HT
Sbjct  132  NFSGVAGSHKAAFGTDVSFDTATGNFTKYNAGVSFTTTDLIASFILNDKGQSLTASYFHT  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSF+SNENTLTIGTQH LD  T+VKA++NN+GKA ALIQH+WRPKS
Sbjct  192  VSPLTNTAVGAELTHSFTSNENTLTIGTQHSLDHLTSVKARLNNYGKASALIQHQWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAI+K+AKIGLAVALKP
Sbjct  252  LVTISGEVDTRAIDKTAKIGLAVALKP  278



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+GV GN+ L+LGTD+SFDTA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH 
Sbjct  196  NFAGVIGNDKLSLGTDLSFDTASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHL  255

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAEL+HSFSSNENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  256  VSPLSNTAVGAELSHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  315

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAI+KSAKIGLA+ LKP
Sbjct  316  LFTISGEVDTRAIDKSAKIGLALVLKP  342



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT TG  TK NAGLSF+ SDLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGTNALALGTDVSFDTKTGTLTKCNAGLSFTNSDLIASLTLNDKGDALSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+THSFS+NENT+T+GTQH LDP TT+KA+VNN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTSTAVGAEVTHSFSTNENTITLGTQHALDPLTTLKARVNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTI+GEVDT++I++SAK GLA+ LKP
Sbjct  250  LFTITGEVDTKSIDQSAKFGLALVLKP  276



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG  TK NAGLSFS +DL+A+LTLNDKGD L ASYYH+
Sbjct  129  NFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGLSFSNADLVAALTLNDKGDILSASYYHS  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAE+TH F +NENT+T+GTQH LDP T++KA+VNNFGKA ALIQHEWRPKS
Sbjct  189  VNPLSNTAVGAEVTHRFPTNENTITLGTQHALDPLTSIKARVNNFGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+SGEVDT+AIEKSAKIGLA+ALKP
Sbjct  249  FLTVSGEVDTKAIEKSAKIGLALALKP  275



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+NDKGD L ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHA  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+TH FS+NENTLT+GTQH LDP TT+KA+VNNFGKA+ALIQHEWRPKS
Sbjct  190  VNRLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTMKARVNNFGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL +ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLALKP  276



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D++FDT  G+ TK NAGLSF+  DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVIGTNVLALGADLTFDTKIGELTKSNAGLSFTKDDLIAALTLNDKGDALNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GN  L+LGTDVSFDTA+G  TK NAGL+F  +DLIASL +NDKGD L ASYY T
Sbjct  130  NFSGVVGNAALSLGTDVSFDTASGNLTKLNAGLNFIHTDLIASLLVNDKGDTLTASYYQT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+T TAVGAEL+HSFSSNENT TIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKS
Sbjct  190  VSPITCTAVGAELSHSFSSNENTFTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  LFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSG+ G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+NDKGD L ASYYH 
Sbjct  130  NFSGIVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHA  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+TH FS+NENTLT+GTQH LDP TT+KA+VNNFGKA+ALIQHEWRPKS
Sbjct  190  VNRLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTMKARVNNFGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL +ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLALKP  276



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT TG  TK NAGLSFS +DLIA+LTLNDKGD L ASYYH+
Sbjct  129  NFSGVIGTNQLALGADLSFDTKTGILTKCNAGLSFSNADLIAALTLNDKGDILSASYYHS  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAE+TH F +NENT+T+GTQH LDP TT+KA+VNNFGKA AL+QHEWRPKS
Sbjct  189  VNPLSNTAVGAEVTHRFPTNENTITLGTQHALDPMTTIKARVNNFGKASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+SGEVDT+AIEKSAKIGLA+ALKP
Sbjct  249  FLTVSGEVDTKAIEKSAKIGLALALKP  275



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG  TK NAG+SFS +DLIA+LTLNDKGD L ASYYH 
Sbjct  129  NFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVSFSNADLIAALTLNDKGDILSASYYHN  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+TH F +NENT+T+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS
Sbjct  189  VNPLANTAVGAEVTHRFPTNENTITLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT+AIEK+AKIGLA+ALKP
Sbjct  249  FVTISGEVDTKAIEKTAKIGLALALKP  275



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GN+TLALGTD+SFDTA+G FTK NAGLSF+  DLIAS+ +NDK D L ASYYH 
Sbjct  130  NFSGVFGNSTLALGTDLSFDTASGNFTKCNAGLSFTNDDLIASVNVNDKLDILNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNENTL IGTQH LDP T+VKA+VNN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAELSHSFSSNENTLNIGTQHALDPLTSVKARVNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            + TISGEVDT AIEKSAK+GLA+ LKP
Sbjct  250  IVTISGEVDTSAIEKSAKLGLALVLKP  276



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+N+KGD L ASYYHT
Sbjct  121  NFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHT  180

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+TH FS+NENTLT+GTQH LDP TTVKA+VNN GKA+ALIQHEWRP+S
Sbjct  181  VNRLTNTAVGAEVTHQFSTNENTLTLGTQHALDPLTTVKARVNNLGKANALIQHEWRPRS  240

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL +ALKP
Sbjct  241  FFTISGEVDTKAIEKSAKVGLGLALKP  267



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTDVSFDT  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH 
Sbjct  130  NFSGVVGTNLLSLGTDVSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGDSLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT TAVGAE+THSFS+NENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKS
Sbjct  190  VSPLTMTAVGAEVTHSFSTNENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV GN T ALGTDV+FDTAT K TK NAG SF+TSDLIA+ T+NDKG+ L ASYYHTV
Sbjct  131  FSGVLGNETFALGTDVAFDTATSKLTKCNAGFSFTTSDLIAAATVNDKGNTLTASYYHTV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PLT T+VGAEL+HS S+NENTLTIGTQH LDP TTVK ++NNFGKA ALIQHEWRPKSL
Sbjct  191  SPLTRTSVGAELSHSLSTNENTLTIGTQHSLDPLTTVKGRLNNFGKASALIQHEWRPKSL  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FT+ GEVD RAIEKSAK+GL+VALKP
Sbjct  251  FTLCGEVDARAIEKSAKVGLSVALKP  276



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G+ TK+NAGL+F+  DL+ASLT+N+KGD L ASYYHT
Sbjct  130  NFSGVVGTNVLALGTDVSFDTKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+TH FS+NENTLT+GTQH LDP TTVKA+VNN GKA+ALIQHEWRP+S
Sbjct  190  VNRLTNTAVGAEVTHQFSTNENTLTLGTQHALDPLTTVKARVNNLGKANALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL +ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLALKP  276



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LNDKGD L ASYYHT
Sbjct  130  NFSGVVGTNILALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P T+T VGAE+TH FS+NENT+T+GTQH+LDP T+VKA+VNNFGKA AL+QHEWRPKS
Sbjct  190  VSPFTSTVVGAEVTHCFSTNENTITVGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++++K AK GLA+ALKP
Sbjct  250  LFTISGEVDTKSVDKGAKFGLALALKP  276



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIASLTLN+KGD L ASYYH 
Sbjct  130  NLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+TNTAVGAE+THSFS+NENT+TIGTQH LDP T VKA+VNN GKA ALIQHEWRP+S
Sbjct  190  VNPMTNTAVGAEVTHSFSTNENTITIGTQHALDPLTMVKARVNNAGKASALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT++I+KSAK+GLA+ALKP
Sbjct  250  LITISGEVDTKSIDKSAKVGLALALKP  276



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIASLTLN+KGD L ASYYH 
Sbjct  130  NLSGVIGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+TNTAVGAE+THSFS+NENT+TIGTQH LDP T VKA+VNN G A ALIQHEWRP+S
Sbjct  190  VNPMTNTAVGAEVTHSFSTNENTITIGTQHALDPLTMVKARVNNAGNASALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTKSIDKSAKVGLALALKP  276



>gb|ABB02635.1| unknown [Solanum tuberosum]
Length=171

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G  TK NAGLSF+ +DLI SL LN+KGD L ASYYH 
Sbjct  25   NFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHI  84

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+THSFS++ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKS
Sbjct  85   VTPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKS  144

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  145  LFTISGEVDTKAVDKSAKFGLALALKP  171



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL + LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLVLKP  276



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL + LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLVLKP  276



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENT+T+GTQH LDP TT+KA+VNNFGK+ ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTITLGTQHALDPLTTLKARVNNFGKSSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL++ LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLSLVLKP  276



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG  TK NAG+SFS +DLIA+LTLNDKGD L ASYYH 
Sbjct  180  NFSGVIGTNQLALGTDLSFDTKTGNLTKCNAGVSFSNADLIAALTLNDKGDILSASYYHN  239

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+TH F +NENT+T+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS
Sbjct  240  VNPLANTAVGAEVTHRFPTNENTITLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKS  299

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT+AIEK+AKIGLA+ALKP
Sbjct  300  FVTISGEVDTKAIEKTAKIGLALALKP  326



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAGLSFS  DLIAS+ LN+KGD L ASYYH 
Sbjct  130  NFSGVFGTNVLALGTDLSFDTKTGNFTKCNAGLSFSNVDLIASVALNEKGDSLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENT+T+GTQH LDP T VKA+VNN GKA ALIQHEWRP+S
Sbjct  190  VNPLTNTAVGAEVTHCFSTNENTITVGTQHALDPLTMVKARVNNAGKASALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KSAK+GLA+ALKP
Sbjct  250  LFTISGEVDTKSIDKSAKVGLALALKP  276



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G  TK NAGLSF+ +DLI SL LN+KGD L ASYYH 
Sbjct  130  NFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+THSFS+NENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKS
Sbjct  190  VTPLTSTAVGAEVTHSFSTNENTITVGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFD+  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL++ LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLSLVLKP  276



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D++FDT  G  TK NAGL F+  DLIA+LTLND+GD L ASYYH 
Sbjct  130  NFSGVIGTNVLALGADLTFDTKIGGLTKSNAGLGFTKDDLIAALTLNDRGDALNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAEVTHRFSTNENTLTLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLALALKP  276



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFD+ TG FTK NAGLSF+ +DL+ASL LNDKGD L ASYYH+
Sbjct  130  NFSGVVGTNILALGTDVSFDSKTGDFTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P T+TAVGAE+ H FS+NENT+T+GTQH+LDP T+VKA+VNNFGKA AL+QHEWRPKS
Sbjct  190  VSPFTSTAVGAEVNHCFSTNENTITVGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++++K AK GLA+ALKP
Sbjct  250  LFTISGEVDTKSVDKGAKFGLALALKP  276



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G +  ++GTD+SFDTA+G FTK+NAG S S +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGTSAASVGTDLSFDTASGNFTKFNAGASLSNADLIASLTLNDKGDTLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAELT +FSSN+NTLT GTQH LDP TTVKA++NN+GKA ALIQHEWRPKS
Sbjct  190  VSPLTHTAVGAELTRTFSSNDNTLTFGTQHALDPLTTVKARLNNYGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAK+GLA+ALKP
Sbjct  250  LLTISGEVDTRAIEKSAKVGLALALKP  276



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N +ALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LN+KGD L ASYYHT
Sbjct  130  NFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+ HSFS+NEN +T+GTQH+LDP T+VKA++NNFGKA AL+QHEWRPKS
Sbjct  190  VSPLTSTAVGAEVNHSFSTNENIITVGTQHRLDPLTSVKARINNFGKASALLQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFT+SGEVDT++++K AK GLA+ALKP
Sbjct  250  LFTVSGEVDTKSVDKGAKFGLALALKP  276



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQH+WRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHKWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL + LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLGLVLKP  276



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N +ALGTDVSFDT TG FTK NAGLSF+ +DL+ASL LN+KGD L ASYYHT
Sbjct  130  NFSGVVGTNIVALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+ HSFS+NEN +T+GTQH+LDP T+VKA++NNFGKA AL+QHEWRPKS
Sbjct  190  VSPLTSTAVGAEVNHSFSTNENIITVGTQHRLDPLTSVKARINNFGKASALLQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFT+SGEVDT++++K AK GLA+ALKP
Sbjct  250  LFTVSGEVDTKSVDKGAKFGLALALKP  276



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH 
Sbjct  130  NFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT TAV AE+THSF +NENT+T+GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKS
Sbjct  190  VSPLTMTAVSAEVTHSFCTNENTITVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTD+SFDT  G+ TK+NAGL+F+ +DLIASLT+NDKGD L ASYYH 
Sbjct  130  NFSGVVGTNALAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGDALNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTA GAE+TH FS+NENTLT+GTQH LDP T+VKA+VNN GKA+ALIQHEWR KS
Sbjct  190  VNPLTNTAFGAEVTHRFSTNENTLTLGTQHALDPLTSVKARVNNLGKANALIQHEWRAKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAKIGL +ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKIGLGLALKP  276



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +++GTD+SFDTA+G FTK NAGL+F+ SDLIAS+T+NDK D L ASYYH 
Sbjct  130  NFSGVVGNNCVSVGTDLSFDTASGNFTKLNAGLNFTHSDLIASVTVNDKCDNLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAELTHSFSSNENTLT GTQ++LDP TTVKA+ NNFG+A ALIQHE+RPKS
Sbjct  190  VSPLTNTAVGAELTHSFSSNENTLTFGTQYELDPLTTVKARWNNFGRASALIQHEFRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEKSAK+G+A+ LKP
Sbjct  250  LLTISGEVDTRAIEKSAKVGMALLLKP  276



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSG  G N +ALGTD+SFDT +G FTK NAG+SF  +DLIASLT+NDKGD + ASY+H+
Sbjct  130  NFSGTIGTNVVALGTDLSFDTKSGNFTKCNAGVSFCNADLIASLTVNDKGDAVNASYFHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE+THSFS+N+NTLT+G QHKLDP TTVKA+VNNFGKA ALIQHEWRP+S
Sbjct  190  VNLLTNTAVGAEVTHSFSTNQNTLTLGAQHKLDPLTTVKARVNNFGKASALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++K+AK+GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKTAKVGLALALKP  276



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G  TK NAGLSF+ +DLI SL LN+KGD L ASYYH 
Sbjct  130  NFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+THSFS++ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKS
Sbjct  190  VTPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH 
Sbjct  130  NFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT TAV AE+THSF +NENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKS
Sbjct  190  VSPLTMTAVSAEVTHSFCTNENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTD+SFDT  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH 
Sbjct  130  NFSGVVGTNLLSLGTDLSFDTKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT TAV AE+THSF +NENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKS
Sbjct  190  VSPLTMTAVSAEVTHSFCTNENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT  G  TK NAGL F+ +DLI SL LN+KGD L ASYYH 
Sbjct  130  NFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLRFTNADLITSLNLNNKGDSLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT+TAVGAE+THSFS++ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKS
Sbjct  190  VSPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLTTVKARVNNFGMATALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  250  LFTISGEVDTKAVDKSAKFGLALALKP  276



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFDT  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH 
Sbjct  130  NFSGVVGTNILALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTL +GTQH LDP TT+KA+V NFGK  ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLILGTQHALDPLTTLKARVTNFGKTSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAK+GL++ LKP
Sbjct  250  FFTISGEVDTKAIEKSAKVGLSLVLKP  276



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  112  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  171

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P TNTAVGAE+THSFS+N NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  172  VNPSTNTAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKS  231

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LF+ISGEVDT++I+KS K+GLA+ALKP
Sbjct  232  LFSISGEVDTKSIDKSPKVGLALALKP  258



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N  A+GTD+SFDT  G+ TK+NAGL+F+ +DLIASLT+NDKGD L ASYYH 
Sbjct  130  NFSGVVGTNARAVGTDLSFDTKIGELTKFNAGLNFTKADLIASLTVNDKGDALNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTA GAE+TH FS+NENTLT+GTQH LDP T+VKA+VNN GKA+ALIQHEWR KS
Sbjct  190  VNPLTNTAFGAEVTHRFSTNENTLTLGTQHALDPLTSVKARVNNLGKANALIQHEWRAKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSAKIGL +ALKP
Sbjct  250  FFTISGEVDTKAIEKSAKIGLGLALKP  276



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG D+SFD+  G+ TK NAGLSF+  DLIASL LNDKGD L A+YYH 
Sbjct  130  NFSGVIGTNVLALGADLSFDSKIGELTKSNAGLSFTKDDLIASLALNDKGDALNAAYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+TH FS+NENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTI GEVDT+AIEKSAK+GL++ LKP
Sbjct  250  FFTIFGEVDTKAIEKSAKVGLSLVLKP  276



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  125  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  184

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P TNTAVGAE+THSFS+N NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  185  VNPSTNTAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKS  244

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LF+ISGEVDT++I+KS K+GLA+ALKP
Sbjct  245  LFSISGEVDTKSIDKSPKVGLALALKP  271



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +ALG+DVSFDT  G F K N G SF+ +DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNKVALGSDVSFDTKEGAFVKCNFGASFTNADLIAALTLNDKGDTLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+THSFS+NENT+T+GTQH LDP T+VKA+VNNFGKA+ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGAEVTHSFSTNENTITVGTQHALDPLTSVKARVNNFGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVDT++I+KSAK G A+ALKP
Sbjct  250  LITVSTEVDTKSIDKSAKFGFALALKP  276



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSG+ GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGIIGNNLVAVGTDLSFDTASGNFTKYNAGLNVTHADLIASLTLNDKGDSLNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN LTIGTQH LDP T +KA+VNN+G+A ALIQHEW P++
Sbjct  190  VSPLTNTAVGAELSHSFSSNENILTIGTQHALDPITLLKARVNNYGRASALIQHEWNPRT  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              ++ GEVDT AIEKSAK+GLA+ALKP
Sbjct  250  RVSLVGEVDTGAIEKSAKVGLALALKP  276



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G + LALGTDVSFDT +G F K NAGLSFS +DLIASLT+NDKGD L ASYYH 
Sbjct  114  TFSGVIGTSALALGTDVSFDTKSGDFAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHL  173

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE TH FS+NENT+T+GTQH LDP T+VKA+V N GK  ALIQHEWRP+S
Sbjct  174  VNGLTNTAVGAEFTHRFSTNENTITVGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRS  233

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVD+++I+KSAK+GLA+ALKP
Sbjct  234  LFTISGEVDSKSIDKSAKVGLALALKP  260



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA GTDVSFD+ TG FTK NAGLSF+ +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVLGTNLLAFGTDVSFDSKTGNFTKCNAGLSFANADLIASLTLNDKGDTLNASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + PLT++AVGAE+ HSFS+N+NT+T+G QH +DP T +K +VNNFGKA ALIQHEWRPKS
Sbjct  190  ISPLTSSAVGAEVAHSFSTNQNTITLGAQHAIDPLTNLKGRVNNFGKATALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T S EVDT+AIEKSAK+GLA+ALKP
Sbjct  250  LVTFSAEVDTKAIEKSAKVGLALALKP  276



>gb|KJB11405.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=214

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  68   NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  127

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   TNT VGAE+THSFS+N NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  128  VNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKS  187

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KS K+GLA+ALKP
Sbjct  188  LFTISGEVDTKSIDKSPKVGLALALKP  214



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  198  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  257

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P TNTAVGAE+THSFS+N NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  258  VNPSTNTAVGAEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKS  317

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LF+ISGEVDT++I+KS K+GLA+ALKP
Sbjct  318  LFSISGEVDTKSIDKSPKVGLALALKP  344



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT +G FTK NAGL+FS +DL+ASL LN+KGD +  S+YH+
Sbjct  130  NFSGVLGTNLLALGTDVSFDTKSGNFTKCNAGLNFSNADLMASLNLNEKGDVVSGSFYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + P  NTAVGAE+TH FS++ENT+T+G QH LDP T+VKA+VNN GKA+ALIQHEWRPKS
Sbjct  190  LYPEQNTAVGAEVTHRFSNSENTITLGAQHALDPLTSVKARVNNIGKANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  250  FFTISGEVDTRAIEKSAKIGLALALKP  276



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGVAGN  +  GTDVSFDTATG FTKYNAG+SF+T+DLIASL LNDKG+ + ASY+HT
Sbjct  132  NFSGVAGNKNVFFGTDVSFDTATGNFTKYNAGISFTTADLIASLNLNDKGEKITASYFHT  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE TH+ ++ EN + +GTQH LDP T VK ++N++G+A A+IQHEWRPKS
Sbjct  192  VSPLTNTAVGAEFTHNLTTKENVVFVGTQHLLDPLTAVKGRLNSYGQASAVIQHEWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDTRAIEK+AKIGLAVALKP
Sbjct  252  LITISGEVDTRAIEKTAKIGLAVALKP  278



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G + LALGTDVSFDT +G F K NAGLSFS +DLIASLT+NDKGD L ASYYH 
Sbjct  130  TFSGVIGTSALALGTDVSFDTKSGDFAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHL  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAE TH FS+NENT+T+GTQH LDP T+VKA+V N GK  ALIQHEWRP+S
Sbjct  190  VNGLTNTAVGAEFTHRFSTNENTITVGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVD+++I+KSAK+GLA+ALKP
Sbjct  250  LFTISGEVDSKSIDKSAKVGLALALKP  276



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            S SGV G N +A+G DVSFDTA G F KYNAGLS + +DLIASLT+NDKGD + ASYYH 
Sbjct  129  SLSGVVGTNAVAVGADVSFDTAVGDFIKYNAGLSITNADLIASLTVNDKGDSVNASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL++TAVGAELTHSFSSN+NTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPKS
Sbjct  189  VSPLSSTAVGAELTHSFSSNQNTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T++GEVDT+AIEKS+K+GL++ L+P
Sbjct  249  FLTVTGEVDTKAIEKSSKVGLSLVLRP  275



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G+N LA+G+DVSFD+  G  TK N G SF+ SDLIA+LTLNDKGD L ASYYHT
Sbjct  130  NFSAVLGSNKLAVGSDVSFDSKEGAITKCNFGASFTNSDLIAALTLNDKGDTLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAE+THSFSSNENT+T+GTQH LDP T VKA+VNNFGKA ALIQHEWRPKS
Sbjct  190  VNPLTNTAVGAEVTHSFSSNENTITVGTQHSLDPLTMVKARVNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVDT++I+KSAK G+A+ALKP
Sbjct  250  LITVSTEVDTKSIDKSAKFGVALALKP  276



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   L++G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+KGD L ASYYH 
Sbjct  129  NLSGVVGTKALSVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL++TAVGAE+THSFS NENTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPKS
Sbjct  189  VNPLSSTAVGAEITHSFSGNENTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKS+K+GL++ L+P
Sbjct  249  FFTISGEVDTKAIEKSSKVGLSLVLRP  275



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGDTLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+H+FSSNEN+LTIGTQH LDP T +KA+VNN+G A ALIQH+W P++
Sbjct  190  VSPLTNTAVGAELSHNFSSNENSLTIGTQHALDPLTHLKARVNNYGLASALIQHDWNPRT  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             F++ GEVDT AI KSAK+GLAVALKP
Sbjct  250  RFSLVGEVDTGAIGKSAKVGLAVALKP  276



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +A+GTD+SFDTA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNLVAVGTDLSFDTASGNFTKYNAGLNITHADLIASLTLNDKGDNLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFS NEN LT GTQH LDP T +K++VNN+G+A ALIQH+W P++
Sbjct  190  VNPLTNTAVGAELSHSFSGNENILTFGTQHALDPLTLLKSRVNNYGRASALIQHDWTPRT  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             F++ GEVDT AIEKSAK+GLAVALKP
Sbjct  250  RFSLVGEVDTGAIEKSAKVGLAVALKP  276



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  130  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   TNT VGAE+THSFS+N NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  190  VNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KS K+GLA+ALKP
Sbjct  250  LFTISGEVDTKSIDKSPKVGLALALKP  276



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH 
Sbjct  129  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHI  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   TNT VGAE+THSFS+N NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  189  VNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KS K+GLA+ALKP
Sbjct  249  LFTISGEVDTKSIDKSPKVGLALALKP  275



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+ T+++G DV+FDTATG F KYNA LS + +DLIA+L LN+KGD L ASYYH 
Sbjct  129  NFSGVVGSKTVSVGADVAFDTATGNFIKYNASLSITNADLIAALALNNKGDSLSASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL++TAVGAELTHSFSSNENTL  GTQH LDP TT+KA+ NN+GKA ALIQHEW+PKS
Sbjct  189  VNPLSSTAVGAELTHSFSSNENTLAFGTQHALDPLTTIKARFNNYGKASALIQHEWKPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKS+KIGL++ LKP
Sbjct  249  FFTISGEVDTKAIEKSSKIGLSLVLKP  275



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH 
Sbjct  130  NFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS
Sbjct  190  VNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT++I+KSAK+GLA+ALKP
Sbjct  250  FFTISGEVDTKSIDKSAKVGLALALKP  276



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN  ++G+DVS+DT  G  TK N G SF+ +DLIASLTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGNNLFSVGSDVSYDTKEGALTKCNFGASFTNADLIASLTLNDKGDSLSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+TNTAVGAE+THSFSSNENT+T+GTQH LD  TTVKA++NNFGKA ALIQHEWRPKS
Sbjct  190  VTPVTNTAVGAEVTHSFSSNENTITVGTQHSLDSLTTVKARLNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVDT++++KSAK GLA+ALKP
Sbjct  250  LVTVSSEVDTKSVDKSAKFGLALALKP  276



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH 
Sbjct  121  NFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHI  180

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS
Sbjct  181  VNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKS  240

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+A++GLA+ALKP
Sbjct  241  FFTISGEVDTKAIDKNARVGLALALKP  267



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +A+GTD+SFDT +G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNLVAVGTDLSFDTTSGNFTKYNAGLNITHADLIASLTLNDKGDNLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTN+AVGAEL+HSFS NEN LT GTQH LDP T +KA+VNN+G+A ALIQH+W P++
Sbjct  190  VNPLTNSAVGAELSHSFSGNENILTFGTQHALDPLTLLKARVNNYGRASALIQHDWTPRT  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             F++ GEVDT AIEKSAK+GLAVALKP
Sbjct  250  RFSLVGEVDTGAIEKSAKVGLAVALKP  276



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH 
Sbjct  163  NFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHI  222

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS
Sbjct  223  VNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKS  282

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+A++GLA+ALKP
Sbjct  283  FFTISGEVDTKAIDKNARVGLALALKP  309



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             S V G    A+G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+KGD L  SYYH V
Sbjct  130  ISSVFGTKAFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSGSYYHLV  189

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL++TAVGAE+THSFSSNENTLT G QH LDP TTVKA+ NN+GKA ALIQHEWRPKS 
Sbjct  190  SPLSSTAVGAEITHSFSSNENTLTFGMQHALDPLTTVKARFNNYGKASALIQHEWRPKSF  249

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FTISGEVDT+AIEKS+K+GL++ LKP
Sbjct  250  FTISGEVDTKAIEKSSKVGLSLVLKP  275



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALG+DVSFDT  G F K N G SF+ +DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNKLALGSDVSFDTKEGAFIKCNFGASFTNADLIAALTLNDKGDTLSASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NTAVGAE+THSFS+NENT+ +GTQH LDP T+VKA++NNFGKA ALIQHEWRPKS
Sbjct  190  VSPLSNTAVGAEVTHSFSTNENTVIVGTQHSLDPLTSVKARLNNFGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVDT++I+KS K G A+ALKP
Sbjct  250  LITVSTEVDTKSIDKSPKFGFALALKP  276



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N +ALGTDVSFDT +G FTK NAGLSF+  DLIASLTLN+KGD +  SYYH 
Sbjct  195  NFSGVIGSNVVALGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNEKGDAMNLSYYHI  254

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS
Sbjct  255  VNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKS  314

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+KSAK+GLA+ALKP
Sbjct  315  FFTISGEVDTKAIDKSAKVGLALALKP  341



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+ V G+N L+LGTDVSFD+    FTK NAG+SFS +DLIASL LN+KGD L ASYYH 
Sbjct  130  NFAAVLGSNVLSLGTDVSFDSKASNFTKCNAGISFSNADLIASLALNNKGDSLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+T+TA+GAE+THSFSSN NT+T+GTQH LDP TT+KA++NN GKA ALIQHEWRP+S
Sbjct  190  VNPVTSTAIGAEVTHSFSSNVNTITVGTQHALDPLTTLKARINNSGKASALIQHEWRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFT+SGEVDT++I+KSAK+GLA+ALKP
Sbjct  250  LFTVSGEVDTKSIDKSAKVGLALALKP  276



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N +ALGTDVSF+T +G F  +NAG+SF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVVGTNVVALGTDVSFETESGNFKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NT VGAE++H+F++ EN +T+GTQH +DP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLSNTVVGAEVSHNFTTKENAITVGTQHAIDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD+RAIEKSAK+G+A+ALKP
Sbjct  250  FFTVSGEVDSRAIEKSAKVGIALALKP  276



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV G+N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+NDKGD L ASYYH V
Sbjct  131  FSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL NTAVGAE++H  SS ++T+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS 
Sbjct  191  NPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSF  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FTISGEVDT++I+KSAK+GLA+ALKP
Sbjct  251  FTISGEVDTKSIDKSAKVGLALALKP  276



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK N GLSF   DLIASLTLN+KGD L ASYYH 
Sbjct  130  NFSGVIGTNALAIGTDVSFDTKSGNFTKINGGLSFIKEDLIASLTLNEKGDLLNASYYHH  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS
Sbjct  190  VNPLFNTAVGAEVSHKFSSKDNTITVGTQHSLDPLTSVKARVNSVGIASALIQHEWKPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTI GEVDT+AI+KSAK+G A+ALKP
Sbjct  250  FFTICGEVDTKAIDKSAKVGFAIALKP  276



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV G+N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+NDKGD L ASYYH V
Sbjct  131  FSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL NTAVGAE++H  SS ++T+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS 
Sbjct  191  NPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSF  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FTISGE+DT++I+KSAK+GLA+ALKP
Sbjct  251  FTISGEIDTKSIDKSAKVGLALALKP  276



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N  +LGTD+SFDT TG F K NAG+S S  DLIASLTLNDKGD L ASYYH 
Sbjct  130  NFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNDKGDSLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT  AVGAE++HSFSSNENT+T+G QH LDP TT+KA+VNN GKA AL+QH+WRPKS
Sbjct  190  VNPLT--AVGAEVSHSFSSNENTITVGAQHALDPLTTLKARVNNAGKASALVQHQWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AIEK+AK+GLA+ALKP
Sbjct  248  FFTVSGEVDTKAIEKTAKVGLALALKP  274



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTDVSFDT +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FSS  NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS
Sbjct  190  VNPLFNTAVGAEVNHKFSSKVNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AI+KSAK+GLA++LKP
Sbjct  250  FFTVSGEVDTKAIDKSAKVGLALSLKP  276



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN  ALG+D+SFDT  G  TK+N G S+S +DLIA+L LNDKGD L ASYYH 
Sbjct  130  NFSGVLGNNAFALGSDLSFDTKEGNVTKWNFGASYSNADLIAALALNDKGDTLSASYYHL  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+TNTAVG E+THSFSSNENT+T+GTQH LDP T+VKA++NN GKA ALIQHEWRPKS
Sbjct  190  VSPVTNTAVGGEVTHSFSSNENTITVGTQHLLDPLTSVKARINNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVDTR+++KSAK GLA+ALKP
Sbjct  250  LLTLSTEVDTRSVDKSAKFGLALALKP  276



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTDVSFDT +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVVGNNLLALGTDVSFDTKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H F+S  NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS
Sbjct  190  VNPLFNTAVGAEVNHKFASKVNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AI+KSAK+GLA++LKP
Sbjct  250  FFTVSGEVDTKAIDKSAKVGLALSLKP  276



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G+N ++LGTD+SFDT +G FTK NAGLS+S +DL+A+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVIGSNAVSLGTDLSFDTKSGNFTKCNAGLSYSNADLVAALTLNDKGDSLKASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P    AVGAE++HSFS+NENT+T+G+QH LDP TT+KA+VNNFGK  ALIQHEWRPKS
Sbjct  190  VNP--THAVGAEVSHSFSTNENTVTVGSQHALDPLTTLKARVNNFGKVSALIQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT++GEVDT+AIEKS KIGLA+ALKP
Sbjct  248  FFTVTGEVDTKAIEKSTKIGLALALKP  274



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LA+GTDVSFDT +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVIGNNALAVGTDVSFDTKSGNFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FSS  NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS
Sbjct  190  VNPLFNTAVGAEVNHKFSSKVNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AI+KSAK+GLA++LKP
Sbjct  250  FFTVSGEVDTKAIDKSAKVGLALSLKP  276



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   L++G DVSFDTA+G FTKYNAGLS   +DLIA+LTLN+KGD L ASYYH 
Sbjct  129  NLSGVVGTRGLSVGADVSFDTASGNFTKYNAGLSVINADLIAALTLNNKGDSLSASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+THSFSSNENTLT GTQH LDP T VKA+ NN+GKA ALIQHEWR KS
Sbjct  189  VNPLWNTAVGAEITHSFSSNENTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRLKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT+AIEKS+K+GL++ LKP
Sbjct  249  FLTISGEVDTKAIEKSSKVGLSLVLKP  275



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNT VGAE++H+F++ EN +T+G+QH +DP T VKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VSPLTNTVVGAEVSHNFTTKENAITVGSQHAIDPLTIVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD++AIEKSAK+G+A+ALKP
Sbjct  250  FFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  +++G DV+FDTATG F KYNAGLS + +DLIASLTLN+KGD L ASYYH 
Sbjct  129  NLSGVVGSKNVSVGADVAFDTATGNFIKYNAGLSITNTDLIASLTLNNKGDSLSASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL++TAVGAEL HSFSSNENTLT GTQH LDP TT KA+ NN+GKA ALIQHEW+PKS
Sbjct  189  VNPLSSTAVGAELNHSFSSNENTLTFGTQHALDPLTTAKARFNNYGKASALIQHEWKPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT+AIE S+KIGL++ L+P
Sbjct  249  FLTISGEVDTKAIENSSKIGLSLVLRP  275



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FS+N NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P+S
Sbjct  190  VNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++LKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N  +LGTD+SFDT TG F K NAG+S S  DLIASLTLN+KGD L ASYYH 
Sbjct  130  NFSGVIGTNVASLGTDLSFDTKTGDFIKCNAGVSLSKVDLIASLTLNNKGDSLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT  AVGAE++HSFSSN+NT+TIG QH LDP TT+KA+VNN GKA AL+QHEWRPKS
Sbjct  190  VNPLT--AVGAEVSHSFSSNDNTITIGAQHALDPLTTLKARVNNAGKASALVQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVDT+AIEK+AK+GLA+ALKP
Sbjct  248  FFTVSGEVDTKAIEKTAKVGLALALKP  274



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+TNT VGAE++H+F++ EN +T+G+Q+ +DP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPVTNTVVGAEVSHNFTTKENAITVGSQYAMDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD++AIEKSAK+G+A+ALKP
Sbjct  250  FFTVSGEVDSKAIEKSAKVGIALALKP  276



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   219 bits (558),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N  ++G DVSFDTATG F K N GLS   +DLIASLT+NDKGD + ASYYH 
Sbjct  129  NLSGVVGTNVYSVGADVSFDTATGNFIKCNGGLSVINADLIASLTVNDKGDSINASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL++TAVGAELTH+FS+NEN+LT GTQH LDP T VKA++NN+GKA ALIQHEWRPKS
Sbjct  189  VSPLSSTAVGAELTHNFSTNENSLTFGTQHALDPLTIVKARLNNYGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGE+D++AIEK AK+GLA+ L+P
Sbjct  249  FFTISGEIDSKAIEKGAKVGLALVLRP  275



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH 
Sbjct  130  NFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FS+ +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS
Sbjct  190  VNPLFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALALKP  276



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTDVSF+T +G F  +NAG SF+  DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNVLALGTDVSFNTQSGGFKHFNAGFSFTKDDLIAALTLNDKGDKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NT VGAE+THSF++ +N +T+G QH +DP TTVKA++NN G A+ALIQH+WRPKS
Sbjct  190  VNPLSNTVVGAEVTHSFTTQKNAITVGAQHAIDPLTTVKARLNNDGVANALIQHQWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+SGEVD+RAIEKSAK+G A+ALKP
Sbjct  250  FITVSGEVDSRAIEKSAKVGFALALKP  276



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SGV G    A+G DVSFDTA+G FTKYNAGLS + +DLIA+LTLN+KGD L ASYYH  
Sbjct  130  LSGVFGTKGFAVGADVSFDTASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHLA  189

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL++ AVGAE+THSFSSNENTLT G Q  LDP T VKA+ NN+GKA ALIQHEWRPKS 
Sbjct  190  SPLSSAAVGAEITHSFSSNENTLTFGMQQALDPLTMVKARFNNYGKASALIQHEWRPKSF  249

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            FTISGEVDT+AIEKS+K+GL++ LKP
Sbjct  250  FTISGEVDTKAIEKSSKVGLSLVLKP  275



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTD+SFDT +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH 
Sbjct  130  NFSGVIGTNVLAVGTDISFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FS+ +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS
Sbjct  190  VNPLFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALALKP  276



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDV+F+T +G F  +NAGL+F+  DLIASL LN+KG+ L ASYY  
Sbjct  130  NFSGVVGTNVLALGTDVAFNTESGNFKHFNAGLNFTKDDLIASLILNEKGEKLNASYYQI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNT VGAE++H+F++ EN +T+GTQH +DP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLTNTVVGAEISHNFTTKENAITVGTQHAIDPLTTVKARVNNVGVANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD+RAIEKSAK+G+A+ALKP
Sbjct  250  FFTVSGEVDSRAIEKSAKVGIALALKP  276



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA+GTDVSFDT +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH 
Sbjct  130  NFSGVIGTNVLAVGTDVSFDTKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+ NTAVGAE++H FS+ +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS
Sbjct  190  VNPVFNTAVGAEVSHRFSNKDNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA+ALKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALALKP  276



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G N L+LGTD+SFD+ +G FTK NAGLSF+ +DLIASL LN+KGD L ASYYH 
Sbjct  130  NFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHF  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT  AVGAE+ HSFS+N+NT+T+GTQH LDP TT+KA+VNN G A ALIQHEWRPKS
Sbjct  190  VNPLT--AVGAEVIHSFSTNDNTITVGTQHILDPLTTLKARVNNAGIASALIQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAK GLA+ALKP
Sbjct  248  LFTISGEVDTKAIEKSAKFGLALALKP  274



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V GNN +++G+DVSFDTA+G F KYNAGL+ + +DLIASLT+NDKGD L ASYYH 
Sbjct  130  NFSSVIGNNLVSVGSDVSFDTASGNFIKYNAGLNVTHADLIASLTINDKGDTLNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+ SFSSNEN LTIGTQH LDP T +KA+VNN+G+A ALIQH+W P++
Sbjct  190  VSPLTNTAVGAELSRSFSSNENLLTIGTQHALDPITLLKARVNNYGRASALIQHDWNPRT  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              ++ GEVDT AI+KSAK+GLA+ALKP
Sbjct  250  RISLVGEVDTVAIQKSAKVGLALALKP  276



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTDVSF+T +G F ++NAG SF+  DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NT VGAE+THSF++ +N +T+G QH LDP TT+KA+VNN G A+ALIQH+WRPKS
Sbjct  190  VNPLSNTVVGAEVTHSFTTQKNAITVGAQHALDPLTTLKARVNNDGVANALIQHQWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+SGEV++RAIEK AK+G A+ALKP
Sbjct  250  FITVSGEVNSRAIEKGAKVGFALALKP  276



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N +ALGTDVSFDT TG FTKYNAGLSF++ DLIA+LT NDKG+ L AS+YH 
Sbjct  130  NFSGVIGTNMVALGTDVSFDTKTGNFTKYNAGLSFASEDLIAALTFNDKGNNLNASFYHY  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+T  ++GAE+THS S+ ENT+T+G QH LDP T VKA++NN GKA AL+QHEWRP S
Sbjct  190  VNPMTKLSIGAEVTHSLSTKENTVTLGAQHALDPLTNVKARINNLGKASALLQHEWRPMS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+S EVDTRAIEK+AK+GLA+ALKP
Sbjct  250  TVTVSAEVDTRAIEKTAKVGLALALKP  276



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G N LA GTDVSFDT +G FTK NAGLSF+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FS+N NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P+S
Sbjct  190  VNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++LKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -3

Query  656  SGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVR  477
            SG  G N +ALG D+++DT  G+FTK N GL+F+  DL+ASLTL DKGD L ASYYH V 
Sbjct  132  SGTLGTNVIALGHDLTYDTKIGEFTKLNTGLNFTKDDLVASLTLTDKGDVLNASYYHVVN  191

Query  476  PLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLF  297
             LT TAVGAE+TH FS+ ENTLT+GTQH LDP TTVKA+ NNFGKA+ALIQHEWRP+S  
Sbjct  192  HLTKTAVGAEVTHRFSNTENTLTLGTQHALDPLTTVKARFNNFGKANALIQHEWRPRSFL  251

Query  296  TISGEVDTRAIEKSAKIGLAVALKP  222
            TISGEVDT+AIEKSAK+GLA+ALKP
Sbjct  252  TISGEVDTKAIEKSAKVGLALALKP  276



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN LALGTDVSF+T +G F ++NAG SF+  DLIA+LTLNDKGD L ASYYH 
Sbjct  130  NFSGVVGNNVLALGTDVSFNTQSGDFKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NT VGAE+THSF++ +N +T+G QH LDP  T+KA+VNN G A+ALIQH+WRPKS
Sbjct  190  VNPLSNTVVGAEVTHSFTTQKNAITVGAQHALDPLATLKARVNNDGVANALIQHQWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+SGEV++RAIEK AK+G A+ALKP
Sbjct  250  FITVSGEVNSRAIEKGAKVGFALALKP  276



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G   LA+G D+S DTATG FTKYNAGLS +  DLIASL LN+KGD L A+YYH+
Sbjct  130  NLSGSFGTKALAVGADISLDTATGNFTKYNAGLSVTHEDLIASLNLNNKGDSLTAAYYHS  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LT+TAVGAELTHSFSSNENTLT GTQH LDP T +KA+ NN GKA ALIQHEWRPKS
Sbjct  190  VSQLTSTAVGAELTHSFSSNENTLTFGTQHALDPLTVLKARFNNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+ IEKS+K+G+AVALKP
Sbjct  250  LVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+GV GNN LALG+DVSFDT  G F KYN G SF+ +DLIA++TLN+K D + ASYYHT
Sbjct  130  NFAGVLGNNKLALGSDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFDSVSASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVG E THSFSS+ENT+T+GTQH LDP T VKA+VNN GK  ALIQHEWRPKS
Sbjct  190  VSPLTNTAVGGEFTHSFSSSENTITVGTQHSLDPLTNVKARVNNAGKVSALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S EVD +A +KSAK GLA+ALKP
Sbjct  250  LITVSTEVDAKAFDKSAKFGLALALKP  276



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G N LA GTDVSFDT +G FTK NAGLSF+  DL+ASLTLNDKGD + ASYYH 
Sbjct  130  NFSAVMGTNVLAAGTDVSFDTKSGNFTKINAGLSFTKDDLVASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FS+N NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S
Sbjct  190  VNPLFNTAVGAEVNHKFSTNVNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPSS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++LKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G N L+LGTD+SFD+ +G FTK NAGLSF+ +DLIASL LN+KGD L ASYYH 
Sbjct  130  NFSAVIGTNVLSLGTDLSFDSKSGNFTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHF  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLT  AVGAE+ HSFS+ +NT+T+GTQH LDP TT+KA+VNN G A ALIQHEWRPKS
Sbjct  190  VNPLT--AVGAEVIHSFSTTDNTITVGTQHILDPLTTLKARVNNAGIASALIQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAK GLA+ALKP
Sbjct  248  LFTISGEVDTKAIEKSAKFGLALALKP  274



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+ TL++G DV+FDT TGKF KYNAGLS + +DLIA+LTLN++GD L ASYYH 
Sbjct  129  NLSGAVGSKTLSVGADVAFDTTTGKFIKYNAGLSITNADLIAALTLNNRGDSLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+ L+ TAVGAELTHSFSSNENTLT GTQH LD  TTVK ++N++GKA ALIQHEW+PKS
Sbjct  189  VKSLSRTAVGAELTHSFSSNENTLTFGTQHALDRLTTVKGRINSYGKASALIQHEWKPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGE+DT+AIEKS+K+GL++ L+P
Sbjct  249  FLTISGEIDTKAIEKSSKVGLSLVLRP  275



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G + LALGTDVSFDT +G F  +NAG+SF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVIGTSVLALGTDVSFDTESGNFKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NT VGAE++H+  S  N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVD++AIEKSAK+G A+ALKP
Sbjct  250  FITISGEVDSKAIEKSAKVGFALALKP  276



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G + +A+G DVSFDTA G F K NAGLS + +DLIASLT+NDKGD + ASYYH 
Sbjct  129  NLSGVVGTDAVAVGADVSFDTANGDFIKCNAGLSITNADLIASLTVNDKGDCVNASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNE-NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPK  306
            V PL++TAVGAELTHSFSSN+ NTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPK
Sbjct  189  VSPLSSTAVGAELTHSFSSNQKNTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPK  248

Query  305  SLFTISGEVDTRAIEKSAKIGLAVALKP  222
            S  TI+GEVDT+AIEKS+K+GL++ L+P
Sbjct  249  SFLTITGEVDTKAIEKSSKVGLSLVLRP  276



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G NT A+G DVSFDTATG F K N GL+   +DLIASLT+NDKGD + ASYYH 
Sbjct  128  NLSGVVGTNTYAVGADVSFDTATGNFIKCNGGLNVINADLIASLTVNDKGDSVTASYYHL  187

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+ TAVGAELTH FSSNENT+T GTQH LDP T VKA+ NN GKA ALIQHEWRPKS
Sbjct  188  VSPLS-TAVGAELTHCFSSNENTMTFGTQHTLDPLTNVKARFNNCGKASALIQHEWRPKS  246

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVDT+AIEKSAK+GLA+ L+P
Sbjct  247  FVTISGEVDTKAIEKSAKVGLALVLRP  273



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTD+SFDT TG FTK NAG SF+ +DLIASL L   GD + ASYYH 
Sbjct  130  NFSGVLGTNVLALGTDISFDTKTGNFTKCNAGFSFTNADLIASLALY-VGDSVNASYYHI  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   TNT VGAE+THSFS+N NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKS
Sbjct  189  VNLSTNTVVGAEVTHSFSTNVNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT++I+KS K+GLA+ALKP
Sbjct  249  LFTISGEVDTKSIDKSPKVGLALALKP  275



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS  NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S
Sbjct  190  VNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++LKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLKP  276



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSFDT +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVVGTNVLALGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE+ H FS+N NT+T+GTQ+ LDP TTVKA VN+ G A +LIQH+W P+S
Sbjct  190  VNPLFNTAVGAEVNHKFSTNVNTITVGTQNSLDPLTTVKAPVNSAGIAKSLIQHQWTPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++LKP
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLKP  276



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALGTDVSF+T +G F  +NAGLSF+  DLIASL L+DKG+ L ASYY  
Sbjct  130  NFSGVVGTNVLALGTDVSFETDSGNFKHFNAGLSFTKEDLIASLILSDKGEKLNASYYQI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNT VGAE++H+F++ EN +T+G+Q+ +DP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLTNTVVGAEVSHNFTTKENAITVGSQYAIDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD++AIEKSAK+G+A+ALKP
Sbjct  250  FFTVSGEVDSKAIEKSAKVGIALALKP  276



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS  NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S
Sbjct  190  VNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++L+P
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLRP  276



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LA GTDVSFDT +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH 
Sbjct  130  NFSGVIGTNVLAAGTDVSFDTKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAE++H FSS  NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S
Sbjct  190  VNPLFNTAVGAEVSHKFSSKTNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AI+K+AK+GLA++L+P
Sbjct  250  FFTISGEVDTKAIDKNAKVGLALSLRP  276



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G + LALGTDVSFDT +G F  +N G+SF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NT VGAE++H+  S  N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVD++AIEKSAK+G A+ALKP
Sbjct  250  FITISGEVDSKAIEKSAKVGFALALKP  276



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNN +ALG D+S+DT TG FT+ NAGL+F+  DLIASLTLN+K + L ASYYH 
Sbjct  132  NFSGVIGNNVVALGGDLSYDTKTGVFTRLNAGLNFTKDDLIASLTLNEKANALNASYYHV  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+T TAVGAE++H FS+ ENTLT+GTQH +D  TT K + NNFG A  LIQHEWRPKS
Sbjct  192  VNPVTKTAVGAEVSHRFSTKENTLTLGTQHAIDSLTTAKLRFNNFGLASGLIQHEWRPKS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FTISGEVDT+AIEKSA+IG+A+ALKP
Sbjct  252  FFTISGEVDTKAIEKSARIGIALALKP  278



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G + LALGTDVSFDT +G F  +N G+SF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVIGTSVLALGTDVSFDTESGNFKHFNTGVSFTKDDLIASLTLNDKGEKLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NT VGAE++H+  S  N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VNPLKNTVVGAEVSHNLKSQVNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVD++AIEKSAK+G A+ALKP
Sbjct  250  FITISGEVDSKAIEKSAKVGFALALKP  276



>gb|KJB31318.1| hypothetical protein B456_005G186100, partial [Gossypium raimondii]
Length=247

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LALGTD+SFDT T  FTK NA LSF+ +DLIASL LN+KG+ + ASYYH 
Sbjct  101  NLSGVLGTNVLALGTDISFDTKTKNFTKCNARLSFTNADLIASLALNEKGNSINASYYHI  160

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P TNT VG E+THSFS+N NT+T+GTQH LDP TT KA+VN+ GKA  LIQH+WRPKS
Sbjct  161  VNPSTNTVVGVEVTHSFSTNVNTITVGTQHVLDPLTTTKARVNHAGKASTLIQHKWRPKS  220

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTIS EVDT++I+KS K+GLA+ALKP
Sbjct  221  LFTISREVDTKSIDKSPKVGLALALKP  247



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V G N LA+G D+SFDT  G+ TK NAGLS++  DLIASLTLN+KGD L AS+YH 
Sbjct  130  NLSSVVGTNVLAIGADLSFDTKLGELTKSNAGLSYAKDDLIASLTLNNKGDALNASFYHL  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTA G ++ H FS+ ENT T+GTQH LD  TTVKA+V N GKA ALIQHEWRPKS
Sbjct  190  VNPLTNTAFGVDVNHRFSTKENTFTLGTQHALDSLTTVKARVTNAGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            LFTISGEVDT+AIEKSAK+GL++ALKP
Sbjct  250  LFTISGEVDTKAIEKSAKVGLSLALKP  276



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G N LA+G DVS DTAT  FTKYNAGLSF+  DL ASL LN+KGD L ASYYH 
Sbjct  130  NLSGSFGTNALAVGADVSLDTATKNFTKYNAGLSFTNDDLTASLNLNNKGDSLTASYYHF  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   T TAVGAELTHSFSSNENTL  GTQH LDP T VKA++NN GKA ALIQHE+RP+S
Sbjct  190  VEKSTKTAVGAELTHSFSSNENTLIFGTQHTLDPLTLVKARINNSGKASALIQHEFRPRS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKS+K+G+AVALKP
Sbjct  250  LCTISAEVDTKAIEKSSKVGIAVALKP  276



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V G   LA+G DVS DTATG  TKYNAGLSF+  DLIASL LN+KGD L ASYYH 
Sbjct  129  NLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFTNDDLIASLNLNNKGDSLTASYYHI  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKS
Sbjct  189  VNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L+TIS EVDT+AIEKS+K+G+AVALKP
Sbjct  248  LWTISAEVDTKAIEKSSKVGIAVALKP  274



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N LALG DVSF+T +G F  +NAG SF+  DLIASLTLNDKG+ L ASYYH 
Sbjct  130  NFSGVVGTNVLALGADVSFNTESGNFKHFNAGFSFTKDDLIASLTLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL+NT VGAE++H+F++ EN +T+GTQH LDP TTVKA+VN+ G A+ALIQHEWRPKS
Sbjct  190  VNPLSNTVVGAEVSHNFTTKENAITVGTQHALDPLTTVKARVNHAGVANALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TISGEVD+++IEK+ K G A+ALKP
Sbjct  250  FVTISGEVDSKSIEKNPKFGFALALKP  276



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   209 bits (533),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S   G   LA+G ++SFD+ATG FTKYNAGL F+  DLIASL +N+KGD L  +YYH 
Sbjct  130  NLSAAFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHK  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAELTHSFS+NENTLT G QH LDP T +KA++NN GKA  LIQHEWRPKS
Sbjct  190  VSELTNTAVGAELTHSFSTNENTLTFGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+ IEKS+K+G+AVALKP
Sbjct  250  LVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV GN+T ++G +VSFDTA+G F KY+AGLSFS  D ++SLTL  KGD L ASY HTV
Sbjct  131  FSGVIGNDTFSVGGEVSFDTASGNFLKYDAGLSFSKPDFVSSLTLTGKGDTLKASYLHTV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PLT TAVGAE++HSFS +ENT TIGTQH LDP TTVK ++NN+GKA AL+QHEWRPKS 
Sbjct  191  SPLTKTAVGAEISHSFSRSENTFTIGTQHALDPLTTVKGRLNNYGKAAALLQHEWRPKSF  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+SGEVDT+A+  SAK+GL++ LKP
Sbjct  251  VTLSGEVDTKALHNSAKVGLSLILKP  276



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL LN+KGD L ASYYH 
Sbjct  129  NLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHI  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKS
Sbjct  189  VNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKARALLQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            ++TIS EVDT+AI+KS+K+G+AVALKP
Sbjct  248  VWTISAEVDTKAIDKSSKVGIAVALKP  274



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS V G N LA G D+SFDT  G+ TK NA ++F   DLI SLTLN+KGD L ASYYH 
Sbjct  130  NFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHA  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + PL+NTAVG +++H FS+ ENT T+GTQH LDP TTVK +V N GKA ALIQHEWRPKS
Sbjct  190  INPLSNTAVGVDISHRFSTKENTFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKSAKIGL++ALKP
Sbjct  250  LITISSEVDTKAIEKSAKIGLSLALKP  276



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  644  GNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTN  465
            G   LA+G ++SFD+ATG FTKYNAGL F+  DLIASL +N+KGD L  +YYH V  LTN
Sbjct  136  GTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHKVSELTN  195

Query  464  TAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISG  285
            TAVGAELTHSFS+NENTLT G QH LDP T +KA++NN GKA  LIQHEWRPKSL TIS 
Sbjct  196  TAVGAELTHSFSTNENTLTFGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKSLVTISA  255

Query  284  EVDTRAIEKSAKIGLAVALKP  222
            EVDT+ IEKS+K+G+AVALKP
Sbjct  256  EVDTKTIEKSSKVGIAVALKP  276



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N ++LGT++SFDT +G FTK NAG S+S +DLIASLTLNDKGD L ASYY  
Sbjct  130  NFSGVIGTNVVSLGTELSFDTKSGNFTKCNAGFSYSNADLIASLTLNDKGDSLKASYYQI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P+   AVGAE++HSFS+NENT+T+G+QH LDP TT+K +VNNFGKA AL QHEWRPKS
Sbjct  190  VNPVH--AVGAEVSHSFSTNENTITLGSQHALDPLTTMKTRVNNFGKASALFQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+S EVDT+AIE + KIGLA+ALKP
Sbjct  248  FITVSAEVDTKAIESNPKIGLALALKP  274



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S   G   LA+G DVS DTATG  TKYN+GL F+  DLIASL+LN++GD L  +YYH 
Sbjct  130  NLSAAFGTKALAVGADVSLDTATGNLTKYNSGLRFTHEDLIASLSLNNRGDSLTGAYYHK  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAELTHSFS+NENT+T G QH LDP T +KA++NN GKA ALIQHEWRPKS
Sbjct  190  VSELTNTAVGAELTHSFSTNENTVTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+ IEKS+K+G+AVALKP
Sbjct  250  LVTISAEVDTKTIEKSSKVGIAVALKP  276



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL LN+KGD L ASYYH V
Sbjct  130  LSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIV  189

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
               + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKS+
Sbjct  190  NH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKSV  248

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            +TIS EVDT+AI+KS+K+G+AVALKP
Sbjct  249  WTISAEVDTKAIDKSSKVGIAVALKP  274



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S   G   +ALG D+S DTATG  TKYNA L F+  DL+ASL LN+KGD L  +YYH 
Sbjct  130  NLSAAFGTKAVALGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHK  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAELTHSFS+NENTLT G QH LDP T +KA++NN GKA ALIQHEWRPKS
Sbjct  190  VSELTNTAVGAELTHSFSTNENTLTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+ IEKS+K+G+AVALKP
Sbjct  250  LVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             S V G   LA+G DVS DTATG  TKYNAGLSFS  DLIASL+LN+KGD L ASYYH V
Sbjct  130  LSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLSLNNKGDSLTASYYHIV  189

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
               + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA  NN GKA AL+QHEWRPKS+
Sbjct  190  NH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKAHFNNSGKASALLQHEWRPKSV  248

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
            +TIS EVDT+AI+KS+K+G+AVALKP
Sbjct  249  WTISAEVDTKAIDKSSKVGIAVALKP  274



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S   G   +A+G D+S DTATG  TKYNA L F+  DL+ASL LN+KGD L  +YYH 
Sbjct  130  NLSAAFGTKAVAVGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHK  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  LTNTAVGAELTHSFS+NENTLT G QH LDP T +KA++NN GKA ALIQHEWRPKS
Sbjct  190  VSELTNTAVGAELTHSFSTNENTLTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+ IEKS+K+G+AVALKP
Sbjct  250  LVTISAEVDTKTIEKSSKVGIAVALKP  276



>gb|KHG11726.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=205

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL--NDKGDFLGASYY  489
            +FSGV G N LAL  D SFDT  G FTK NAGLSF+  DLIA L L  N+KGD + ASYY
Sbjct  57   NFSGVLGTNVLALRIDTSFDTKIGNFTKCNAGLSFTNVDLIACLALHVNEKGDSVNASYY  116

Query  488  HTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRP  309
            H V P TN  VG E+THSFS+N NT+T+GTQH LDP TT+KA+ NN GKA  LIQHEW P
Sbjct  117  HIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPLTTIKAQANNAGKASVLIQHEWHP  176

Query  308  KSLFTISGEVDTRAIEKSAKIGLAVALKP  222
            KSLFTISGEVDT +I+KS  +GLA+ALKP
Sbjct  177  KSLFTISGEVDTESIDKSPNVGLALALKP  205



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +F+GV G N LALGTD SF+T TG     N GLSF+  DLIASL LNDKG+ L ASYYH 
Sbjct  130  NFAGVVGTNILALGTDASFNTETGNLKHLNFGLSFTKDDLIASLNLNDKGEKLNASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNT VGAE+ H+FS+N+NT+T+GTQH LD  TTVKA+VNN G A+ALIQH+WRPKS
Sbjct  190  VNPLTNTVVGAEVNHNFSTNQNTITVGTQHALDSLTTVKARVNNAGVANALIQHQWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              TIS E+D++AIEK+ K+G+A+ALKP
Sbjct  250  FVTISSEIDSKAIEKTPKVGIALALKP  276



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V GNN +++G+DVSF+T++G   K N GL+ + +DLIASLT+ND+GD L ASYYH 
Sbjct  130  NISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN LTIGTQH LDP T +KAKVNN+GKA ALIQH+W  ++
Sbjct  190  VSPLTNTAVGAELSHSFSSNENVLTIGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQA  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             F++ GEVDT AI+K+AK+GLA ALKP
Sbjct  250  RFSLVGEVDTAAIQKTAKVGLACALKP  276



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+P ++TAVGAEL+HSFS NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKPHSSTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
            L TISGEVDT+AIEKS K+GL++ LK
Sbjct  249  LVTISGEVDTKAIEKSTKVGLSLVLK  274



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G  T+A+G D SFDT++G  TKYNAGLS++  D +A+ TLN+KGD L ASYYH 
Sbjct  132  NLSGVFGTKTIAVGADASFDTSSGDLTKYNAGLSYNAGDFVAAATLNNKGDSLAASYYHL  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TAVG ELTHSFSSNENTLT GTQH LDP TTVKA+ NN+G A ALIQHEWRPKS
Sbjct  192  VN--STTAVGGELTHSFSSNENTLTFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKS+K+GL++ LKP
Sbjct  250  LVTISTEVDTKAIEKSSKVGLSLVLKP  276



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDTAT  FTKYNA ++F    LI SLTLN+KGD L ASYYH 
Sbjct  130  NLSGAFGSKALSVGVDVSFDTATSDFTKYNAAVNFVKDSLIGSLTLNEKGDLLSASYYHA  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + PL+NTAVG +++H FS+ EN  T+GTQH LDP TTVK +V N GKA ALIQHEWRPKS
Sbjct  190  INPLSNTAVGVDISHRFSTKENDFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
            L TIS EVDT+AIEKSAKIGL++ALK
Sbjct  250  LITISSEVDTKAIEKSAKIGLSLALK  275



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DV+FDTAT  FTKYNA LS + SDLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSDLIASLHLNNHGDTLIASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  +NTAVGAEL+HSFS NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSNTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
            L TISGEVDT+AIEKS K+GL++ LK
Sbjct  249  LITISGEVDTKAIEKSTKVGLSLVLK  274



>gb|KJB29688.1| hypothetical protein B456_005G114000, partial [Gossypium raimondii]
Length=208

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL----NDKGDFLGAS  495
            +F GV G N LALGTD+SFDT TG FTK N GLSF+  DLIASL L    N+KG  + +S
Sbjct  58   NFLGVLGTNVLALGTDISFDTKTGNFTKRNVGLSFNNPDLIASLALHVVMNEKGYPVNSS  117

Query  494  YYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEW  315
             YH V P TN  VG E+THSFS+N NT+T+GTQH LDP TT+KA+VNN   A ALIQHEW
Sbjct  118  SYHIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPLTTIKARVNNIDNASALIQHEW  177

Query  314  RPKSLFTISGEVDTRAIEKSAKIGLAVALKP  222
            RPKSLFTIS EVDT++I+KS K+ LA+ALKP
Sbjct  178  RPKSLFTISREVDTKSIDKSPKVRLALALKP  208



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            SFSGV G    A+GTDV+FDTATG FTKYNAGLS +T DL A+L LN+KGD L ASYYH 
Sbjct  136  SFSGVFGTGAFAVGTDVAFDTATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAASYYHK  195

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V     +AVGAEL HSFSSNENTLT GTQH LD  TTVKA+ NNFG A ALIQHE+RPKS
Sbjct  196  VSK--TSAVGAELAHSFSSNENTLTFGTQHALDELTTVKARFNNFGMASALIQHEFRPKS  253

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AI+KS+K+GL++ LKP
Sbjct  254  LVTISTEVDTKAIDKSSKVGLSLVLKP  280



>gb|ADE76112.1| unknown [Picea sitchensis]
Length=174

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  656  SGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVR  477
            S V GN  +ALG + +FDTA+G FTKYNAGL+F   D I+SL L D+GD L ASY HTV 
Sbjct  30   SVVIGNEGVALGGEFAFDTASGNFTKYNAGLNFVQPDFISSLNLTDRGDTLKASYLHTVS  89

Query  476  PLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLF  297
            PLT TAVGAE+ HS S NENT T+GTQH  DP TTVKA++NN GK  AL+QHEWRPKSL 
Sbjct  90   PLTKTAVGAEIAHSISRNENTFTMGTQHAFDPFTTVKARLNNHGKVAALVQHEWRPKSLI  149

Query  296  TISGEVDTRAIEKSAKIGLAVALKP  222
            T+SGEVD++A++ SAKIGL++ LKP
Sbjct  150  TLSGEVDSKALDNSAKIGLSLVLKP  174



>gb|EYU34672.1| hypothetical protein MIMGU_mgv1a021682mg, partial [Erythranthe 
guttata]
Length=133

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -3

Query  620  TDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELT  441
            +DVSFDT  G F KYN G SF+ +DLIA++TLN+K D + ASYYHTV PLTNTAVG E T
Sbjct  1    SDVSFDTKEGAFLKYNFGASFTNADLIAAVTLNNKFDLVSASYYHTVSPLTNTAVGGEFT  60

Query  440  HSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIE  261
            HSFSS+ENT+T+GTQH LDP T VKA+VNN GK  ALIQHEWRPKSL T+S EVD +A +
Sbjct  61   HSFSSSENTITVGTQHSLDPLTNVKARVNNAGKVSALIQHEWRPKSLITVSTEVDAKAFD  120

Query  260  KSAKIGLAVALKP  222
            KSAK GLA+ALKP
Sbjct  121  KSAKFGLALALKP  133



>gb|AFW82970.1| outer membrane protein porin, partial [Zea mays]
Length=206

 Score =   199 bits (506),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SGV G  T+A+G DV+FDT++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V
Sbjct  63   LSGVFGTKTVAVGADVAFDTSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSV  122

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             P   TAVG EL+HSFS+N NT+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL
Sbjct  123  SP--TTAVGGELSHSFSTNGNTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSL  180

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             TIS EVDT+AIEKS+KIGL++ LKP
Sbjct  181  VTISMEVDTKAIEKSSKIGLSLVLKP  206



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G  T+A+G D ++DT++G  TKYNAGLS++TSD +A+ TLN KGD + ASYYH 
Sbjct  132  NLSGVFGTKTIAVGADAAYDTSSGDLTKYNAGLSYTTSDFVAAATLNHKGDNIAASYYHL  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P   TAVG EL+HSFS+N NT+T GTQH LDP TTVKA+ NN+G A ALIQHEWRPKS
Sbjct  192  VSP--TTAVGGELSHSFSTNGNTITFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKS+K+GL++ LKP
Sbjct  250  LVTISAEVDTKAIEKSSKVGLSLVLKP  276



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G + LA+G DVS DTAT  F KYNA LS++  DLIASL LN+KGD L ASYYH 
Sbjct  130  NLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKGDSLTASYYHI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA++NN GKA ALIQHE+ PKS
Sbjct  190  VEK-SGTAVGAELTHSFSSNENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKS+K+G+A+ALKP
Sbjct  249  LCTISAEVDTKAIEKSSKVGIAIALKP  275



>gb|AFW82971.1| hypothetical protein ZEAMMB73_507543 [Zea mays]
Length=238

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SGV G  T+A+G DV+FDT++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V
Sbjct  95   LSGVFGTKTVAVGADVAFDTSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSV  154

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             P   TAVG EL+HSFS+N NT+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL
Sbjct  155  SP--TTAVGGELSHSFSTNGNTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSL  212

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             TIS EVDT+AIEKS+KIGL++ LKP
Sbjct  213  VTISMEVDTKAIEKSSKIGLSLVLKP  238



>ref|XP_006826372.1| hypothetical protein AMTR_s00004p00132460 [Amborella trichopoda]
 gb|ERM93609.1| hypothetical protein AMTR_s00004p00132460 [Amborella trichopoda]
Length=149

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FS   G    A GTDVSFD+ATG FTK N GLSFS +D+IASL LN+KGD L ASY+HT
Sbjct  3    NFSTTVGTGEFAFGTDVSFDSATGAFTKCNVGLSFSQADIIASLNLNNKGDTLIASYFHT  62

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PL NTAVGAEL+H+FS +++TLT+G     DP TT KAK+NN+GKA ALIQH WRPKS
Sbjct  63   VNPLKNTAVGAELSHTFSKSDDTLTLGMMQAFDPLTTFKAKINNYGKASALIQHGWRPKS  122

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS E D  AIEK+ K+GLA+ L+P
Sbjct  123  LMTISVEADAGAIEKTTKVGLAMVLRP  149



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DV+FDTAT  FTKYNA LS + S+LIAS+ LN+ GD L  SYYH 
Sbjct  129  NLSGVFGSKELSVGVDVAFDTATSNFTKYNAALSLTNSELIASMHLNNHGDTLTTSYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  +NTAVGAEL+HSFS NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSNTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
            L TISGEVDT+AIEKS K+GL++ LK
Sbjct  249  LITISGEVDTKAIEKSTKVGLSLVLK  274



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   +A+G D +FDT++G  TKYNAGLS++T D +A+ TLN+KGD + ASYYH+
Sbjct  132  NLSGVFGTKAIAVGADAAFDTSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNIAASYYHS  191

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P   TAVG EL+HSFS+N NT+T GTQH LDP TTVKA+ NN+G A ALIQHEWRPKS
Sbjct  192  VSP--TTAVGGELSHSFSTNGNTITFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKS  249

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AIEKS+K+GL++ LKP
Sbjct  250  LVTISTEVDTKAIEKSSKVGLSLVLKP  276



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G    A G DV+FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH 
Sbjct  129  NFSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKVNTLAASYYHQ  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+    TAVGAE+ HSFSSNENT+TIGTQH+LDP TTVK + NNFG A ALIQH WRPKS
Sbjct  189  VQ--RTTAVGAEIAHSFSSNENTITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKS  246

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T S EVDT+AIEKS K GLA++LKP
Sbjct  247  LITFSTEVDTKAIEKSPKFGLALSLKP  273



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLAYPDLIASLHLNNHGDTLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  ++TAVGAEL+H+F  NE+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT+AIEKS K+GL++ LKP
Sbjct  249  LVTISGEVDTKAIEKSTKVGLSLVLKP  275



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD + ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTNPDLIASLHLNNHGDTMVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HSFS NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSGTAVGAELSHSFSRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISGEVDT+AIEKS K+GL+V LK
Sbjct  249  FITISGEVDTKAIEKSTKVGLSVVLK  274



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  ++TAVGAEL+H+F  NE+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT+AIEKS K+GL++ LKP
Sbjct  249  LVTISGEVDTKAIEKSTKVGLSLVLKP  275



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTDV+++T +G F  +NAG +F+  DL ASL LNDKG+ L ASYY  
Sbjct  130  NFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P  +T VGAE++H+F++ EN +T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VSP--STVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD++AI+KSAK+G+A+ALKP
Sbjct  248  FFTVSGEVDSKAIDKSAKVGIALALKP  274



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV G N L+LGTDV+++T +G F  +NAG +F+  DL ASL LNDKG+ L ASYY  
Sbjct  130  NFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQI  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V P  +T VGAE++H+F++ EN +T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS
Sbjct  190  VSP--STVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKS  247

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+SGEVD++AI+KSAK+G+A+ALKP
Sbjct  248  FFTVSGEVDSKAIDKSAKVGIALALKP  274



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 116/147 (79%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            SFSG  G    A+G DV+FDTATG FTKYNA LS +T DL ASL LN+KGD L  SYYH+
Sbjct  137  SFSGAFGTRAFAVGADVTFDTATGDFTKYNAALSHTTEDLTASLLLNNKGDSLVTSYYHS  196

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V  ++  AVGAEL HSFSSNENTLT GTQH LD  TTVKA+ NNFG A ALIQHE+RPKS
Sbjct  197  VSKVS--AVGAELAHSFSSNENTLTFGTQHALDELTTVKARFNNFGLASALIQHEFRPKS  254

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS EVDT+AI+KS+K+GL++ LKP
Sbjct  255  LITISTEVDTKAIDKSSKVGLSLVLKP  281



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   +A+G DV++DTATG FTKYNAGL+F+ +DLIAS+TLN+KGD L ASYYH 
Sbjct  129  NLSGVFGTKAIAVGADVAYDTATGDFTKYNAGLNFTNTDLIASVTLNNKGDSLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V    NTAVGAE+T SFSS +N +T GTQH LDP+TTVKA+ N+ G A ALIQHEWRPKS
Sbjct  189  VNAEKNTAVGAEVTRSFSSKKNIVTFGTQHALDPSTTVKARYNSNGMASALIQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T++ EVDT+A EKS+K+GL++ LKP
Sbjct  249  FVTLTTEVDTKAFEKSSKVGLSLVLKP  275



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   LA G DV+FDTA+G FTKYNAG+S +  DL ASL LN+KG+ L ASYYH 
Sbjct  146  NISGVIGTKALAFGLDVAFDTASGDFTKYNAGMSHTNQDLTASLMLNNKGNTLAASYYHQ  205

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+ LT TAVGAE+ HSFSSNENT+T+GTQH+LDP TT+K + NNFG A ALIQH WRPKS
Sbjct  206  VQ-LT-TAVGAEIAHSFSSNENTITVGTQHELDPLTTLKGRYNNFGIASALIQHAWRPKS  263

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            + T S EVDT+A+EKS K GLA++LKP
Sbjct  264  VITFSTEVDTKAVEKSPKFGLALSLKP  290



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  ++TAVGAEL+H+F  NE+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWR KS
Sbjct  189  VKYTSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT+AIEKS K+GL++ LKP
Sbjct  249  LVTISGEVDTKAIEKSTKVGLSLVLKP  275



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGVFGSKELSVGVDVSFDTATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  ++TAVGAEL+H+F  NE+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWR KS
Sbjct  189  VKSHSSTAVGAELSHNFPRNESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TISGEVDT+AIEKS K+GL++ LKP
Sbjct  249  LVTISGEVDTKAIEKSTKVGLSLVLKP  275



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L  SYYH 
Sbjct  129  NISGVFGSKALSVGVDVSFDTATSNFTKYNAALSLTSPDLIASLHLNNHGDTLVGSYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISGEVDT+AIEKS K+GL++ LK
Sbjct  249  FITISGEVDTKAIEKSTKVGLSLVLK  274



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV GN ++A+G DV+ DT+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH 
Sbjct  171  NLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHL  230

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TA GAELTHSFS+ ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS
Sbjct  231  VNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKS  290

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+S EVDT+AI+K++K+GL++ LKP
Sbjct  291  FLTLSAEVDTKAIDKASKVGLSLVLKP  317



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDT T  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGAFGSKALSVGVDVSFDTETSNFTKYNAALSLANPDLIASLHLNNHGDTLVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              T+SGEVDTRAIEKS K+GL++ LK
Sbjct  249  FITVSGEVDTRAIEKSTKVGLSLVLK  274



>gb|EEC71387.1| hypothetical protein OsI_03508 [Oryza sativa Indica Group]
 gb|EEE55296.1| hypothetical protein OsJ_03247 [Oryza sativa Japonica Group]
Length=305

 Score =   194 bits (494),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV GN ++A+G DV+ DT+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH 
Sbjct  159  NLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHL  218

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TA GAELTHSFS+ ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS
Sbjct  219  VNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKS  278

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+S EVDT+AI+K++K+GL++ LKP
Sbjct  279  FLTLSAEVDTKAIDKASKVGLSLVLKP  305



>gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis]
 gb|KDO82797.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis]
Length=101

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  524  NDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFG  345
            NDKGD L ASYYH V PLTNTAVGAELTHSFSSNENTLTIGTQH LDP T+VKA+VNN+G
Sbjct  1    NDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYG  60

Query  344  KAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  222
            +A ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLA+ALKP
Sbjct  61   RASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP  101



>ref|NP_001044063.2| Os01g0715500 [Oryza sativa Japonica Group]
 dbj|BAF05977.2| Os01g0715500 [Oryza sativa Japonica Group]
Length=318

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV GN ++A+G DV+ DT+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH 
Sbjct  172  NLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHL  231

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TA GAELTHSFS+ ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS
Sbjct  232  VNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKS  291

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
              T+S EVDT+AI+K++K+GL++ LKP
Sbjct  292  FLTLSAEVDTKAIDKASKVGLSLVLKP  318



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDT +  FTKYNA LS +  DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGAFGSKALSVGVDVSFDTESSNFTKYNAALSLANPDLIASLHLNNHGDTLVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS
Sbjct  189  VKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              T+SGEVDTRAIEKS K+GL++ LK
Sbjct  249  FITVSGEVDTRAIEKSTKVGLSLVLK  274



>gb|EMT20213.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=902

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV G    A G DV+FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH V
Sbjct  759  FSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQV  818

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
            +    TAVGAE+ HSFSSNENT+T+GTQH+LDP TTVK + NNFG A ALIQH WRPKSL
Sbjct  819  Q--RTTAVGAEIAHSFSSNENTITVGTQHELDPLTTVKGRYNNFGIASALIQHAWRPKSL  876

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T S EVDT+AIEKS K GLA++LKP
Sbjct  877  ITFSTEVDTKAIEKSPKFGLALSLKP  902



>gb|EMS62963.1| Mitochondrial outer membrane protein porin [Triticum urartu]
Length=981

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FSGV G    A G DV+FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH V
Sbjct  838  FSGVIGTKAFAFGVDVAFDTASGDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQV  897

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
            +    TAVGAE+ HSFSSNENT+TIGTQH+LDP TTVK + NNFG A ALIQH WRPKSL
Sbjct  898  Q--RTTAVGAEIAHSFSSNENTITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKSL  955

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T S EVDT+AIEKS K GLA++LKP
Sbjct  956  ITFSTEVDTKAIEKSPKFGLALSLKP  981



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G   LA G DV+FDTA+G FTKYNAG+S +  DL AS+ LN+KGD L ASYY  
Sbjct  134  NLSGVLGTKDLAFGADVAFDTASGDFTKYNAGVSLTNEDLTASVVLNNKGDTLAASYYQQ  193

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+   +TAVGAEL HSFSSN NTLTIGTQH LDP TTVK + NN G A ALIQH WRP S
Sbjct  194  VK--GSTAVGAELAHSFSSNANTLTIGTQHALDPLTTVKGRFNNNGIASALIQHAWRPNS  251

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L T+S E DT+A+EKS K GLA+ALKP
Sbjct  252  LVTVSTEFDTKAMEKSPKFGLALALKP  278



>ref|NP_001152335.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|ACG47097.1| outer mitochondrial membrane protein porin [Zea mays]
Length=314

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SGV G  T+++G DV+FDT++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V
Sbjct  171  LSGVFGTKTVSVGADVAFDTSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSV  230

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             P   TAVG EL+HSFS+N +T+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL
Sbjct  231  SP--TTAVGGELSHSFSTNGSTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSL  288

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             TIS EVDT+AIEKS+KI L++ LKP
Sbjct  289  VTISMEVDTKAIEKSSKIELSLVLKP  314



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTL----NDKGDFLGAS  495
            +FSGV G N LALGTD+SF+   G FTK NAGLSF+ +DLIASL L    N+KGD + AS
Sbjct  185  NFSGVFGTNVLALGTDISFNMKFGNFTKCNAGLSFTNADLIASLALHVVMNEKGDSVNAS  244

Query  494  YYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEW  315
            YYH V P TN  VGAE+T+SF++N NT+T+GTQ+ LDP TT+KA VNN     ALIQHEW
Sbjct  245  YYHIVNPSTNIVVGAEVTYSFTTNVNTITVGTQYALDPLTTIKAWVNNASMVSALIQHEW  304

Query  314  RPKSLFTISGEVDTRAIEKSAKIGLAVALKP  222
              KSLFTI GEVDT +I+KS K+GLA+ALKP
Sbjct  305  LSKSLFTIYGEVDTESIDKSPKVGLALALKP  335



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH 
Sbjct  131  NLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHL  190

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS
Sbjct  191  VKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKS  250

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISG+VDT+AIEKS K+GL++ LK
Sbjct  251  FVTISGDVDTKAIEKSTKVGLSLVLK  276



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS
Sbjct  189  VKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISG+VDT+AIEKS K+GL++ LK
Sbjct  249  FVTISGDVDTKAIEKSTKVGLSLVLK  274



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDTAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS
Sbjct  189  VKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISG+VDT+AIEKS K+GL++ LK
Sbjct  249  FVTISGDVDTKAIEKSTKVGLSLVLK  274



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+KGD L ASYYH 
Sbjct  131  NLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHV  190

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + P+TNTAVG ++ H FS+ EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKS
Sbjct  191  INPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKS  250

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS E+DT+AIEKSAK+GL++ LKP
Sbjct  251  LITISTELDTKAIEKSAKVGLSLVLKP  277



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+KGD L ASYYH 
Sbjct  131  NLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHV  190

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + P+TNTAVG ++ H FS+ EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKS
Sbjct  191  INPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKS  250

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TIS E+DT+AIEKSAK+GL++ LKP
Sbjct  251  LITISTELDTKAIEKSAKVGLSLVLKP  277



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V GNN +++G+DVSF+T++G   K N GL+ + +DLIASLT+ND+GD L ASYYH 
Sbjct  130  NISAVLGNNLVSVGSDVSFETSSGSLNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHV  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V PLTNTAVGAEL+HSFSSNEN LTIGTQH LDP T +KAKVNN+GKA ALIQH+W  ++
Sbjct  190  VSPLTNTAVGAELSHSFSSNENVLTIGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQA  249

Query  302  LFTISGEVDTRAIEKSAK  249
             F++ GEVDT AI+K+AK
Sbjct  250  RFSLVGEVDTAAIQKTAK  267



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SG  G+  L++G DVSFDTA+  FTKYNA LS ++ DLIASL LN+ GD L ASYYH 
Sbjct  129  NLSGAFGSKALSVGVDVSFDTASSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHL  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V+  + TAVGAEL+HS S NE+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS
Sbjct  189  VKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKS  248

Query  302  LFTISGEVDTRAIEKSAKIGLAVALK  225
              TISG+VDT+AIEKS K+GL++ LK
Sbjct  249  FVTISGDVDTKAIEKSTKVGLSLVLK  274



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV G N LA G D+S+DT   + TK N G+SF   DL+ +LTLN+KGD L ASYYH 
Sbjct  131  NLSGVFGTNALAFGGDISYDTKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHV  190

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            + P+TNTAVG ++ H FS+ EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKS
Sbjct  191  INPVTNTAVGVDMGHRFSTRENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKS  250

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
            L TI  E+DT+AIEKSAK+GL++ LKP
Sbjct  251  LITIFTELDTKAIEKSAKVGLSLVLKP  277



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V GN  +A G DV++DTAT  FTKYNAGLSF+ +DLIA++TLN+KG+ L ASYYH 
Sbjct  129  NLSAVFGNKAIAAGADVAYDTATRDFTKYNAGLSFTNADLIAAVTLNNKGESLTASYYHI  188

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V    NTAVGAE+TH+FS+  +T+T GTQH LDP TTVKA+ ++ G A ALIQHEWRPKS
Sbjct  189  VNTEKNTAVGAEVTHNFSTKGSTVTFGTQHALDPTTTVKARYSSNGMASALIQHEWRPKS  248

Query  302  LFTISGEVDTRA--IEKSAKIGLAVALKP  222
             FT+S EVD  A  ++KS K+GL++ LKP
Sbjct  249  FFTLSTEVDIDASGVKKSPKVGLSLVLKP  277



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV GN  LA G DV++D+ATG FTKYNAG+S +  DL A++ LN+KGD L ASYYH+
Sbjct  183  NLSGVFGNKALAAGADVAYDSATGNFTKYNAGVSLTNEDLSAAVMLNNKGDSLTASYYHS  242

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V     TAVGAE+THSFSS ENT T G+Q+ LDP TT K + NN G    LIQHEWRPKS
Sbjct  243  VN--KETAVGAEVTHSFSSKENTFTFGSQYSLDPLTTAKLRYNNLGMVSTLIQHEWRPKS  300

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
               +S EVDT+AI+KS+KIGL++ L+P
Sbjct  301  FLALSTEVDTKAIDKSSKIGLSLVLEP  327



>dbj|BAD87377.1| putative 36kDA porin II [Oryza sativa Japonica Group]
 dbj|BAD87575.1| putative 36kDA porin II [Oryza sativa Japonica Group]
Length=379

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + SGV GN ++A+G DV+ DT+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH 
Sbjct  224  NLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHL  283

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + TA GAELTHSFS+ ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS
Sbjct  284  VNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKS  343

Query  302  LFTISGEVDTRAIEKSAKIGLA  237
              T+S EVDT+AI+K++K G+ 
Sbjct  344  FLTLSAEVDTKAIDKASKDGIV  365



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SG  G + LALG DVS DTAT  FTKYNA LS++  DLIASL LN+KGD L ASYYH V
Sbjct  132  LSGAFGTSALALGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIV  191

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
               + TAVGAELTHSFSSNEN+LT GTQH LDP T VKA++NN GKA ALIQHE+ PKSL
Sbjct  192  EK-SGTAVGAELTHSFSSNENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKSL  250

Query  299  FTISGEVDTRAIEKSAK  249
             TIS EVDT+AIEKS+K
Sbjct  251  CTISAEVDTKAIEKSSK  267



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             SG  G + LA+G DVS DTAT  FTKYNA LS++  DLIASL LN+KGD L ASYYH V
Sbjct  132  LSGAFGTSALAVGADVSLDTATKNFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIV  191

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
               + TAVGAELTHSF SNEN+LT GTQH LDP T VKA++NN GKA ALIQHE+RPKSL
Sbjct  192  EK-SGTAVGAELTHSFLSNENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFRPKSL  250

Query  299  FTISGEVDTRAIEKSAK  249
             TIS EVDT+AIEKS+K
Sbjct  251  CTISAEVDTKAIEKSSK  267



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  656  SGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVR  477
            +G  GN   ++G +++FDTA+G   KYNAG+ F   D  ASL L +KGD L ASY HTV 
Sbjct  132  TGALGNEGFSVGGELAFDTASGSLIKYNAGVGFVKPDFNASLMLAEKGDLLKASYLHTVS  191

Query  476  PLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLF  297
            P++ T V AE+ H FS NENT T+G  ++LD  TTVKA++NN GK  AL+QHEWRPKSL 
Sbjct  192  PVSRTTVAAEIAHKFSKNENTFTVGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLI  251

Query  296  TISGEVDTRAIEKSAKIGLAVALKP  222
            T SGEVDT++++K+AKIGLA+ALKP
Sbjct  252  TFSGEVDTKSLDKTAKIGLALALKP  276



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  656  SGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVR  477
            +G  GN+  ++G +V+FD+A G   KYNAG+     D  AS+ L +KGD L ASY HTV 
Sbjct  132  TGALGNDGFSVGGEVAFDSANGSLIKYNAGVGLVKPDFNASIILAEKGDLLKASYLHTVS  191

Query  476  PLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLF  297
            P++ T + AE+ H FS NENT T+G  ++LD  TTVKA++NN GK  AL+QHEWRPKSL 
Sbjct  192  PISRTTMAAEIAHRFSKNENTFTVGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLV  251

Query  296  TISGEVDTRAIEKSAKIGLAVALKP  222
            T+SGEVDT++++K+AKIGLA+ALKP
Sbjct  252  TLSGEVDTKSLDKTAKIGLALALKP  276



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -3

Query  656  SGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVR  477
            SG  G++ +++G +++FDTA+  F+KY+AG+  S  +  A++ L DKGD + ASY H V 
Sbjct  132  SGALGSDGISVGGEMAFDTASSTFSKYSAGIGVSKPEYTAAVILADKGDTVKASYTHIVN  191

Query  476  PLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLF  297
            P+T TAV AE TH FS+NENT T+G+ H +D  TT+K++++N GK  ALIQHEWRPKSL 
Sbjct  192  PITKTAVAAEFTHKFSTNENTYTVGSSHAIDRLTTMKSRLDNRGKLAALIQHEWRPKSLV  251

Query  296  TISGEVDTRAIEKSAKIGLAVALKP  222
            TISGE DT+A++KSAKIGL++ALKP
Sbjct  252  TISGEFDTKALDKSAKIGLSLALKP  276



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            +FSGV GNNTL+LGTD+SFDTATG FTK NAGL FS +DLIA+LTLNDKGD L ASYYHT
Sbjct  130  NFSGVVGNNTLSLGTDLSFDTATGNFTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHT  189

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKA  339
            V PLTNTAVGAEL+H FS+NENTLTIGTQH LDP T VKA+ NN GK 
Sbjct  190  VSPLTNTAVGAELSHCFSTNENTLTIGTQHALDPLTKVKARANNSGKV  237



>emb|CDY70638.1| BnaCnng69120D [Brassica napus]
Length=250

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 104/150 (69%), Gaps = 17/150 (11%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDV---SFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASY  492
            +FSGV G + LALGTDV   SFDT +G F  +N G+SF+  DLIA+LTLNDKG+      
Sbjct  115  NFSGVIGTSVLALGTDVYQVSFDTESGNFKHFNTGVSFTKDDLIAALTLNDKGE------  168

Query  491  YHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWR  312
                    NT VGAE+ H+  S   ++T+G QH LDP TTVKA+VNN G A+ LIQHEWR
Sbjct  169  --------NTVVGAEVNHNLKSQVISITVGAQHSLDPLTTVKARVNNAGIANPLIQHEWR  220

Query  311  PKSLFTISGEVDTRAIEKSAKIGLAVALKP  222
            PKS  TI GEVD+R IEKSAK+G  +ALKP
Sbjct  221  PKSFITIFGEVDSRGIEKSAKVGFTIALKP  250



>gb|EMS67817.1| Mitochondrial outer membrane protein porin [Triticum urartu]
Length=169

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  650  VAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPL  471
            + GN   ALG DV++D+ATG FTKYN G SF+  DL A++ LN+KGD L ASYY  V   
Sbjct  28   LVGNKAFALGADVAYDSATGDFTKYNFGASFTNDDLYAAVMLNNKGDSLSASYYQMVSN-  86

Query  470  TNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTI  291
            +  A G E++HS SS+E T T+G Q+ LDP TT K + +N G   ALIQHE RPKSL TI
Sbjct  87   SQAAAGGEVSHSLSSHETTTTLGFQYSLDPLTTTKVRYDNHGMVSALIQHELRPKSLLTI  146

Query  290  SGEVDTRAIEKSAKIGLAVALKP  222
            S E DT+AIEKS+KIGL++ LKP
Sbjct  147  SSEFDTKAIEKSSKIGLSLLLKP  169



>ref|XP_008453611.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453612.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453613.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453614.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
Length=276

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FS   G+   +LG DV FDT +  FTKYNAG+S + SD  A+L L DKG  L ASY H++
Sbjct  131  FSAAIGSKNFSLGGDVGFDTTSASFTKYNAGISLNKSDFSAALMLTDKGQALKASYIHSL  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL  T V AE+TH FS++EN+ TIG+ H LDP T +K + ++ GKA  L Q EWRPKSL
Sbjct  191  DPLNETMVAAEMTHKFSTSENSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQREWRPKSL  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+S E D++AI+ S KIGLA+ALKP
Sbjct  251  VTLSAEYDSKAIDSSPKIGLAIALKP  276



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  644  GNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTN  465
            G+N + +G + +FDTA+G FTKYNAG+  +  +  A++ + DKGD L ASY H + P T 
Sbjct  138  GSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTR  197

Query  464  TAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISG  285
            T VGAE++H  S+  NT +IG  + LD  TT+KA++NN G+  A++QHEWRPKS+ +ISG
Sbjct  198  TTVGAEISHKLSTKANTFSIGGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISISG  257

Query  284  EVDTRAIEKSAKIGLAVALKP  222
            EVDT+A+EKSAK+GLA++LKP
Sbjct  258  EVDTKALEKSAKLGLALSLKP  278



>ref|XP_004172904.1| PREDICTED: mitochondrial outer membrane protein porin 4-like, 
partial [Cucumis sativus]
Length=248

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FS   G+   +LG DV FDT +  FTKYNAG+S + SD  A+L L DKG  L ASY H++
Sbjct  103  FSAAIGSKNCSLGGDVGFDTTSASFTKYNAGISLNKSDFSAALMLTDKGQGLKASYVHSL  162

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL  T V AE+TH FS++EN+ TIG+ H LDP T +K + ++ GKA  L Q +WRPKSL
Sbjct  163  DPLNETMVAAEMTHKFSTSENSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSL  222

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+S E D++AI+ S KIGLA+ALKP
Sbjct  223  VTLSAEYDSKAIDSSPKIGLAIALKP  248



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  644  GNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTN  465
            G+N + +G + +FDTA+G FTKYNAG+  +  +  A++ + DKGD L ASY H + P T 
Sbjct  138  GSNDVVIGGEAAFDTASGNFTKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTR  197

Query  464  TAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISG  285
            T VGAE++H  S+  NT +IG  + LD  TT+KA++NN G+  A++QHEWRPKS+ ++SG
Sbjct  198  TTVGAEISHKLSTKANTFSIGGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISMSG  257

Query  284  EVDTRAIEKSAKIGLAVALKP  222
            EVDT+A+EKSAK+GLA++LKP
Sbjct  258  EVDTKALEKSAKLGLALSLKP  278



>ref|XP_004146313.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Cucumis sativus]
 gb|KGN65451.1| hypothetical protein Csa_1G423090 [Cucumis sativus]
Length=276

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
            FS   G+   +LG DV FDT +  FTKYNAG+S + SD  A+L L DKG  L ASY H++
Sbjct  131  FSAAIGSKNCSLGGDVGFDTTSASFTKYNAGISLNKSDFSAALMLTDKGQALKASYVHSL  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             PL  T V AE+TH FS++EN+ TIG+ H LDP T +K + ++ GKA  L Q +WRPKSL
Sbjct  191  DPLNETMVAAEMTHKFSTSENSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSL  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+S E D++AI+ S KIGLA+ALKP
Sbjct  251  VTLSAEYDSKAIDSSPKIGLAIALKP  276



>ref|XP_006644617.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Oryza brachyantha]
Length=323

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -3

Query  662  SFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHT  483
            + S V GN T+A+G DV+FD++T  FT+YNAGL F+T DL A+L L +KG+ L ASYY  
Sbjct  177  NLSCVFGNKTVAVGADVAFDSSTEDFTEYNAGLKFTTPDLAAALMLINKGESLAASYYQL  236

Query  482  VRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKS  303
            V   + +AVG ELTHSFS  +N+  IG  H LDP TTVK + ++ G   ALI+HEWRPK+
Sbjct  237  VNEESGSAVGGELTHSFSRKKNSFAIGALHALDPLTTVKIRYSSRGMIGALIKHEWRPKT  296

Query  302  LFTISGEVDTRAIEKSAKIGLAVALKP  222
             FT+S +VDT AI K+ ++GLAVALKP
Sbjct  297  SFTLSTQVDTNAINKAPEVGLAVALKP  323



>ref|XP_010918628.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X2 [Elaeis guineensis]
Length=271

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             +   G+  LALG +V FD+A+   TKYNAG+ F+  D  A+L L DKG+ L ASY H V
Sbjct  126  LAAAVGSKELALGVEVGFDSASASVTKYNAGIGFNKHDFSAALILADKGETLKASYVHVV  185

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             P+T  AV AE+ H F++ ENT TIG+ H LDP TT+K + NN GKA  + QHEWRPKSL
Sbjct  186  NPITGAAVAAEIVHRFNTYENTFTIGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSL  245

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+S E D +AI   +++GLA+ALKP
Sbjct  246  ITLSAEYDPKAISAPSRVGLALALKP  271



>ref|XP_010918626.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918627.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
Length=276

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = -3

Query  659  FSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTV  480
             +   G+  LALG +V FD+A+   TKYNAG+ F+  D  A+L L DKG+ L ASY H V
Sbjct  131  LAAAVGSKELALGVEVGFDSASASVTKYNAGIGFNKHDFSAALILADKGETLKASYVHVV  190

Query  479  RPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSL  300
             P+T  AV AE+ H F++ ENT TIG+ H LDP TT+K + NN GKA  + QHEWRPKSL
Sbjct  191  NPITGAAVAAEIVHRFNTYENTFTIGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSL  250

Query  299  FTISGEVDTRAIEKSAKIGLAVALKP  222
             T+S E D +AI   +++GLA+ALKP
Sbjct  251  ITLSAEYDPKAISAPSRVGLALALKP  276



>ref|XP_011465744.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=147

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -3

Query  527  LNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVKAKVNNF  348
            +N+KGD +  S+YH++ P  N  VGAE+TH FS++ENT+T+G QH LD  T+VKA+VNNF
Sbjct  46   VNEKGDVVSGSFYHSLYPEQNIVVGAEVTHRFSNSENTITLGAQHPLDSLTSVKARVNNF  105

Query  347  GKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  222
            GKA+ALIQHEWRPKS FTISGEVDTRAIEKSAKIGLA+ LKP
Sbjct  106  GKANALIQHEWRPKSFFTISGEVDTRAIEKSAKIGLALDLKP  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455