BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030M10

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...    320   3e-104   Sesamum indicum [beniseed]
emb|CDP09213.1|  unnamed protein product                                317   2e-103   Coffea canephora [robusta coffee]
gb|EPS71863.1|  hypothetical protein M569_02886                         316   5e-103   Genlisea aurea
gb|AFK36627.1|  unknown                                                 309   7e-103   Lotus japonicus
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg                316   8e-103   Erythranthe guttata [common monkey flower]
ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    316   9e-103   Cucumis melo [Oriental melon]
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...    315   1e-102   Sesamum indicum [beniseed]
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...    315   2e-102   Solanum tuberosum [potatoes]
gb|KDP22867.1|  hypothetical protein JCGZ_00454                         315   2e-102   Jatropha curcas
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...    314   3e-102   Solanum lycopersicum
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    313   7e-102   Cucumis sativus [cucumbers]
ref|XP_004156612.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    313   8e-102   
ref|XP_002530504.1|  proliferation-associated 2g4, putative             313   1e-101   Ricinus communis
gb|KHN20329.1|  Proliferation-associated protein 2G4                    308   2e-101   Glycine soja [wild soybean]
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             312   2e-101   
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...    311   4e-101   Solanum tuberosum [potatoes]
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4    311   6e-101   Glycine max [soybeans]
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...    311   6e-101   Solanum lycopersicum
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610          311   8e-101   Sorghum bicolor [broomcorn]
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...    310   1e-100   Phoenix dactylifera
ref|NP_001149216.1|  proliferation-associated protein 2G4               310   1e-100   Zea mays [maize]
ref|XP_003623305.1|  Proliferation-associated protein 2G4               310   1e-100   Medicago truncatula
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    310   2e-100   Nicotiana tomentosiformis
gb|KHN39558.1|  Proliferation-associated protein 2G4                    310   2e-100   Glycine soja [wild soybean]
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    310   2e-100   Nicotiana tomentosiformis
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    310   3e-100   Pyrus x bretschneideri [bai li]
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      310   3e-100   
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    309   3e-100   Pyrus x bretschneideri [bai li]
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    309   4e-100   Malus domestica [apple tree]
ref|NP_001241588.1|  uncharacterized protein LOC100781302               309   4e-100   Glycine max [soybeans]
ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    309   4e-100   Nicotiana sylvestris
ref|XP_010092793.1|  Proliferation-associated protein 2G4               310   4e-100   
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   309   4e-100   Citrus sinensis [apfelsine]
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...    309   5e-100   Phoenix dactylifera
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             309   5e-100   
gb|KEH38647.1|  proliferation-associated 2G4-like protein               308   6e-100   Medicago truncatula
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g             309   6e-100   Phaseolus vulgaris [French bean]
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    310   7e-100   Nicotiana tomentosiformis
gb|KJB17053.1|  hypothetical protein B456_002G262700                    308   8e-100   Gossypium raimondii
gb|ACJ85304.1|  unknown                                                 308   8e-100   Medicago truncatula
gb|KHG25370.1|  Proliferation-associated 2G4                            308   1e-99    Gossypium arboreum [tree cotton]
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    308   1e-99    Solanum lycopersicum
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...    308   1e-99    Elaeis guineensis
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    306   1e-99    
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g             308   1e-99    Phaseolus vulgaris [French bean]
gb|ABF66654.1|  EBP1                                                    307   2e-99    Ammopiptanthus mongolicus
gb|ADK78215.1|  methionine aminopeptiase                                307   2e-99    Hordeum vulgare [barley]
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    306   3e-99    Nicotiana sylvestris
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    309   3e-99    Cucumis melo [Oriental melon]
gb|KJB36949.1|  hypothetical protein B456_006G183700                    303   3e-99    Gossypium raimondii
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...    305   3e-99    
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    306   3e-99    Glycine max [soybeans]
gb|KHN42848.1|  Proliferation-associated protein 2G4                    306   3e-99    Glycine soja [wild soybean]
gb|ACU22749.1|  unknown                                                 302   4e-99    Glycine max [soybeans]
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...    306   4e-99    Setaria italica
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...    306   5e-99    Populus euphratica
gb|KHN22549.1|  Proliferation-associated protein 2G4                    304   5e-99    Glycine soja [wild soybean]
gb|KHG01253.1|  Proliferation-associated 2G4                            306   5e-99    Gossypium arboreum [tree cotton]
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    306   5e-99    Malus domestica [apple tree]
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    306   5e-99    
ref|XP_010040429.1|  PREDICTED: proliferation-associated protein ...    300   6e-99    
gb|ABK95017.1|  unknown                                                 306   7e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...    305   8e-99    
ref|NP_001275188.1|  EBP1                                               305   8e-99    Solanum tuberosum [potatoes]
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             306   1e-98    
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...    305   1e-98    Populus euphratica
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g             305   1e-98    
gb|KJB36944.1|  hypothetical protein B456_006G183700                    305   1e-98    Gossypium raimondii
gb|KJB36946.1|  hypothetical protein B456_006G183700                    304   1e-98    Gossypium raimondii
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4    305   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...    305   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36945.1|  hypothetical protein B456_006G183700                    304   2e-98    Gossypium raimondii
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...    305   2e-98    Phoenix dactylifera
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...    305   2e-98    Elaeis guineensis
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...    305   2e-98    Elaeis guineensis
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg                304   3e-98    Erythranthe guttata [common monkey flower]
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    304   3e-98    
gb|KCW45226.1|  hypothetical protein EUGRSUZ_L01140                     301   6e-98    Eucalyptus grandis [rose gum]
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648             303   7e-98    
gb|ABK24337.1|  unknown                                                 303   8e-98    Picea sitchensis
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...    303   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780              302   1e-97    
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    302   2e-97    Cicer arietinum [garbanzo]
gb|AAB80919.1|  DNA-binding protein GBP16                               301   4e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    301   4e-97    Eucalyptus grandis [rose gum]
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4    301   4e-97    Brachypodium distachyon [annual false brome]
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...    301   5e-97    
gb|AAF91445.1|AF281652_1  putative DNA binding protein                  301   5e-97    Atriplex hortensis
ref|NP_001242070.1|  uncharacterized protein LOC100784176               301   7e-97    
ref|NP_001055274.1|  Os05g0350500                                       301   7e-97    
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...    301   7e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...    301   8e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    300   9e-97    Vitis vinifera
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    300   9e-97    
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    300   1e-96    Cicer arietinum [garbanzo]
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...    301   1e-96    
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    300   1e-96    Vitis vinifera
ref|XP_001779761.1|  predicted protein                                  300   1e-96    
gb|EAY97646.1|  hypothetical protein OsI_19569                          299   2e-96    Oryza sativa Indica Group [Indian rice]
gb|EMS60472.1|  Proliferation-associated protein 2G4                    303   4e-96    Triticum urartu
gb|AHA84129.1|  DNA-binding protein GBP16                               298   5e-96    Phaseolus vulgaris [French bean]
ref|XP_001769950.1|  predicted protein                                  298   1e-95    
gb|EMT31637.1|  Proliferation-associated protein 2G4                    301   1e-95    
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...    296   4e-95    Oryza brachyantha
gb|AFG29445.1|  Erb3 binding protein                                    296   5e-95    Nervilia fordii
gb|AEY75257.1|  putative DNA binding protein                            295   8e-95    Atriplex canescens [shadscale]
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    297   2e-94    
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...    293   7e-94    Tarenaya hassleriana [spider flower]
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4    291   5e-93    Fragaria vesca subsp. vesca
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein       289   3e-92    Phaseolus vulgaris [French bean]
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    283   7e-90    Tarenaya hassleriana [spider flower]
ref|XP_009799003.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    280   2e-89    Nicotiana sylvestris
ref|XP_001765994.1|  predicted protein                                  275   5e-87    
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                    271   4e-85    Arabis alpina [alpine rockcress]
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...    269   2e-84    Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...    269   2e-84    Brassica rapa
emb|CDX73690.1|  BnaC08g23130D                                          269   2e-84    
emb|CDY16291.1|  BnaC01g23260D                                          269   2e-84    Brassica napus [oilseed rape]
emb|CDY33263.1|  BnaA01g19300D                                          269   2e-84    Brassica napus [oilseed rape]
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...    269   2e-84    Brassica rapa
emb|CDX78041.1|  BnaA09g32360D                                          269   7e-84    
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p           266   2e-83    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19507.1|  AT3G51800                                              265   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg             265   6e-83    Eutrema salsugineum [saltwater cress]
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p              265   6e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p      265   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530             265   8e-83    Arabidopsis lyrata subsp. lyrata
emb|CDY29047.1|  BnaC07g32530D                                          259   8e-81    Brassica napus [oilseed rape]
emb|CDX90633.1|  BnaA03g41480D                                          259   1e-80    
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...    259   1e-80    Brassica rapa
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p              257   8e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KCW45224.1|  hypothetical protein EUGRSUZ_L01138                     245   1e-77    Eucalyptus grandis [rose gum]
gb|EEE63363.1|  hypothetical protein OsJ_18175                          247   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...    239   7e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...    239   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...    238   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006291296.1|  hypothetical protein CARUB_v10017431mg             232   1e-71    
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg             234   6e-71    
gb|KHN18039.1|  Proliferation-associated protein 2G4                    226   2e-70    Glycine soja [wild soybean]
ref|XP_006843644.1|  hypothetical protein AMTR_s00007p00167240          227   4e-69    
ref|XP_005650680.1|  proliferation-associated protein 1                 225   3e-67    Coccomyxa subellipsoidea C-169
ref|XP_004148633.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    211   3e-63    
gb|KIZ00762.1|  hypothetical protein MNEG_7198                          211   6e-62    Monoraphidium neglectum
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416             201   2e-58    Chlamydomonas reinhardtii
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596              200   6e-58    Volvox carteri f. nagariensis
gb|AFK46635.1|  unknown                                                 191   2e-57    Medicago truncatula
ref|XP_003062941.1|  predicted protein                                  198   3e-57    Micromonas pusilla CCMP1545
ref|XP_002508417.1|  predicted protein                                  196   1e-56    Micromonas commoda
ref|XP_001422365.1|  predicted protein                                  189   7e-54    Ostreococcus lucimarinus CCE9901
ref|XP_003084394.1|  putative DNA-binding protein GBP16 (ISS)           184   6e-52    
emb|CEG00817.1|  Peptidase M24, methionine aminopeptidase               184   9e-52    Ostreococcus tauri
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591              174   7e-48    Aureococcus anophagefferens
ref|WP_028832180.1|  hypothetical protein                               173   1e-47    
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512              172   3e-47    Aureococcus anophagefferens
ref|XP_011400941.1|  Proliferation-associated protein A                 171   5e-47    Auxenochlorella protothecoides
ref|XP_010091710.1|  hypothetical protein L484_026567                   163   2e-46    
ref|XP_008619458.1|  hypothetical protein SDRG_15074                    170   3e-46    Saprolegnia diclina VS20
gb|KDO19442.1|  DNA-binding protein                                     170   3e-46    Saprolegnia parasitica CBS 223.65
gb|ETL29090.1|  DNA-binding protein, 42 kDa                             169   6e-46    Phytophthora parasitica
ref|XP_008912890.1|  DNA-binding protein, 42 kDa                        169   6e-46    Phytophthora parasitica INRA-310
ref|XP_002900555.1|  proliferation-associated protein, metallopro...    168   9e-46    Phytophthora infestans T30-4
ref|XP_009533169.1|  methionine aminopeptidase, merops subfamily M24    168   1e-45    Phytophthora sojae
ref|XP_006381246.1|  hypothetical protein POPTR_0006s10320g             164   4e-45    
ref|XP_009839077.1|  DNA-binding protein, 42 kDa                        166   4e-45    Aphanomyces astaci
gb|KJB17056.1|  hypothetical protein B456_002G262700                    163   7e-45    Gossypium raimondii
ref|XP_007026647.1|  Metallopeptidase M24 family protein isoform 2      163   8e-45    
ref|XP_008877833.1|  DNA-binding protein, 42 kDa                        165   2e-44    Aphanomyces invadans
ref|XP_007508742.1|  predicted protein                                  164   4e-44    Bathycoccus prasinos
ref|XP_010108751.1|  hypothetical protein L484_011409                   159   4e-44    
gb|ETE68956.1|  Proliferation-associated protein 2G4                    163   6e-44    Ophiophagus hannah
ref|XP_008939686.1|  PREDICTED: proliferation-associated protein 2G4    159   7e-44    Merops nubicus
gb|KFQ30813.1|  Proliferation-associated protein 2G4                    158   1e-43    Merops nubicus
ref|XP_005655696.1|  PREDICTED: proliferation-associated protein ...    158   1e-43    
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...    162   2e-43    Lepisosteus oculatus
gb|KFV57642.1|  Proliferation-associated protein 2G4                    156   2e-43    Tyto alba [Schleiereule]
gb|KFP70431.1|  Proliferation-associated protein 2G4                    158   2e-43    Acanthisitta chloris
ref|XP_003223249.1|  PREDICTED: proliferation-associated protein 2G4    162   3e-43    Anolis carolinensis [Carolina anole]
ref|XP_009073732.1|  PREDICTED: proliferation-associated protein 2G4    158   3e-43    Acanthisitta chloris
ref|XP_009970305.1|  PREDICTED: proliferation-associated protein 2G4    157   3e-43    Tyto alba [Schleiereule]
ref|XP_007423593.1|  PREDICTED: proliferation-associated protein 2G4    160   3e-43    
ref|XP_007064970.1|  PREDICTED: proliferation-associated protein 2G4    160   3e-43    
gb|EWM29247.1|  proliferation-associated protein 2g4                    166   4e-43    Nannochloropsis gaditana
ref|XP_010219357.1|  PREDICTED: proliferation-associated protein 2G4    160   4e-43    Tinamus guttatus
gb|KGL81710.1|  Proliferation-associated protein 2G4                    160   5e-43    Tinamus guttatus
ref|XP_005799891.1|  PREDICTED: proliferation-associated protein ...    161   5e-43    Xiphophorus maculatus
ref|XP_008641741.1|  PREDICTED: proliferation-associated protein 2G4    160   5e-43    Corvus brachyrhynchos
ref|XP_005431428.1|  PREDICTED: proliferation-associated protein ...    160   5e-43    Geospiza fortis
ref|XP_009685364.1|  PREDICTED: proliferation-associated protein 2G4    160   6e-43    Struthio camelus australis
gb|KFV87572.1|  Proliferation-associated protein 2G4                    160   6e-43    Struthio camelus australis
ref|XP_006131250.1|  PREDICTED: proliferation-associated protein 2G4    160   6e-43    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008003570.1|  PREDICTED: proliferation-associated protein 2G4    159   7e-43    Chlorocebus sabaeus
ref|XP_010183489.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    157   7e-43    Mesitornis unicolor
ref|XP_005876787.1|  PREDICTED: proliferation-associated protein 2G4    160   7e-43    Myotis brandtii
ref|XP_006987432.1|  PREDICTED: proliferation-associated protein 2G4    160   8e-43    
ref|XP_005826372.1|  hypothetical protein GUITHDRAFT_96731              160   1e-42    Guillardia theta CCMP2712
ref|XP_009557265.1|  PREDICTED: proliferation-associated protein 2G4    159   1e-42    Cuculus canorus
emb|CAJ82581.1|  proliferation-associated 2G4                           159   1e-42    Xenopus tropicalis [western clawed frog]
ref|XP_009485967.1|  PREDICTED: proliferation-associated protein 2G4    158   1e-42    Pelecanus crispus
gb|KFO74722.1|  Proliferation-associated protein 2G4                    158   1e-42    Cuculus canorus
gb|KFP07640.1|  Proliferation-associated protein 2G4                    159   1e-42    Calypte anna
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    160   1e-42    Chrysemys picta bellii
gb|KFO08279.1|  Proliferation-associated protein 2G4                    159   2e-42    Balearica regulorum gibbericeps
ref|XP_005235817.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    Falco peregrinus [peregrine]
ref|XP_010725225.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    Meleagris gallopavo [common turkey]
ref|XP_005499208.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    
ref|XP_005031270.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    
gb|KFR05935.1|  Proliferation-associated protein 2G4                    159   2e-42    Opisthocomus hoazin [hoatzin]
ref|XP_008500839.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    Calypte anna
gb|KGL92866.1|  Proliferation-associated protein 2G4                    158   2e-42    Charadrius vociferus
gb|KFP09829.1|  Proliferation-associated protein 2G4                    158   2e-42    Egretta garzetta
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4    160   2e-42    Pseudopodoces humilis [Tibetan ground-jay]
gb|KFV11001.1|  Proliferation-associated protein 2G4                    158   2e-42    Pterocles gutturalis
gb|KFQ63630.1|  Proliferation-associated protein 2G4                    158   2e-42    Pelecanus crispus
gb|KFM08039.1|  Proliferation-associated protein 2G4                    158   2e-42    Aptenodytes forsteri
ref|XP_007533407.1|  PREDICTED: proliferation-associated protein 2G4    159   2e-42    Erinaceus europaeus [common hedgehog]
ref|NP_001008439.1|  ErbB3-binding protein 1                            159   2e-42    Xenopus tropicalis [western clawed frog]
ref|XP_009929445.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-42    Opisthocomus hoazin [hoatzin]
ref|XP_001363571.1|  PREDICTED: proliferation-associated protein 2G4    159   2e-42    Monodelphis domestica
emb|CAA59260.1|  p38-2G4                                                158   2e-42    Mus musculus [mouse]
ref|XP_010282642.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   2e-42    Phaethon lepturus
ref|XP_009882846.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   2e-42    Charadrius vociferus
gb|KFP66746.1|  Proliferation-associated protein 2G4                    158   2e-42    Cariama cristata
gb|AAD00646.1|  erbB3 binding protein EBP1                              158   2e-42    Homo sapiens [man]
ref|XP_009701955.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   2e-42    Cariama cristata
ref|XP_009586223.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   2e-42    Fulmarus glacialis
ref|XP_423059.4|  PREDICTED: proliferation-associated protein 2G4       159   3e-42    
ref|XP_009278316.1|  PREDICTED: proliferation-associated protein 2G4    159   3e-42    Aptenodytes forsteri
gb|KFV99294.1|  Proliferation-associated protein 2G4                    158   3e-42    Fulmarus glacialis
gb|KDD75813.1|  hypothetical protein H632_c489p2                        159   3e-42    Helicosporidium sp. ATCC 50920
ref|XP_009921703.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   3e-42    Haliaeetus albicilla
gb|KFQ36395.1|  Proliferation-associated protein 2G4                    155   3e-42    Mesitornis unicolor
dbj|BAF84485.1|  unnamed protein product                                158   3e-42    Homo sapiens [man]
gb|EHB06549.1|  Proliferation-associated protein 2G4                    158   3e-42    Heterocephalus glaber [naked mole rat]
ref|XP_006908945.1|  PREDICTED: proliferation-associated protein 2G4    159   3e-42    Pteropus alecto
gb|AAH03777.1|  Pa2g4 protein                                           158   3e-42    Mus musculus [mouse]
ref|XP_004700624.1|  PREDICTED: proliferation-associated protein 2G4    159   3e-42    Echinops telfairi [lesser hedgehog tenrec]
gb|AAH32111.1|  PA2G4 protein                                           158   3e-42    Homo sapiens [man]
gb|KFO54080.1|  Proliferation-associated protein 2G4                    157   4e-42    Corvus brachyrhynchos
ref|XP_008066667.1|  PREDICTED: proliferation-associated protein 2G4    158   4e-42    
ref|NP_001085830.1|  ErbB3-binding protein 1                            159   4e-42    Xenopus laevis [clawed frog]
ref|XP_004093117.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    159   4e-42    Nomascus leucogenys [White-cheeked Gibbon]
gb|KFM70392.1|  Proliferation-associated protein 2G4                    154   4e-42    Stegodyphus mimosarum
ref|XP_008846918.1|  PREDICTED: proliferation-associated protein 2G4    159   4e-42    
gb|KFQ91587.1|  Proliferation-associated protein 2G4                    157   4e-42    Nipponia nippon
ref|NP_001004206.1|  proliferation-associated protein 2G4               159   4e-42    Rattus norvegicus [brown rat]
ref|XP_002711114.1|  PREDICTED: proliferation-associated protein 2G4    159   4e-42    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003506238.1|  PREDICTED: proliferation-associated protein 2G4    159   4e-42    Cricetulus griseus [Chinese hamsters]
ref|XP_002752647.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    Callithrix jacchus [common marmoset]
ref|NP_006182.2|  proliferation-associated protein 2G4                  158   5e-42    Homo sapiens [man]
ref|XP_010348255.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    Saimiri boliviensis boliviensis
ref|NP_001271715.1|  uncharacterized protein LOC101867185               158   5e-42    Macaca fascicularis [crab eating macaque]
gb|ELR50756.1|  Proliferation-associated protein 2G4                    159   5e-42    Bos mutus
ref|NP_035249.1|  proliferation-associated protein 2G4                  158   5e-42    Mus musculus [mouse]
dbj|BAE25986.1|  unnamed protein product                                158   5e-42    Mus musculus [mouse]
ref|XP_009179195.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    
ref|XP_006165654.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    Tupaia chinensis
gb|KFU89768.1|  Proliferation-associated protein 2G4                    157   5e-42    Chaetura pelagica
gb|ADT71645.1|  proliferation associated 2G4                            158   5e-42    Mesocricetus auratus [Syrian golden hamster]
ref|XP_004692692.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    Condylura cristata
ref|NP_001029871.1|  proliferation-associated protein 2G4               158   5e-42    Bos taurus [bovine]
ref|XP_009996179.1|  PREDICTED: proliferation-associated protein 2G4    157   5e-42    Chaetura pelagica
pdb|2Q8K|A  Chain A, The Crystal Structure Of Ebp1                      158   5e-42    Homo sapiens [man]
ref|XP_006179892.1|  PREDICTED: proliferation-associated protein 2G4    158   5e-42    Camelus ferus
ref|XP_004589712.1|  PREDICTED: proliferation-associated protein 2G4    158   6e-42    Ochotona princeps [southern American pika]
ref|XP_003476243.1|  PREDICTED: proliferation-associated protein 2G4    158   6e-42    Cavia porcellus [guinea pig]
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...    158   6e-42    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...    158   6e-42    Pundamilia nyererei
ref|XP_010643016.1|  PREDICTED: proliferation-associated protein 2G4    158   7e-42    Fukomys damarensis [Damara mole rat]
gb|AAB91536.1|  cell cycle protein p38-2G4 homolog                      158   7e-42    Homo sapiens [man]
ref|XP_005335677.1|  PREDICTED: proliferation-associated protein 2G4    158   7e-42    Ictidomys tridecemlineatus
ref|XP_003405168.1|  PREDICTED: proliferation-associated protein 2G4    158   7e-42    Loxodonta africana [African bush elephant]
ref|XP_004379999.1|  PREDICTED: proliferation-associated protein 2G4    158   7e-42    Trichechus manatus latirostris
ref|XP_009468808.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    157   8e-42    Nipponia nippon
ref|XP_004890349.1|  PREDICTED: proliferation-associated protein 2G4    158   8e-42    
ref|XP_005397344.1|  PREDICTED: proliferation-associated protein 2G4    158   8e-42    Chinchilla lanigera
ref|XP_007559711.1|  PREDICTED: proliferation-associated protein 2G4    158   8e-42    Poecilia formosa
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...    158   8e-42    Oryzias latipes [Japanese rice fish]
ref|XP_009983110.1|  PREDICTED: proliferation-associated protein 2G4    156   9e-42    Tauraco erythrolophus
ref|XP_005371237.1|  PREDICTED: proliferation-associated protein 2G4    157   9e-42    Microtus ochrogaster [prairie voles]
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...    158   1e-41    
ref|XP_002163189.2|  PREDICTED: proliferation-associated protein ...    157   1e-41    
gb|AAH19222.1|  PA2G4 protein                                           157   1e-41    
gb|KFV16945.1|  Proliferation-associated protein 2G4                    156   1e-41    
ref|XP_004006644.1|  PREDICTED: proliferation-associated protein 2G4    157   1e-41    
ref|XP_006267753.1|  PREDICTED: proliferation-associated protein 2G4    157   1e-41    
ref|XP_004601656.1|  PREDICTED: proliferation-associated protein 2G4    157   1e-41    
ref|XP_006035312.1|  PREDICTED: proliferation-associated protein 2G4    157   1e-41    
ref|XP_008408124.1|  PREDICTED: proliferation-associated protein 2G4    157   2e-41    
gb|EOA93068.1|  Proliferation-associated protein 2G4                    155   2e-41    
ref|XP_007953297.1|  PREDICTED: proliferation-associated protein 2G4    157   2e-41    
ref|XP_003772221.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-41    
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4    157   2e-41    
ref|NP_997806.1|  proliferation-associated 2G4-like                     157   2e-41    
ref|XP_009641743.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    158   2e-41    
ref|XP_005061405.1|  PREDICTED: proliferation-associated protein 2G4    158   2e-41    
ref|XP_004274221.1|  PREDICTED: proliferation-associated protein 2G4    156   3e-41    
ref|XP_006859475.1|  PREDICTED: proliferation-associated protein 2G4    156   3e-41    
ref|XP_006897700.1|  PREDICTED: proliferation-associated protein 2G4    156   3e-41    
gb|AAH44287.1|  Pa2g4 protein                                           156   3e-41    
ref|NP_001083993.1|  proliferation-associated 2G4, 38kD                 156   3e-41    
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4    156   3e-41    
ref|XP_010865536.1|  PREDICTED: proliferation-associated protein ...    156   3e-41    
gb|EHH20847.1|  Cell cycle protein p38-2G4-like protein                 156   3e-41    
ref|XP_001504854.1|  PREDICTED: proliferation-associated protein ...    156   3e-41    
ref|XP_002290444.1|  DNA-binding protein                                155   4e-41    
pdb|2V6C|A  Chain A, Crystal Structure Of Erbb3 Binding Protein 1...    155   4e-41    
gb|ACI33074.1|  Proliferation-associated protein 2G4                    156   5e-41    
emb|CDQ85755.1|  unnamed protein product                                155   5e-41    
ref|NP_001002070.1|  proliferation-associated 2G4, a                    155   5e-41    
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...    155   7e-41    
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...    155   8e-41    
ref|XP_004649070.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    155   9e-41    
emb|CDQ74715.1|  unnamed protein product                                155   1e-40    
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...    154   1e-40    
ref|NP_001124717.1|  proliferation-associated protein 2G4               154   2e-40    
emb|CCI48095.1|  unnamed protein product                                154   2e-40    
gb|EMP31026.1|  Proliferation-associated protein 2G4                    157   2e-40    
emb|CCA18784.1|  proliferationassociated protein putative               154   2e-40    
gb|AFM86347.1|  proliferation-associated 2G4                            153   2e-40    
gb|AFM85909.1|  proliferation-associated 2G4                            153   2e-40    
gb|ACI33868.1|  Proliferation-associated protein 2G4                    154   3e-40    
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...    154   3e-40    
ref|XP_007656709.1|  PREDICTED: proliferation-associated protein 2G4    149   3e-40    
ref|XP_011409574.1|  PREDICTED: proliferation-associated protein ...    150   4e-40    
gb|ELK15270.1|  Proliferation-associated protein 2G4                    157   4e-40    
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4    153   5e-40    
gb|AAC34392.1|  PAS1                                                    153   5e-40    
ref|XP_003963121.1|  PREDICTED: proliferation-associated protein ...    153   5e-40    
ref|NP_001279838.1|  proliferation-associated 2G4, 38kDa                153   6e-40    
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...    153   6e-40    
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...    152   7e-40    
gb|KFO24578.1|  Proliferation-associated protein 2G4                    157   7e-40    
emb|CDQ89185.1|  unnamed protein product                                152   9e-40    
gb|EQB77766.1|  hypothetical protein CB1_000449019                      157   9e-40    
ref|XP_002605416.1|  hypothetical protein BRAFLDRAFT_278505             152   9e-40    
gb|ACO10060.1|  Proliferation-associated protein 2G4                    152   1e-39    
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...    152   1e-39    
ref|XP_005801435.1|  PREDICTED: proliferation-associated protein ...    152   1e-39    
emb|CBK24689.2|  unnamed protein product                                152   2e-39    
ref|XP_005079873.1|  PREDICTED: receptor tyrosine-protein kinase ...    156   2e-39    
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...    151   2e-39    
ref|XP_004466155.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    151   3e-39    
ref|XP_006815930.1|  PREDICTED: proliferation-associated protein ...    149   4e-39    
ref|XP_004070502.1|  PREDICTED: proliferation-associated protein ...    150   4e-39    
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...    150   4e-39    
ref|XP_001647519.1|  predicted protein                                  150   4e-39    
ref|XP_011408355.1|  PREDICTED: proliferation-associated protein ...    148   4e-39    
ref|XP_009512308.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    149   4e-39    
gb|ADX97052.1|  proliferation-associated protein 2g4                    150   6e-39    
ref|XP_010745944.1|  PREDICTED: proliferation-associated protein ...    150   7e-39    
emb|CDQ78322.1|  unnamed protein product                                150   7e-39    
ref|XP_002734317.1|  PREDICTED: proliferation-associated protein ...    150   8e-39    
ref|XP_008411912.1|  PREDICTED: proliferation-associated protein ...    150   8e-39    
gb|KDR23244.1|  Proliferation-associated protein 2G4                    150   8e-39    
ref|XP_003790559.1|  PREDICTED: receptor tyrosine-protein kinase ...    155   8e-39    
ref|XP_001113953.2|  PREDICTED: receptor tyrosine-protein kinase ...    155   9e-39    
ref|XP_006011099.1|  PREDICTED: proliferation-associated protein ...    149   1e-38    
ref|XP_626802.1|  proliferation-associated protein 2G4 metallopro...    149   1e-38    
gb|EJK49958.1|  hypothetical protein THAOC_31113                        150   1e-38    
ref|XP_005793747.1|  proliferation-associated protein 2G4               149   1e-38    
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein ...    149   2e-38    
ref|XP_005705833.1|  DNA binding protein                                149   2e-38    
ref|XP_002116398.1|  hypothetical protein TRIADDRAFT_64279              148   3e-38    
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...    148   4e-38    
gb|EFA84439.1|  proliferation associated protein                        147   4e-38    
ref|XP_003383390.1|  PREDICTED: proliferation-associated protein ...    147   5e-38    
emb|CAG06775.1|  unnamed protein product                                147   8e-38    
ref|XP_666677.1|  nuclear DNA-binding protein G2p -related              146   2e-37    
ref|XP_005769829.1|  proliferation-associated protein 2G4               146   3e-37    
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                  145   3e-37    
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                  145   4e-37    
gb|EHJ70953.1|  hypothetical protein KGM_14785                          144   5e-37    
ref|XP_005710371.1|  unnamed protein product                            145   6e-37    
ref|XP_002141587.1|  proliferation-associated protein 2G4               144   1e-36    
ref|XP_780193.1|  PREDICTED: proliferation-associated protein 2G4...    144   1e-36    
ref|XP_005853761.1|  proliferation-associated protein 2g4               144   1e-36    
ref|XP_011173347.1|  PREDICTED: proliferation-associated protein 2G4    144   2e-36    
ref|XP_011340977.1|  PREDICTED: proliferation-associated protein 2G4    143   2e-36    
ref|XP_011306002.1|  PREDICTED: proliferation-associated protein 2G4    143   2e-36    
gb|EFZ09337.1|  hypothetical protein SINV_15911                         144   2e-36    
ref|XP_011059200.1|  PREDICTED: proliferation-associated protein 2G4    143   2e-36    
ref|XP_011263181.1|  PREDICTED: proliferation-associated protein 2G4    143   3e-36    
ref|XP_009011773.1|  hypothetical protein HELRODRAFT_156370             142   5e-36    
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...    142   6e-36    
ref|XP_005537086.1|  probable DNA binding protein                       142   7e-36    
ref|XP_001913309.1|  proliferation-associated protein 1                 141   1e-35    
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4    141   1e-35    
gb|ACN60176.1|  Proliferation-associated protein 2G4                    135   2e-35    
ref|XP_008472310.1|  PREDICTED: proliferation-associated protein 2G4    141   2e-35    
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative     140   2e-35    
ref|XP_011154366.1|  PREDICTED: proliferation-associated protein 2G4    140   3e-35    
ref|XP_003703942.1|  PREDICTED: proliferation-associated protein ...    140   3e-35    
ref|XP_011419861.1|  PREDICTED: proliferation-associated protein ...    139   5e-35    
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4       139   6e-35    
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4    139   7e-35    
dbj|GAM23516.1|  hypothetical protein SAMD00019534_066910               139   1e-34    
gb|ERG85130.1|  proliferation-associated protein 2g4                    139   1e-34    
dbj|BAM19228.1|  proliferation-associated 2g4                           138   1e-34    
ref|XP_008549132.1|  PREDICTED: proliferation-associated protein 2G4    138   2e-34    
ref|XP_005095772.1|  PREDICTED: proliferation-associated protein ...    138   2e-34    
ref|XP_004355743.1|  proliferation associated protein                   138   2e-34    
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...    138   2e-34    
ref|XP_002047403.1|  GJ11948                                            138   2e-34    
tpg|DAA34047.1|  TPA: metallopeptidase                                  137   2e-34    
gb|AAV36985.2|  LD30448p                                                137   2e-34    
ref|XP_002007862.1|  GI13173                                            137   3e-34    
ref|XP_004171625.1|  PREDICTED: proliferation-associated protein ...    130   3e-34    
ref|NP_647984.1|  CG10576, isoform A                                    137   4e-34    
ref|XP_001010313.1|  metallopeptidase family M24 containing protein     136   7e-34    
ref|XP_002182273.1|  predicted protein                                  136   7e-34    
emb|CBJ31951.1|  conserved unknown protein                              136   9e-34    
gb|ACO12262.1|  Proliferation-associated protein 2G4                    136   9e-34    
gb|AAB03665.1|  PrlA                                                    135   1e-33    
ref|XP_001134549.1|  proliferation associated protein                   135   1e-33    
ref|XP_002128302.1|  PREDICTED: proliferation-associated protein 2G4    135   1e-33    
ref|XP_011502791.1|  PREDICTED: proliferation-associated protein 2G4    135   2e-33    
ref|XP_002035467.1|  GM13901                                            135   2e-33    
ref|XP_002083760.1|  GD13178                                            135   2e-33    
ref|XP_004029906.1|  hypothetical protein IMG5_170920                   134   6e-33    
ref|XP_001984453.1|  GH15010                                            134   6e-33    
ref|XP_001894006.1|  DNA-binding protein, 42 kDa containing protein     134   6e-33    
ref|XP_003689614.1|  PREDICTED: proliferation-associated protein ...    134   7e-33    
ref|XP_006615964.1|  PREDICTED: proliferation-associated protein ...    133   8e-33    
ref|XP_006560659.1|  PREDICTED: proliferation-associated protein ...    133   8e-33    
ref|XP_002093823.1|  GE20541                                            133   8e-33    
ref|XP_001957516.1|  GF10449                                            133   9e-33    
gb|KFH72903.1|  hypothetical protein MVEG_00128                         133   1e-32    
emb|CDW84742.1|  proliferation-associated protein 2g4                   132   2e-32    
ref|XP_005184671.1|  PREDICTED: proliferation-associated protein 2G4    132   2e-32    
ref|XP_001972015.1|  GG14116                                            132   2e-32    
ref|XP_003485618.1|  PREDICTED: proliferation-associated protein ...    132   2e-32    
ref|XP_003394756.1|  PREDICTED: proliferation-associated protein ...    132   2e-32    
ref|XP_002062021.1|  GK16873                                            132   2e-32    
emb|CAG07405.1|  unnamed protein product                                132   4e-32    
ref|XP_010156890.1|  PREDICTED: proliferation-associated protein 2G4    125   4e-32    
ref|XP_003284133.1|  hypothetical protein DICPUDRAFT_52698              131   5e-32    
ref|XP_003143613.1|  DNA-binding protein                                132   5e-32    
gb|KHN80833.1|  Proliferation-associated protein 2G4                    132   6e-32    
ref|XP_002324717.2|  hypothetical protein POPTR_0018s07240g             125   1e-31    
gb|ETO19191.1|  hypothetical protein RFI_18041                          129   1e-31    
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...    130   1e-31    
ref|XP_004031065.1|  hypothetical protein IMG5_148130                   130   1e-31    
emb|CCF73397.1|  unnamed protein product                                129   2e-31    
ref|XP_002634083.1|  Hypothetical protein CBG01629                      129   4e-31    
ref|XP_010174926.1|  PREDICTED: proliferation-associated protein ...    122   6e-31    
ref|XP_003880798.1|  methionine aminopeptidase,related                  128   8e-31    
ref|XP_001353865.1|  GA10407                                            128   9e-31    
emb|CDW52768.1|  proliferation associated protein 2g4                   127   1e-30    
gb|EFX84381.1|  hypothetical protein DAPPUDRAFT_24528                   125   2e-30    
ref|XP_007869056.1|  proliferation-associated protein 1                 127   2e-30    
gb|ENN76413.1|  hypothetical protein YQE_07074                          127   2e-30    
gb|AEE62360.1|  unknown                                                 127   2e-30    
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative     127   2e-30    
gb|EPR57248.1|  putative proliferation-associated protein 2G4           127   2e-30    
ref|XP_008924453.1|  PREDICTED: proliferation-associated protein 2G4    125   2e-30    
ref|XP_003391218.2|  PREDICTED: proliferation-associated protein ...    121   3e-30    
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative     127   3e-30    
gb|ETW31956.1|  DNA-binding protein, 42 kDa                             125   3e-30    
emb|CDO66750.1|  proliferation-associated protein 2g4, putative         126   4e-30    
dbj|GAA35285.2|  metalloprotease ARX1                                   125   4e-30    
emb|CAP22983.2|  Protein CBG01630                                       125   4e-30    
ref|XP_003108289.1|  hypothetical protein CRE_10205                     126   4e-30    
ref|XP_009161956.1|  hypothetical protein T265_00035                    126   5e-30    
gb|ETW46814.1|  DNA-binding protein, 42 kDa                             125   5e-30    
gb|ETW34073.1|  DNA-binding protein, 42 kDa                             125   5e-30    
ref|XP_001348435.1|  proliferation-associated protein 2g4, putative     125   6e-30    
ref|XP_001865752.1|  proliferation-associated 2g4                       126   6e-30    
ref|XP_002634084.1|  Hypothetical protein CBG01630                      125   7e-30    
gb|EMD34055.1|  hypothetical protein CERSUDRAFT_117563                  125   1e-29    
ref|XP_001616691.1|  proliferation-associated protein 2g4               124   1e-29    
gb|EFX84375.1|  hypothetical protein DAPPUDRAFT_46898                   125   1e-29    
ref|NP_500311.1|  Protein W08E12.7                                      124   1e-29    
ref|XP_009052849.1|  hypothetical protein LOTGIDRAFT_115903             124   1e-29    
gb|KDQ24453.1|  hypothetical protein PLEOSDRAFT_1067285                 124   1e-29    
gb|EFX83265.1|  hypothetical protein DAPPUDRAFT_315717                  124   2e-29    
ref|XP_004224377.1|  proliferation-associated protein 2g4               124   2e-29    
ref|XP_001688498.1|  AGAP005108-PB                                      124   2e-29    
ref|XP_002775231.1|  proliferation-associated protein 2G4 metallo...    124   2e-29    
gb|KFW82865.1|  Proliferation-associated protein 2G4                    123   3e-29    
ref|XP_313985.4|  AGAP005108-PA                                         124   3e-29    
ref|XP_007362719.1|  proliferation-associated protein 1                 123   3e-29    
gb|EHH65552.1|  hypothetical protein EGM_02333                          123   3e-29    
gb|EJY79371.1|  Metallopeptidase family M24 containing protein          123   4e-29    
gb|EGT46940.1|  hypothetical protein CAEBREN_29895                      123   4e-29    
gb|EGT53148.1|  hypothetical protein CAEBREN_04692                      123   4e-29    
gb|EFX62733.1|  hypothetical protein DAPPUDRAFT_67763                   123   5e-29    
ref|XP_002028721.1|  GL24799                                            122   5e-29    
gb|KII85040.1|  hypothetical protein PLICRDRAFT_45151                   122   7e-29    
gb|KFH67450.1|  hypothetical protein MVEG_06182                         122   7e-29    
gb|ERL94099.1|  hypothetical protein D910_11381                         125   8e-29    
ref|XP_002260742.1|  proliferation-associated protein                   122   8e-29    
emb|CCD59701.1|  proliferation-associated protein 2G4, 38kDa (M24...    121   8e-29    
ref|XP_001602273.2|  PREDICTED: proliferation-associated protein ...    120   9e-29    
gb|EHH19926.1|  hypothetical protein EGK_02674                          122   9e-29    
ref|XP_001880628.1|  predicted protein                                  122   1e-28    
emb|CEF70564.1|  Proliferation-associated protein 2G4                   122   1e-28    
ref|XP_001662411.1|  AAEL012312-PA                                      122   1e-28    
gb|ETN66740.1|  proliferation-associated 2g4                            122   1e-28    
emb|CAX83116.1|  Proliferation-associated protein 2G4                   121   2e-28    
emb|CCD59700.1|  proliferation-associated protein 2G4, 38kDa (M24...    121   2e-28    



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS  +TRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSGPDTRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT HPLQEL  TK +DDPEIKAWLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITTHPLQELQPTKTVDDPEIKAWLALP  355



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVL+VS+ E RVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLNVSSPEMRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNYNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLALPTKTkkkgggkkk  211
            GDLVAHIKFTVLLMPNGSDRIT+H LQELN TK +D DPEIKAWL+LP KTKKKGGGKKK
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHSLQELNPTKTVDSDPEIKAWLSLPIKTKKKGGGKKK  368

Query  210  kgkkgekaeeaAQTEPTGEEATNRSK  133
            KGKKG+KAE++ QTEP  E A   S+
Sbjct  369  KGKKGDKAEDSMQTEPVDEAANGASQ  394



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVYS+DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSISNPDTRVDEAEFEENEVYSVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDL+AHIKFTVLLMPNGSDR+T+HPLQEL  TK +DDPEIKAWL+L
Sbjct  309  GDLLAHIKFTVLLMPNGSDRVTSHPLQELQTTKTVDDPEIKAWLSL  354



>gb|AFK36627.1| unknown [Lotus japonicus]
Length=203

 Score =   309 bits (792),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  2    KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  61

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  62   DKSYHLKMKASRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  121

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSDRIT HPLQEL  TK ++DPEIKAWLAL TK+
Sbjct  122  GDYVAHIKFTVLLMPNGSDRITFHPLQELQTTKTVEDPEIKAWLALGTKS  171



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS  +TRVDE+EFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSGTDTRVDESEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDR+T HPLQEL  TK +DDPEIKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRVTTHPLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVVLSVANPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D+NY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DRNYHLKMKASRFIFSEITQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  310  GDFVAHIKFTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLAL  355



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS  +TRVDEAEFEENEVYS+DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSGPDTRVDEAEFEENEVYSVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK +DDPEIKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHPLQDLQPTKTVDDPEIKAWLAL  354



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVYSIDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSDRIT+H LQEL + K I D+PEIK WLALP KT
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALPVKT  359



>gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSV+N ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  189  KQFVIDGNKVILSVTNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKHTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK I+DPEIKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIEDPEIKAWLAL  354



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVYS+DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLALPTKT  238
            GDLVAHIKFT LLMPNGSDRIT+H LQEL+  K IDD PEIK WLALP KT
Sbjct  309  GDLVAHIKFTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALPVKT  359



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVVLSVANPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D+NY+LKMKASRFI+SEI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DRNYHLKMKASRFIFSEITQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWL+L
Sbjct  310  GDFVAHIKFTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLSL  355



>ref|XP_004156612.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=395

 Score =   313 bits (803),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  192  KQFVIDGNKVVLSVANPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  251

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D+NY+LKMKASRFI+SEI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  252  DRNYHLKMKASRFIFSEITQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  311

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWL+L
Sbjct  312  GDFVAHIKFTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLSL  357



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY+IDIVT+TGEGKPK+LDEK TTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAIDIVTTTGEGKPKLLDEKHTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD+VAHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  309  GDIVAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  354



>gb|KHN20329.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=284

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  79   KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  138

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  139  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  198

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQEL  TK IDDP+IKAWLAL
Sbjct  199  GDFVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  244



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LS SN +TRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTT+YKRAV
Sbjct  189  KQFVIDGNKVILSASNPDTRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTVYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI +KFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEIREKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHPLQELQPTKQIDDPEIKAWLAL  354



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVYSIDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT+H LQEL + K I D+PEIK WLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALP  356



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score =   311 bits (797),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT HPLQEL  TK IDDP+IKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score =   311 bits (797),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVYS+DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLALP  247
            GDLVAHIKFT LLMPNGSDRIT+H LQEL+  K IDD PEIK WLALP
Sbjct  309  GDLVAHIKFTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALP  356



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSD+IT+HPLQEL  TK I D+ EIKAWLAL TK+
Sbjct  311  GDLVAHIKFTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLALGTKS  361



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN+E RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNSEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWL+L
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLSL  355



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSD+IT+HPLQEL  TK I D+ EIKAWLAL TK+
Sbjct  311  GDLVAHIKFTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLALGTKS  361



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSISNPDTRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN ETRVD+AEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPETRVDDAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT H LQEL  TK +D +PEIK WLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITTHALQELKPTKTVDEEPEIKTWLALP  356



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LE+KRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEDKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT HPLQEL  TK IDDP+IKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT+H LQEL   K I ++PEIKAWLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALP  356



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LS SN ETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VAHIKFTVLLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  309  GDFVAHIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  356



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LS SN ETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VAHIKFTVLLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  309  GDFVAHIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  356



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LS SN ETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VAHIKFT+LLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  309  GDFVAHIKFTILLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  356



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQEL  TK IDDP+IKAWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN ETRVD+AEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPETRVDDAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT H LQEL   K I D+PEIK WLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITTHTLQELKPAKTIEDEPEIKTWLALP  356



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENE+Y+IDIVTSTG+GKP++LDEKQTTIYKRAV
Sbjct  218  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEIYAIDIVTSTGDGKPRLLDEKQTTIYKRAV  277

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  278  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  337

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK I+DPEIK+WLAL
Sbjct  338  GDLVAHIKFTVLLMPNGSDRITSHPLQELQPTKIIEDPEIKSWLAL  383



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY++DIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAVDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQE+  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIVTSTGEGKP++LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVTSTGEGKPRLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  T+ IDD PEIKAWLAL
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTRSIDDNPEIKAWLAL  356



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY++DIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAVDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQE+  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KVVLSVSN +TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D++YNLKMKASRFIYSEISQ FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  249  DRSYNLKMKASRFIYSEISQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSDRIT+HPLQE+  TK +DDPEIKAWLAL  KT
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHPLQEIQPTKTVDDPEIKAWLALGVKT  358



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN ETRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPETRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+S+ISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSDISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDP+IKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKAIDDPDIKAWLAL  354



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  229  KQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  288

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  289  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  348

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDRIT+H LQEL   K I ++PEIKAWLALP
Sbjct  349  GDLVAHIKFTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALP  396



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKP
Sbjct  249  DKNYHLKMKASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSISNPDTRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKR RLGLVEC+NH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRVRLGLVECMNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKP
Sbjct  249  DKNYHLKMKASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVDEAEFEENEVYSIDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDEAEFEENEVYSIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDR+T+H LQEL  TK   ++PEIKAWLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRVTSHSLQELQPTKSTENEPEIKAWLALP  356



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LS+SN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVILSISNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEI+QKFP++PFTAR L+EKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKSYHLKMKASRFIFSEINQKFPILPFTARALDEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK IDD PEIKAWLAL
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDDNPEIKAWLAL  356



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  146  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  205

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  206  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  265

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VA IKFTVLLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  266  GDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  313



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+ DEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLFDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDP+IKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPDIKAWLAL  354



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS SN +TRVDEAEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSASNPDTRVDEAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQ FP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQNFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T++PLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSYPLQELQPTKTIDDPEIKAWLAL  354



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK 
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQ  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSD+IT+HPLQ+L  +K I DD EIKAWLAL TK+
Sbjct  311  GDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEDDAEIKAWLALGTKS  361



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV+N ETRVDEAEFEENEVYSID+VTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDVVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEISQKFP+MPFT R+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEISQKFPIMPFTTRDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDR+T+H LQEL   K I ++PEIKAWLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRVTSHALQELKPAKTIENEPEIKAWLALP  356



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENE+Y+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  247  KQFVIDGNKVILSVSNPETRVDDAEFEENEIYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  306

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP++PFTAR LEEKRARLGLVECVNHDLLQP+PVLHEKP
Sbjct  307  DKNYHLKMKASRFIFSEISQKFPILPFTARALEEKRARLGLVECVNHDLLQPFPVLHEKP  366

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK ID+PEIKAWLAL
Sbjct  367  GDYVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDNPEIKAWLAL  412



>gb|KJB36949.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=291

 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  88   KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  147

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  148  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  207

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  208  GDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  253



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN E RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  139  KQFVIDGNKVVLSVSNPEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQTTIYKRAV  198

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK 
Sbjct  199  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKL  258

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  259  GDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  305



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN +TRVDEAEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  309  GDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|ACU22749.1| unknown [Glycine max]
Length=280

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  79   KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  138

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+ +LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  139  DKSSHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  198

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  199  GDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  244



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSD++T+H LQEL  TK I D+ EIKAWLAL TK+
Sbjct  311  GDLVAHIKFTVLLMPNGSDKVTSHQLQELQPTKSIEDNAEIKAWLALGTKS  361



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKNTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFT+LLMPNGSDRIT+H LQEL  +K IDDPEIKAWLAL
Sbjct  310  GDYVAHIKFTLLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLAL  355



>gb|KHN22549.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=327

 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  126  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  185

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  186  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  245

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+H LQEL  TK IDDPEIKAWLAL
Sbjct  246  GDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  291



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQEL  TK IDDPEIK WLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITLHPLQELQPTKTIDDPEIKGWLAL  354



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VA IKFTVLLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  309  GDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  356



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            GD VA IKFTVLLMPNGSDRIT+HP+QEL  TK +DDPEIKAWL+L T
Sbjct  309  GDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSLAT  356



>ref|XP_010040429.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Eucalyptus grandis]
Length=237

 Score =   300 bits (769),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SVSN +T+VDE EFEENEVY+IDIVTSTGEGKPK+LDEKQTT+YKRAV
Sbjct  34   KQFVIDGNKVIISVSNPDTKVDEFEFEENEVYAIDIVTSTGEGKPKLLDEKQTTVYKRAV  93

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  94   DKNYHLKMKASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  153

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD  AHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  154  GDYAAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  199



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKSTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  +K IDDPEIKAWLAL
Sbjct  310  GDYVAHIKFTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLAL  355



>ref|XP_008792832.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Phoenix 
dactylifera]
Length=376

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDE+ TTIYKRA+
Sbjct  169  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDERHTTIYKRAM  228

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  229  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  288

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID +PEIKAWLAL
Sbjct  289  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLAL  335



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   305 bits (782),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVDEAEFEENEVYSIDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDEAEFEENEVYSIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASRFI+SEI+QKFP+MPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYNLKMKASRFIFSEINQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALP  247
            GDLVAHIKFTVLLMPNGSDR+T+H LQEL  TK   ++PEIKAWLALP
Sbjct  309  GDLVAHIKFTVLLMPNGSDRVTSHXLQELQPTKTTENEPEIKAWLALP  356



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  192  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKSTTIYKRAV  251

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQPYPVLHEKP
Sbjct  252  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQPYPVLHEKP  311

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  +K IDDPEIKAWLAL
Sbjct  312  GDYVAHIKFTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLAL  357



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DI+TSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIITSTGEGKPKLLDEKTTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVEC+NHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECMNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  310  GDCVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DI TSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIFTSTGEGKPKLLDEKTTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  310  GDCVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS+ + RVD+AEFEENEVYSIDI  STGEGKP++LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSIDIAASTGEGKPRMLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEINQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK I+DPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIEDPEIKAWLAL  354



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SV+N ETRVDE EFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVIISVTNPETRVDEVEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMK+SRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKSYHLKMKSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLAL  250
            GDLVAHIKFT+LLMPNGSDR+T+HPLQ+L  TK IDD PEIKAWLAL
Sbjct  310  GDLVAHIKFTLLLMPNGSDRVTSHPLQQLQPTKTIDDNPEIKAWLAL  356



>gb|KJB36945.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  168  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  227

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  228  DKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  287

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  288  GDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  333



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDE+ TTIYKRA+
Sbjct  190  KQFVIDGNKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDERHTTIYKRAM  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID +PEIKAWLAL
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLAL  356



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN E RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK 
Sbjct  249  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKL  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  309  GDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  355



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K+++SVSN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKIIISVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKHTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID +PEIKAWL+L
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLSL  356



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS  +T+VDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVVLSVSAPDTKVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPY VLHEKP
Sbjct  250  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYSVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDR+T+H LQEL  TK +DD EIKAWLAL
Sbjct  310  GDLVAHIKFTVLLMPNGSDRVTSHALQELQPTKTVDDDEIKAWLAL  355



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVV+SVSN +TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVVSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+H LQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  354



>gb|KCW45226.1| hypothetical protein EUGRSUZ_L01140 [Eucalyptus grandis]
Length=325

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SVSN +T+VDE EFEENEVY+IDIVTSTGEGKPK+LDEKQTT+YKRAV
Sbjct  122  KQFVIDGNKVIISVSNPDTKVDEFEFEENEVYAIDIVTSTGEGKPKLLDEKQTTVYKRAV  181

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  182  DKNYHLKMKASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  241

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD  AHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  242  GDYAAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  287



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVDE+EFEENEVY+IDIVTSTGEGKPK+LDE+QTT+YKRAV
Sbjct  190  KQFVIDGNKVILSVSNPETRVDESEFEENEVYAIDIVTSTGEGKPKLLDERQTTVYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFPLMPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHEK 
Sbjct  250  DKSYHLKMKASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYPVLHEKT  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT H +Q++  +  +DDPEIK+WLA+
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVL  SN ETRVD+AEFEENEVY+IDIVTSTGEGK K+LDEK+TTIYKRAV
Sbjct  190  KQFVIDGNKVVLGASNPETRVDDAEFEENEVYAIDIVTSTGEGKLKLLDEKETTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY LKMKASR I++EI+QKFP+MPFTAR LE+KRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYQLKMKASRLIFTEINQKFPIMPFTARALEDKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPT  244
            G+LVAHIKFTVLLMPNGSD+IT HPLQELN TK IDDPEIK WLAL T
Sbjct  310  GELVAHIKFTVLLMPNGSDKITGHPLQELNPTKAIDDPEIKTWLALAT  357



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSV++ ETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVILSVTSPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK I DDPEIKAWLAL
Sbjct  310  GDFVAHIKFTVLLMPNGSDRITSHALQELQPTKKIDDDPEIKAWLAL  356



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVDE+EFEENEVY+IDIVTSTGEGKPK+LDE+QTT+YKRAV
Sbjct  190  KQFVIDGNKVILSVSNPETRVDESEFEENEVYAIDIVTSTGEGKPKLLDERQTTVYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFPLMPFTAR+LEEKRARLGLVECVNH+LLQPYPVLHE+ 
Sbjct  250  DKSYHLKMKASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYPVLHERT  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT H +Q++  +  +DDPEIK+WLA+
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS++N +TRVD+ EFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSITNPDTRVDDTEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+HPLQEL  TK I+DPEI AWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIEDPEINAWLAL  354



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLALPTKT  238
            GDLVAHIKFTVLL+P+GS R+T+H LQ L  TK I+D  EIKAWLAL TKT
Sbjct  311  GDLVAHIKFTVLLLPSGSQRVTSHSLQVLQPTKSIEDHAEIKAWLALGTKT  361



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SVSN +T+VDE EFEENEVY+IDIVTSTGEGKPK+LDEKQTT+YKRAV
Sbjct  189  KQFVIDGNKVIISVSNPDTKVDEFEFEENEVYAIDIVTSTGEGKPKLLDEKQTTVYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKNYHLKMKASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD  AHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  309  GDYAAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARVLEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDR+T+H LQEL  +K I D+ EIK WLAL
Sbjct  311  GDLVAHIKFTVLLMPNGSDRVTSHSLQELQPSKSIEDNAEIKGWLAL  357



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K+++SVSN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  165  KQFVIDGNKIIISVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKHTTIYKRAV  224

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  225  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  284

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLA  253
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID +PEIKAWL+
Sbjct  285  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLS  330



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS+ + RVD+AEFEENEVYS+DI  STGEGKP++LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSVDIAASTGEGKPRMLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKP
Sbjct  250  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T++P+QEL  TK IDDPEIKAWLAL
Sbjct  310  GDYVAHIKFTVLLMPNGSDRVTSYPVQELQPTKSIDDPEIKAWLAL  355



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+H LQEL  TK IDDPEIKA LAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKACLAL  354



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPT  244
            GDLVAHIKFTVLL+P+GS R+T+H LQEL  TK I D+ EIKAWLAL T
Sbjct  311  GDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLALGT  359



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SV+N ETRVDE EFEENEVY+ID+VTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVIISVTNPETRVDEFEFEENEVYAIDVVTSTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  +K IDD  EIKAW+AL
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQQLLPSKMIDDNAEIKAWMAL  356



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+L+VS+ ETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDE+QTTIYKRAV
Sbjct  190  KQFVIDGNKVILNVSSPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDERQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK I DDPEIKAWLAL
Sbjct  310  GDFVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDDDPEIKAWLAL  356



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV + ETRV++AEFEENEVY++DIVTSTG+GKP++LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVPSPETRVEDAEFEENEVYAVDIVTSTGDGKPRLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK  DDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITSHSLQELQPTKTTDDPEIKAWLAL  354



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   300 bits (768),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV + ETRVD+AEFEENEVY++DIV S+G+GKP++LDE+QTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVPSGETRVDDAEFEENEVYAVDIVISSGDGKPRLLDERQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID DPEIKAWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KVVLSVSN +TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D++Y+LKMKASRFIYSEI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEK 
Sbjct  249  DRSYHLKMKASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKA  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSDRIT H LQEL  TK +DDPEIKAWLAL  KT
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLALGIKT  358



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K+++SVSN ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  190  KQFVIDGNKIIISVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKHTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLA  253
            GDLVAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID +PEIKAWL+
Sbjct  310  GDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLS  355



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSV + ETRVD+AEFEENEVY++DIV S+G+GKP++LDE+QTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVPSGETRVDDAEFEENEVYAVDIVISSGDGKPRLLDERQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  249  DKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+HPLQEL  TK ID DPEIKAWLAL
Sbjct  309  GDFVAHIKFTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KV+LSVSN ETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTT+YKRAV
Sbjct  190  KQFVIDANKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTVYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+ KFP+MPFTAR LEEKRARLG+VECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINTKFPIMPFTARALEEKRARLGIVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSD+IT  PLQE   TK  +DPEIKAWLAL TK+
Sbjct  310  GDCVAHIKFTVLLMPNGSDKITGLPLQECQSTKVPEDPEIKAWLALGTKS  359



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 158/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLAL  250
            GDLVAHIKFTVLL+P+GS R+T+H LQEL  TK I D+ EIKAWLAL
Sbjct  311  GDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  357



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  230  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  289

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK 
Sbjct  290  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQ  349

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLALPTKT  238
            GDLVAHIKFTVLLMPNGSD+IT+HPLQ+L  +K I+ D EIKAWLAL TK+
Sbjct  350  GDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLALGTKS  400



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFV++G KVVLS+SN +TRVDEAEFEEN+VY+IDIVTSTG+GKPK+ DEKQTTIYKRAV
Sbjct  189  KQFVMNGNKVVLSLSNPDTRVDEAEFEENQVYAIDIVTSTGDGKPKLFDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKASRFIFSEISQKFPIMPFFARALEEKRARLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T+H LQEL  TK IDDP+IKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSHTLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KV+LS  NAETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT+YKRAV
Sbjct  190  KQFVIDANKVILSAGNAETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTVYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+ KFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEINTKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            GD VAHI+FTVLLMPNGSD+IT  PLQ L  TK  +DPEIKAWLAL TK+
Sbjct  310  GDFVAHIQFTVLLMPNGSDKITGLPLQALEPTKVPEDPEIKAWLALGTKS  359



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  259  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  318

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK 
Sbjct  319  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQ  378

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPID-DPEIKAWLAL  250
            GDLVAHIKFTVLLMPNGSD+IT+HPLQ+L  +K I+ D EIKAWLAL
Sbjct  379  GDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLAL  425



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTTIYKRAV
Sbjct  191  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTTIYKRAV  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  251  DKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GDLVAHIKFTVLL+P+GS R+T+HPLQE       D+ EIKAWLAL
Sbjct  311  GDLVAHIKFTVLLLPSGSQRVTSHPLQEFQPKSIEDNAEIKAWLAL  356



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 1/167 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSV N ETRVDEAEFEENEVY++DIV STG+GKPK+ DEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVILSVGNPETRVDEAEFEENEVYAVDIVMSTGDGKPKLFDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEISQK+P+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEISQKYPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT+HP+Q+L  +  I +DPEIKAWLAL
Sbjct  310  GDFVAHIKFTVLLMPNGSDRITSHPVQQLLPSISIENDPEIKAWLAL  356



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVS+ + RVD+AEFEENEVYS+DI  STGEGKP++LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSVDIAVSTGEGKPRMLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECV+HDL+QPYPVL+EKP
Sbjct  249  DKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVSHDLVQPYPVLYEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDR+T++PLQEL  TK +D PEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRVTSYPLQELQPTKTVDHPEIKAWLAL  354



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KVVLSVSN +TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D++Y+LKMKASRFIYSEI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEK 
Sbjct  249  DRSYHLKMKASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKA  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VAHIKFTVLLMPNGSDRIT H LQEL  TK +DDPEIKAWLAL
Sbjct  309  GDYVAHIKFTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN ETRV++ EFEENEVYSIDIVTSTG+GKPK+LDEKQTT+YKR+ 
Sbjct  190  KQFVIDGNKVVLSVSNPETRVEDVEFEENEVYSIDIVTSTGDGKPKLLDEKQTTVYKRSP  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D++Y+LKMKASRFI+SEI+Q +P  PF+AR LEEKRARLGLVECVNHDLL+PYPVLHEKP
Sbjct  250  DRSYHLKMKASRFIFSEINQNYPHFPFSARVLEEKRARLGLVECVNHDLLEPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSDRIT+HPLQEL  TK IDD PEIKAWLAL  KT
Sbjct  310  GDFVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDAPEIKAWLALGIKT  360



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVID  KV+LS+SN ETRV+EAEFEENEVY+IDIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDANKVILSISNPETRVEEAEFEENEVYAIDIVASTGEGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKASRFI+SEI+QKFPLMPFTAR LEEKRARLGL ECVNHDLLQPYPVLHEKP
Sbjct  250  DKNYHLKMKASRFIFSEITQKFPLMPFTARALEEKRARLGLFECVNHDLLQPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD+VAHIKFTVLLMPNGSDRIT+HPLQEL  TK +DDPEIKAWLAL
Sbjct  310  GDIVAHIKFTVLLMPNGSDRITSHPLQELQPTKQVDDPEIKAWLAL  355



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLS+SN ETRVDEAEFEENEVY+IDIVTS G+GKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVVLSLSNPETRVDEAEFEENEVYAIDIVTSPGDGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKA RFI+S+ISQKFP+MPF AR LEEKRA LGLVECVNH+LLQPYPVLHEKP
Sbjct  249  DKSYHLKMKAFRFIFSDISQKFPIMPFFARALEEKRACLGLVECVNHELLQPYPVLHEKP  308

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKF VLLMPNGSDR+T HPLQEL  TK IDDP++KAWLAL
Sbjct  309  GDYVAPIKFPVLLMPNGSDRVTFHPLQELQPTKAIDDPDVKAWLAL  354



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KVVLSVSN ETRV++ EFEENEVYSIDIVTS+G+GKPK+LDEKQTT+YKR+ 
Sbjct  190  KRFVIDGNKVVLSVSNPETRVEDVEFEENEVYSIDIVTSSGDGKPKLLDEKQTTVYKRSP  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D++Y+LKMKASRFI+SEI+Q F   PFTAR LEEKRARLGLVECVNHDLL+PYPVLHEKP
Sbjct  250  DRSYHLKMKASRFIFSEINQNFQHFPFTARVLEEKRARLGLVECVNHDLLEPYPVLHEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPTKT  238
            GD VAHIKFTVLLMPNGSDRIT+H LQEL  TK I DD EIKAWLAL  +T
Sbjct  310  GDFVAHIKFTVLLMPNGSDRITSHTLQELQPTKTIADDSEIKAWLALGIRT  360



>ref|XP_009799003.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Nicotiana sylvestris]
Length=361

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVV SVSN +TRVD+AEFEENEVYS++IVTSTGEGKP +LD KQTTIYKR V
Sbjct  157  KQFVIDGNKVVSSVSNPDTRVDDAEFEENEVYSVNIVTSTGEGKPILLDGKQTTIYKRDV  216

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+YNLKMKASR I+ EISQK P+MPFTAR+LEEKRAR+GLVECV H+LLQPYPVLHEKP
Sbjct  217  DKSYNLKMKASRVIFREISQKVPIMPFTARDLEEKRARVGLVECVKHELLQPYPVLHEKP  276

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDD-PEIKAWLALP  247
            GDLVAHIKFTVLLMPNG DRIT+H +QEL   K ID+ PEIK WLALP
Sbjct  277  GDLVAHIKFTVLLMPNGPDRITSHAIQELTPAKTIDNEPEIKTWLALP  324



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 150/183 (82%), Gaps = 13/183 (7%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VID  KV+LSVSN ETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTT+YKRAV
Sbjct  183  KQLVIDTNKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTVYKRAV  242

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKAS+FI SEI+ +FPLMPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK 
Sbjct  243  DKNYHLKMKASKFIRSEINSRFPLMPFTARSLEEKRARLGLVECVNHELLQPYPVLHEKS  302

Query  387  -------------GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
                         GD VA IKFTVLLMPNGSD+IT  PLQE   TK  DDPEIKAWL + 
Sbjct  303  GITIFHQLSLILTGDFVARIKFTVLLMPNGSDKITGVPLQEYQQTKVPDDPEIKAWLGMG  362

Query  246  TKT  238
             K+
Sbjct  363  IKS  365



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ +IDG K ++SVS+ ETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQTT+YK+  
Sbjct  190  KQKIIDGSKAIISVSSPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQTTVYKKDD  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI+Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEINQNFPYMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK +DDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQTTKTVDDPEIKGWLAL  355



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VID  K  LSVS  ETRVD+AEFE+NEVY+IDIV STGEGKPK++DEKQTT+YK+  
Sbjct  190  KQNVIDASKSFLSVSTPETRVDDAEFEDNEVYAIDIVASTGEGKPKLIDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  AVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VID  K  LSVS  ETRVD+AEFE+NEVY+IDIV STGEGKPK++DEKQTT+YK+  
Sbjct  190  KQNVIDASKSFLSVSTPETRVDDAEFEDNEVYAIDIVASTGEGKPKLIDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  AVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VID  K  LSVS  ETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTT+YK+  
Sbjct  190  KQNVIDASKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  AVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQE+  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQEIQPTKTIDDPEIKGWLAL  355



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQTT+YK+  
Sbjct  190  KQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKP
Sbjct  250  DVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK +DDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQTT+YK+  
Sbjct  190  KQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKP
Sbjct  250  DVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK +DDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQTT+YK+  
Sbjct  190  KQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQTTVYKKDA  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKP
Sbjct  250  DVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK +DDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VID  K  LSVS  ETRVD+AEFEENEVY+IDIV STG+GKPK++DEKQTT+YK+  
Sbjct  235  KQNVIDASKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLIDEKQTTVYKKDA  294

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  295  AVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  354

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK +DDPEIK WLAL
Sbjct  355  GDFVAQIKFTVLLMPNGSDRITSHALQELQPTKTVDDPEIKGWLAL  400



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTK  241
            GD VA IKFTVLLMPNGSDRIT+H LQEL   K I+DPEIK WLAL  K
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIK  357



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTK  241
            GD VA IKFTVLLMPNGSDRIT+H LQEL   K I+DPEIK WLAL  K
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIK  357



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K VLSVS+ +++VD+ EFEENEVY+IDIV STG+GKPK+LDEKQTTIY++  
Sbjct  190  KQMVIDGSKAVLSVSSPDSKVDDVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYRKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI + FP MPFTAR LEEKRARLGLVEC+NH LLQPYPVL+EKP
Sbjct  250  LVNYQLKMKASRFIISEIKENFPHMPFTARSLEEKRARLGLVECLNHGLLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WL+L
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTIEDPEIKGWLSL  355



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL   K I+DPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL   K I+DPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK  +DPEI+ WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELG-TKISEDPEIQGWLAL  354



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIY++  
Sbjct  190  KQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYRKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              +Y LKMKASR + SE+ ++FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SIHYQLKMKASRSLISEVKERFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSD+IT+H LQEL  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIY++  
Sbjct  190  KQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYRKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              +Y LKMKASR + SE+ + FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SIHYQLKMKASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSD+IT+H LQEL  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG K  LSVS  ETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTIY++  
Sbjct  190  KQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYRKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              +Y LKMKASR + SE+ + FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKP
Sbjct  250  SIHYQLKMKASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSD+IT+H LQEL  TK IDDPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 140/175 (80%), Gaps = 10/175 (6%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSVS+ ET VDE EFEENEVY+IDIV STG+GKPK+LDEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEK-  391
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  250  SVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKP  309

Query  390  --------PGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
                    PGD VA IKFTVLLMPNGSDRIT+H LQEL   K I+DPEIK WLAL
Sbjct  310  GSCRFGFLPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  363



>gb|KCW45224.1| hypothetical protein EUGRSUZ_L01138, partial [Eucalyptus grandis]
Length=208

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 133/166 (80%), Gaps = 22/166 (13%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV++SVSN +T+VDE EFEENEVY+IDIVTSTGEGKPK+LDEKQTT+YKRA 
Sbjct  29   KQFVIDGNKVIISVSNPDTKVDEFEFEENEVYAIDIVTSTGEGKPKLLDEKQTTVYKRAA  88

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMKAS+                      KRARLGLVECVNH+LLQPYPVLHEK 
Sbjct  89   DKNYHLKMKASK----------------------KRARLGLVECVNHELLQPYPVLHEKL  126

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD  AHIKFTVLLMPNGSDRIT+H LQEL  TK IDDPEIKAWLAL
Sbjct  127  GDYAAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  172



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 19/169 (11%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSNA+T+VD+AEFEENEVY+IDIVTSTGEGKP++LDEKQTTIYKRA 
Sbjct  184  KQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPQLLDEKQTTIYKRAF  243

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D+N++LKMKAS                  R LEEKRARLGLVEC+NH+LLQPYPVLHEKP
Sbjct  244  DQNFHLKMKAS------------------RALEEKRARLGLVECMNHELLQPYPVLHEKP  285

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPI-DDPEIKAWLALPT  244
            GDLVAHIKFTVLL+P+GS R+T+H LQEL  TK I D+ EIKAWLAL T
Sbjct  286  GDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLALGT  334



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSV++ E  V+E EFEENEVY+IDIV STG+GKPK++DEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  250  TVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKS  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  355



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSV++ E  V+E EFEENEVY+IDIV STG+GKPK++DEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  250  TVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKS  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  355



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSV++ E  V+E EFEENEVY+IDIV STG+GKPK++DEKQTTIYK+  
Sbjct  190  KQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQTTIYKKDE  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  250  TVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKS  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WLAL
Sbjct  310  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  355



>ref|XP_006291296.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24194.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=282

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSV++ E  V+E EFEENEVY+IDIV STG+GKPK++DEKQTTIYK+  
Sbjct  92   KQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQTTIYKKDE  151

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LK+KASRF  SEI++ FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  152  TVNYQLKLKASRFTISEITKNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKS  211

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WLAL
Sbjct  212  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  257



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ VIDG KVVLSV++ E  V+E EFEENEVY+IDIV STG+GKPK++DEKQTTIYK+  
Sbjct  178  KQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQTTIYKKDE  237

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
              NY LK+KASRF  SEI++ FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK 
Sbjct  238  TVNYQLKLKASRFTISEITKNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKS  297

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            GD VA IKFTVLLMPNGSDRIT+H LQEL  TK I+DPEIK WLAL
Sbjct  298  GDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  343



>gb|KHN18039.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=186

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K VLS+SN +TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  41   KQFVIDGNKDVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  100

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  101  DKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKP  160

Query  387  G  385
            G
Sbjct  161  G  161



>ref|XP_006843644.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
 gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+L+VSN ETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  190  KQFVIDGNKVILNVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAV  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            DKNY+LKMK+SRFI+SEI+Q+FP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKP
Sbjct  250  DKNYHLKMKSSRFIFSEINQRFPIMPFTARVLEEKRARLGLVECVNHELLQPYPVLHEKP  309

Query  387  GD  382
            G+
Sbjct  310  GE  311



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K VL+ ++ E RV++ EFEENEVY IDIV S+GEGK ++LDE++TT+YKRA+
Sbjct  193  KQFVIDGNKCVLNKASPEYRVEDGEFEENEVYGIDIVVSSGEGKGRVLDERETTVYKRAL  252

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D+ Y LK+KASR I+SEI++K P MPFT R L+ K++RLG++EC+NH LL PYPVLHEK 
Sbjct  253  DQEYKLKLKASRSIFSEINKKHPTMPFTTRGLDSKQSRLGILECLNHGLLHPYPVLHEKN  312

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
            G++VA  K TVLLMPNGSDRITA PLQ+++  K +++ ++K  LA   K+
Sbjct  313  GEVVAQFKATVLLMPNGSDRITAAPLQKVDSDKKVENEDLKKLLASSVKS  362



>ref|XP_004148633.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=296

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN ETRVD+AEFEENE+Y+IDIVTSTGEGKPK+LDEKQTTIYKRA+
Sbjct  164  KQFVIDGNKVILSVSNPETRVDDAEFEENEIYAIDIVTSTGEGKPKLLDEKQTTIYKRAM  223

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLH  397
            DK+Y+LKMKA R I+SEIS+KFP++PFTAR LEEKRARLGLVECVN DLLQPYP+LH
Sbjct  224  DKSYHLKMKACRXIFSEISKKFPVLPFTARALEEKRARLGLVECVNRDLLQPYPILH  280



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 10/180 (6%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQ+VIDG KVVL+  + + +V+EAEFE NEVY+IDIV STGEGKPK+LD+K+TT+YKRA+
Sbjct  187  KQYVIDGNKVVLNRPSPDQKVEEAEFEPNEVYAIDIVVSTGEGKPKVLDDKETTVYKRAL  246

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEE----------KRARLGLVECVNHDLL  418
            D  Y LKMKASR +   IS+KFP++PFT R L E          K+ RLGLVEC+ H LL
Sbjct  247  DVEYKLKMKASRLVLGAISKKFPMLPFTLRALSEGEGEDVSELKKQLRLGLVECLTHGLL  306

Query  417  QPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALPTKT  238
             PYPVLHEK G+LVA IK TVLLMPNGSD+IT  P Q +   K ++D E+   L    KT
Sbjct  307  HPYPVLHEKGGELVAQIKGTVLLMPNGSDKITVAPQQPVETEKKVEDAELLKLLNTGLKT  366



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K +L+    + +V++ EFEENEVY++DIV S+GEGKP++LDEK+TT+YKRA+
Sbjct  188  KQFVIDGSKCILNKPTPDQKVEDGEFEENEVYAVDIVVSSGEGKPRVLDEKETTVYKRAL  247

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAR-----------ELEEKRARLGLVECVNHDL  421
            +  Y LKM+ASR ++S ++  F  MPFT R           EL+  + +LGLVEC+NH L
Sbjct  248  EVTYQLKMQASRAVFSLVNSAFATMPFTLRALLDEAAAQKTELKASQLKLGLVECLNHGL  307

Query  420  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
            L PYPVLHEKPG++VA IK TVLLMPNGS  IT+ P Q +   K ++D EI   LA P
Sbjct  308  LHPYPVLHEKPGEVVAQIKGTVLLMPNGSSIITSAPRQTVTTEKKVEDKEILDLLATP  365



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 11/178 (6%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG K +L+    + +V++AEFEENEVY+IDIV STGEGKP++LDEK+TT+YKRA+
Sbjct  191  KQFVIDGSKCILNKPTPDQKVEDAEFEENEVYAIDIVVSTGEGKPRVLDEKETTVYKRAL  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAR-----------ELEEKRARLGLVECVNHDL  421
            +  Y LKM+ASR ++S I+  F  MPFT R           EL+  + +LGLVEC+NH L
Sbjct  251  EVAYQLKMQASRIVFSLINSSFATMPFTLRALLDEAANQKTELKVGQLKLGLVECLNHGL  310

Query  420  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
            L PYPVLHEK G+LVA IK TVLLMPNGS  +T+   Q +N  K ++D EI   LA P
Sbjct  311  LHPYPVLHEKGGELVAQIKGTVLLMPNGSSIVTSASRQPVNSEKKVEDKEILDLLATP  368



>gb|AFK46635.1| unknown [Medicago truncatula]
Length=139

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = -2

Query  546  MKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  367
            MKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGD VAHI
Sbjct  1    MKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKPGDFVAHI  60

Query  366  KFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLAL  250
            KFTVLLMPNGSDR+T+HPLQEL  TK IDDPEIKAWLAL
Sbjct  61   KFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  99



>ref|XP_003062941.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KVVL+    E + DE   E NEVY++DIV STGEGKPK+ DEK+T +YKRA+
Sbjct  197  KRFVIDGNKVVLNKPTPELKADETTIELNEVYALDIVLSTGEGKPKMQDEKETNVYKRAI  256

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKR-ARLGLVECVNHDLLQPYPVLHEK  391
            +KNY LKM+ASR ++SEIS+KFP MPFT R + + R A+LGL EC+ H+LL  YPVL+EK
Sbjct  257  EKNYKLKMQASRAVFSEISKKFPTMPFTMRAMGDVRGAKLGLSECMKHELLHEYPVLYEK  316

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
            PGD VAH+K TVL+M NG+DR+T    Q     K + D ++KA +A P
Sbjct  317  PGDAVAHVKCTVLVMQNGNDRVTTFAPQVTKSEKELMDEDLKALIAEP  364



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K++VIDG KV+L+  +AE + DEAE + NEVY++DIV S+GEG PK+LDEK+T +YKRAV
Sbjct  198  KRYVIDGNKVILNKPSAELKADEAEIKLNEVYALDIVMSSGEGTPKMLDEKETAVYKRAV  257

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEE-KRARLGLVECVNHDLLQPYPVLHEK  391
            + NY LKM+ASR ++SEI ++FP MPF+ R +E  K A+LGLVEC  H+LL  YPVL+EK
Sbjct  258  ENNYKLKMQASRAVFSEIQKRFPTMPFSMRAMEGIKGAKLGLVECCTHELLHKYPVLYEK  317

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLALP  247
            PGD VAH K TVL+M NG+DRIT    Q +     + D E+K  +  P
Sbjct  318  PGDAVAHFKATVLVMQNGNDRITTWTCQPVESALELTDEELKELITQP  365



>ref|XP_001422365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00682.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=379

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F+IDG KV+L+ S  E + D  E E  EVY++DIV S+GEGKPK  DE++T +YKRA+
Sbjct  202  KRFIIDGNKVILNKSTPEMKADPEEIELYEVYALDIVMSSGEGKPKQRDERETKVYKRAI  261

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            +KNY LKM+ SR ++SEIS++FP MPFTAR LEEKR   GLVEC NH LL  YPVL+EK 
Sbjct  262  EKNYQLKMQGSRAVFSEISKRFPTMPFTARALEEKRVNFGLVECCNHGLLHAYPVLYEKD  321

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLA  253
            G  VAH+K T L++  G+DRIT    QE+   K + D  +   +A
Sbjct  322  GAAVAHVKSTFLVLKKGNDRITTFEPQEVQSDKSLSDNALVELIA  366



>ref|XP_003084394.1| putative DNA-binding protein GBP16 (ISS) [Ostreococcus tauri]
Length=367

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F+IDG KV+L+    E + +  E E  E Y++DIV S+GEGKPK  DE++T +YKRA+
Sbjct  190  KRFIIDGNKVILNKQTPEMKAEPTEIEMYETYALDIVMSSGEGKPKQRDERETRVYKRAI  249

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            +KNY LKM  SR ++SEIS++FP MPFTAR L+EKR   GLVEC NH LL  YPVL+EK 
Sbjct  250  EKNYQLKMANSRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGLLHSYPVLYEKD  309

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLA  253
            G  VAHIK T L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  310  GSAVAHIKSTFLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  354



>emb|CEG00817.1| Peptidase M24, methionine aminopeptidase [Ostreococcus tauri]
Length=385

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F+IDG KV+L+    E + +  E E  E Y++DIV S+GEGKPK  DE++T +YKRA+
Sbjct  208  KRFIIDGNKVILNKQTPEMKAEPTEIEMYETYALDIVMSSGEGKPKQRDERETRVYKRAI  267

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            +KNY LKM  SR ++SEIS++FP MPFTAR L+EKR   GLVEC NH LL  YPVL+EK 
Sbjct  268  EKNYQLKMANSRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGLLHSYPVLYEKD  327

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLA  253
            G  VAHIK T L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  328  GSAVAHIKSTFLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  372



>ref|XP_009041985.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
 gb|EGB03305.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
Length=393

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KV+L     + +V++  FE NEVYSID+  STG+GKPK + + +TTI+KR+V
Sbjct  209  KRFVIDGNKVILLREETDQKVEDFCFELNEVYSIDVAMSTGDGKPKEM-QSRTTIFKRSV  267

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DKNY LKM++SR +++E++ KFP +PFT R LE E++AR+G+VEC+ H+L+ PYPVL EK
Sbjct  268  DKNYMLKMRSSRTLFNEVNAKFPALPFTLRALEDERQARMGVVECLKHELIHPYPVLFEK  327

Query  390  PGDLVAHIKFTVLLMPNGSDRITA  319
             GD +AH KFTVLL+P+G  RIT 
Sbjct  328  KGDHIAHFKFTVLLLPSGPTRITG  351



>ref|WP_028832180.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=392

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KVV+  +  +  VDE  FE NEVY++DI  STGEGKPK +D K TT++KRAV
Sbjct  196  KRFVIDGNKVVIQRNEVDQEVDEITFEANEVYAVDIALSTGEGKPKEMDTK-TTVFKRAV  254

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKR-ARLGLVECVNHDLLQPYPVLHEK  391
            + NY LKMKASR++++EI++K+P +PF+    ++ R +++G+VECV H++L  YPVL EK
Sbjct  255  ETNYRLKMKASRYVFNEINKKYPSLPFSIAAFDDTRQSKMGVVECVKHNMLHTYPVLFEK  314

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTK  289
             GD + H+KFT L++PNG+ +IT+ P   ++  K
Sbjct  315  EGDHIVHVKFTALVLPNGTSKITSGPADIVSACK  348



>ref|XP_009039553.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
 gb|EGB05714.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
Length=395

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KV+L   + + +V++  FE NEVYSID+  STG+GKPK +  + TTI+KR+V
Sbjct  209  KRFVIDGNKVILLREDTDQKVEDFSFELNEVYSIDVAMSTGDGKPKEMISR-TTIFKRSV  267

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DKNY LKM++SR +++EI+ KFP +PFT R L+ E++AR+G+VEC+ H+L+ PYPVL EK
Sbjct  268  DKNYMLKMRSSRTLFNEINSKFPALPFTLRALDDERQARMGVVECLKHELIHPYPVLFEK  327

Query  390  PGDLVAHIKFTVLLMPNGSDRITA  319
             GD V+H KFTVL++P+G  RIT 
Sbjct  328  KGDYVSHFKFTVLILPSGPTRITG  351



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 22/165 (13%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F+ID  K            D+ E EE EVY+IDIV STGEGK K++DEK+TT++KRA+
Sbjct  190  KRFIIDASKAA----------DDFEIEEGEVYAIDIVMSTGEGKSKVVDEKETTVFKRAL  239

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D  Y LK+KASR + SEI++KFP M +            GL+EC+NH+LLQP+PVL+EKP
Sbjct  240  DVQYQLKIKASREVLSEINKKFPTMMY------------GLLECINHNLLQPFPVLYEKP  287

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPEIKAWLA  253
              LVAH K TVLL+P+G DRIT   LQ L   K I+D E+KA LA
Sbjct  288  DALVAHFKGTVLLVPSGVDRITNSTLQALESDKSIEDAEVKALLA  332



>ref|XP_010091710.1| hypothetical protein L484_026567 [Morus notabilis]
 gb|EXB44976.1| hypothetical protein L484_026567 [Morus notabilis]
Length=157

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 93/106 (88%), Gaps = 6/106 (6%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG +VVLSVSN +TRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQTTIYKRA 
Sbjct  34   KQFVIDGNRVVLSVSNPDTRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAE  93

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAR------ELEEKRARLG  448
            D NY+LKMKASRFI+SEI+QKFP+MPFTAR      E++E + R+ 
Sbjct  94   DNNYHLKMKASRFIFSEINQKFPIMPFTARYEKLRNEVQENKRRMS  139



>ref|XP_008619458.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
 gb|EQC27064.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
Length=393

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K +    + E +  +  FE NEVY+ID+  +TG  K  +  E++TT++KR V
Sbjct  201  KRFVIDGSKTIAQKHDHEAKTAKVTFEANEVYAIDVAFTTGLDKA-VASERRTTVFKRQV  259

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L  +
Sbjct  260  DKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILEGR  319

Query  390  PGDLVAHIKFTVLLMPNGSDRIT--AHPLQELNVTKPIDDPEIKAWL  256
             GD +AH+K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  320  EGDHIAHLKATVLLMPNGTTKITGLSLPLERINSDKTV-TPEIAAIL  365



>gb|KDO19442.1| DNA-binding protein [Saprolegnia parasitica CBS 223.65]
Length=393

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K +    + E +  +  FE NEVY+ID+  +TG  K  +  E++TT++KR V
Sbjct  201  KRFVIDGSKTIAQKHDHEAKTAKVTFEANEVYAIDVAFTTGLDKA-VASERRTTVFKRQV  259

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L  +
Sbjct  260  DKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILEGR  319

Query  390  PGDLVAHIKFTVLLMPNGSDRIT--AHPLQELNVTKPIDDPEIKAWL  256
             GD +AH+K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  320  EGDHIAHLKATVLLMPNGTTKITGLSLPLERINSEKTV-TPEIAAIL  365



>gb|ETL29090.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETP05241.1| DNA-binding protein, 42 kDa [Phytophthora parasitica CJ01A1]
Length=393

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K++    + E R  +  FE NEVY+ID+  +TG  KP +  E++TT++KR V
Sbjct  212  KRFVIDGNKIIAQKMDVENRTPKVTFEPNEVYTIDVCYTTGGDKP-VNSERRTTVFKRQV  270

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK Y LKMKASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  +
Sbjct  271  DKQYRLKMKASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGR  330

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPL--QELNVTKPIDDPEIK  265
             GD VAH K TVLL+PNG+ +IT  P    +++  K +DD   K
Sbjct  331  EGDKVAHFKVTVLLLPNGTTKITGLPFPSDKVHSEKTVDDETAK  374



>ref|XP_008912890.1| DNA-binding protein, 42 kDa [Phytophthora parasitica INRA-310]
 gb|ETI35422.1| DNA-binding protein, 42 kDa [Phytophthora parasitica P1569]
 gb|ETK75660.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETL82327.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETM35541.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETN01811.1| DNA-binding protein, 42 kDa [Phytophthora parasitica INRA-310]
 gb|ETP33377.1| DNA-binding protein, 42 kDa [Phytophthora parasitica P10297]
Length=393

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K++    + E R  +  FE NEVY+ID+  +TG  KP +  E++TT++KR V
Sbjct  212  KRFVIDGNKIIAQKMDVENRTPKVTFEPNEVYTIDVCYTTGGDKP-VNSERRTTVFKRQV  270

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK Y LKMKASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  +
Sbjct  271  DKQYRLKMKASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGR  330

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPL--QELNVTKPIDDPEIK  265
             GD VAH K TVLL+PNG+ +IT  P    +++  K +DD   K
Sbjct  331  EGDKVAHFKVTVLLLPNGTTKITGLPFPSDKVHSEKTVDDETAK  374



>ref|XP_002900555.1| proliferation-associated protein, metalloprotease family M24X, 
putative [Phytophthora infestans T30-4]
 gb|EEY59870.1| proliferation-associated protein, metalloprotease family M24X, 
putative [Phytophthora infestans T30-4]
Length=393

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K++    + E R  +  FE NE Y+ID+  +TG  KP +  E++TT++KR V
Sbjct  212  KRFVIDGNKMIAQKMDVENRTPKVTFEPNEAYTIDVCYTTGSDKP-VNSERRTTVFKRQV  270

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK Y LKMKASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  +
Sbjct  271  DKQYRLKMKASRYVFKEINTKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGR  330

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPL--QELNVTKPIDDPEIK  265
             GD VAH K TVLL+PNG+ +IT  P   ++++  K +DD   K
Sbjct  331  AGDKVAHFKVTVLLLPNGTTKITGLPFPSEKVHSEKTVDDETAK  374



>ref|XP_009533169.1| methionine aminopeptidase, merops subfamily M24 [Phytophthora 
sojae]
 gb|EGZ10424.1| methionine aminopeptidase, merops subfamily M24 [Phytophthora 
sojae]
Length=393

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG KV+    + E R  +  FE NEVY+ID+  +TG  KP +  E++TT++KR V
Sbjct  212  KRFVIDGNKVIAQKMDVENRTPKVTFEPNEVYTIDVCYTTGSEKP-VNSERRTTVFKRQV  270

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK Y LKMKASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  +
Sbjct  271  DKQYRLKMKASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGR  330

Query  390  PGDLVAHIKFTVLLMPNGSDRITA--HPLQELNVTKPIDDPEIK  265
            PGD VAH K TVLL+P+G+ +IT    P   ++  K +D+   K
Sbjct  331  PGDKVAHFKVTVLLLPSGTTKITGLTFPGDRVHSEKTVDEETAK  374



>ref|XP_006381246.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|ERP59043.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=284

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK TTIYKRAV
Sbjct  192  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKSTTIYKRAV  251

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAR  478
            DKNY+LKMK+SRFI+SEI+QKFP+MPFTAR
Sbjct  252  DKNYHLKMKSSRFIFSEINQKFPIMPFTAR  281



>ref|XP_009839077.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
 gb|ETV71412.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
Length=391

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K + + ++ ET+   A F+ NEVY+ID+  +TG  KP +  E++TT++KR V
Sbjct  199  KRFVIDGSKTIAAKNDPETKAARATFDVNEVYAIDVAFTTGLEKP-VQSERRTTVFKRQV  257

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK+Y LKMKASR+++SEI+ KFP +PFT R  + E ++RLG+ ECV HDLL P+PVL  +
Sbjct  258  DKSYRLKMKASRYVFSEINSKFPTLPFTIRAFDDESQSRLGVSECVKHDLLTPFPVLEGR  317

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPL  310
             GD +AH K TVLL+PNG+ +IT  PL
Sbjct  318  SGDHIAHFKATVLLLPNGTTKITGLPL  344



>gb|KJB17056.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17057.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=286

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAR  478
            DKNY+LKMKASRFI+SEI+Q+FP++PFTAR
Sbjct  249  DKNYHLKMKASRFIFSEINQRFPILPFTAR  278



>ref|XP_007026647.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
 gb|EOY07149.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
Length=286

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KV+LSVSN +TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAV
Sbjct  189  KQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAV  248

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTAREL  472
            DKNY+LKMK SRFI+SEI+QKFP++PFTAR +
Sbjct  249  DKNYHLKMKTSRFIFSEINQKFPILPFTARSV  280



>ref|XP_008877833.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
 gb|ETV93491.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
Length=407

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+FVIDG K +   ++ ET+   A F+ NE Y+ID+  +TG  KP +  E++TT++KR V
Sbjct  217  KRFVIDGSKTIAVKNDPETKAARATFDVNEAYAIDVAFTTGLEKP-VQSERRTTVFKRQV  275

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            DK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++RLG+ ECV HDLL P+PVL  +
Sbjct  276  DKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRLGVSECVKHDLLTPFPVLEGR  335

Query  390  PGDLVAHIKFTVLLMPNGSDRIT--AHPLQELNVTKPIDDPEIKAWLA  253
             GD +AH K TVLL+PNG+ +IT  A P+  +N  K +  PE+ A L 
Sbjct  336  HGDHIAHFKATVLLLPNGTTKITGLALPVDRVNSDKVL-TPELAAVLG  382



>ref|XP_007508742.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19828.1| predicted protein [Bathycoccus prasinos]
Length=384

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 114/168 (68%), Gaps = 3/168 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F IDG KVVL     ET+ D+ E    +V+ +DIV +TGEGK    DEK+T +YKRA+
Sbjct  204  KRFAIDGNKVVLLKKTPETKADDHEIALYDVFGLDIVMTTGEGKLSQKDEKETQVYKRAL  263

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            +K+Y+LKMKASR ++S+I  +FP  PF AR LE   A+ GL EC+ HDLL PYPVL+EK 
Sbjct  264  EKSYSLKMKASRGVFSDICNRFPSFPFAARYLEGLSAKAGLPECLKHDLLVPYPVLYEKT  323

Query  387  GDLVAHIKFTVLLMPNGSDRITAHP---LQELNVTKPIDDPEIKAWLA  253
            G+ VAH+K T+L+M  G+DRIT       Q+++  K + D E+   +A
Sbjct  324  GEYVAHVKTTILVMGKGNDRITKAVEMMQQDVSSEKSLQDAELVELIA  371



>ref|XP_010108751.1| hypothetical protein L484_011409 [Morus notabilis]
 gb|EXC20165.1| hypothetical protein L484_011409 [Morus notabilis]
Length=194

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            KQFVIDG KVVLSVSN +TRVD+A+FEENEV +IDIVTSTG+GKPK+LDEKQTTIYKRAV
Sbjct  73   KQFVIDGNKVVLSVSNPDTRVDDADFEENEVDAIDIVTSTGDGKPKLLDEKQTTIYKRAV  132

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE  469
            DKN +LKMKASRFI+SEI QKFP+MPFTAR ++
Sbjct  133  DKNNHLKMKASRFIFSEIDQKFPIMPFTARSVD  165



>gb|ETE68956.1| Proliferation-associated protein 2G4 [Ophiophagus hannah]
Length=367

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + R D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  164  KQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAIDVLISTGEGKAKDAGQR-TTIYKR  222

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  223  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRALEDEKKARMGVVECAKHELLQPFNVLY  282

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWLALPT  244
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D ++KA L   T
Sbjct  283  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDADLKALLQSST  335



>ref|XP_008939686.1| PREDICTED: proliferation-associated protein 2G4, partial [Merops 
nubicus]
Length=232

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  29   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  87

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  88   DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  147

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  148  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  196



>gb|KFQ30813.1| Proliferation-associated protein 2G4, partial [Merops nubicus]
Length=221

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  30   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  88

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  89   DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  148

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  149  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  197



>ref|XP_005655696.1| PREDICTED: proliferation-associated protein 2G4-like [Sus scrofa]
Length=235

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  32   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  90

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  91   DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  150

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  151  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  199



>ref|XP_006629280.1| PREDICTED: proliferation-associated protein 2G4-like [Lepisosteus 
oculatus]
Length=394

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + R D  +AEFE +EVY++D++ STGEGK +   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLISTGEGKARDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VL+
Sbjct  250  DPTKQYGLKMKTSRVFFSEVERRFDGMPFTLRAFEDEGKARLGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPL-QELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  QEL  ++  + DPE+KA L
Sbjct  310  EKEGENVAQFKFTVLLMPNGPMRITSGPFDQELYKSEHEVQDPELKALL  358



>gb|KFV57642.1| Proliferation-associated protein 2G4, partial [Tyto alba]
Length=183

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = -2

Query  738  VIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVD  565
            VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR   
Sbjct  2    VIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKRDPS  60

Query  564  KNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEKP  388
            K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK 
Sbjct  61   KQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKE  120

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  121  GEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  166



>gb|KFP70431.1| Proliferation-associated protein 2G4, partial [Acanthisitta chloris]
Length=251

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  67   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  125

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  126  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  185

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  +   + D E+KA L
Sbjct  186  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSDFEVQDGELKALL  234



>ref|XP_003223249.1| PREDICTED: proliferation-associated protein 2G4 [Anolis carolinensis]
Length=394

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ V+DG K ++     + R D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  191  KQHVVDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAIDVLISTGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  358



>ref|XP_009073732.1| PREDICTED: proliferation-associated protein 2G4, partial [Acanthisitta 
chloris]
Length=263

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  60   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  118

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  119  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  178

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  +   + D E+KA L
Sbjct  179  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSDFEVQDGELKALL  227



>ref|XP_009970305.1| PREDICTED: proliferation-associated protein 2G4, partial [Tyto 
alba]
Length=202

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = -2

Query  738  VIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVD  565
            VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR   
Sbjct  2    VIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKRDPS  60

Query  564  KNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEKP  388
            K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK 
Sbjct  61   KQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKE  120

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  121  GEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  166



>ref|XP_007423593.1| PREDICTED: proliferation-associated protein 2G4 [Python bivittatus]
Length=340

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + R D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAIDVLISTGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D ++KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDADLKALL  304



>ref|XP_007064970.1| PREDICTED: proliferation-associated protein 2G4 [Chelonia mydas]
Length=340

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLVSTGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT  P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITCGPFEPELYKSEFEVQDAELKALL  304



>gb|EWM29247.1| proliferation-associated protein 2g4 [Nannochloropsis gaditana]
Length=788

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+++IDG KV++   + + +VD+  FE+ E+YS+D+  S+GEGKP+    + TT++KRAV
Sbjct  211  KRYIIDGNKVIILREDVDQKVDDVVFEQGEIYSVDVAFSSGEGKPREATSR-TTVFKRAV  269

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLHEK  391
            D +Y LKMKASR++++E++ +FP +PFT R LE EK+AR+G+VEC+ HDLL PYPVL E+
Sbjct  270  DVSYRLKMKASRYVFNEMNHRFPTLPFTLRALEDEKQARMGVVECLKHDLLHPYPVLMER  329

Query  390  PGDLVAHIKFTVLLMPNGSDRITAHPLQ  307
            PGD+V H K T+LL+P+G+ ++T  P Q
Sbjct  330  PGDIVVHFKATILLLPSGTAKVTGLPHQ  357



>ref|XP_010219357.1| PREDICTED: proliferation-associated protein 2G4 [Tinamus guttatus]
Length=340

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSTGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  304



>gb|KGL81710.1| Proliferation-associated protein 2G4, partial [Tinamus guttatus]
Length=344

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSTGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  327



>ref|XP_005799891.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=391

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + R D  +AEFE +EVY++D++ STGEGK +    + TTIYKR
Sbjct  189  KQHVIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKARDSGLR-TTIYKR  247

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VLH
Sbjct  248  DPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECAKHELLQPFSVLH  307

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLM NG+ RIT  P   EL  ++  + DPE+KA L
Sbjct  308  EKEGEFVAQFKFTVLLMANGAHRITNGPFDPELYQSEHEVQDPELKALL  356



>ref|XP_008641741.1| PREDICTED: proliferation-associated protein 2G4 [Corvus brachyrhynchos]
Length=340

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+LVA  KFTVLLMPNG  RIT+ P + EL  +   + D E+KA L
Sbjct  256  EKEGELVAQFKFTVLLMPNGPMRITSGPFEPELYKSDLEVQDGELKALL  304



>ref|XP_005431428.1| PREDICTED: proliferation-associated protein 2G4-like [Geospiza 
fortis]
Length=340

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRALEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  +   + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSDLEVQDGELKALL  304



>ref|XP_009685364.1| PREDICTED: proliferation-associated protein 2G4 [Struthio camelus 
australis]
Length=340

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSTGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>gb|KFV87572.1| Proliferation-associated protein 2G4, partial [Struthio camelus 
australis]
Length=344

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSTGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_006131250.1| PREDICTED: proliferation-associated protein 2G4 [Pelodiscus sinensis]
Length=370

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  167  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLVSTGEGKAKDAGQR-TTIYKR  225

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  226  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  285

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT  P + EL  ++  + D E+KA L
Sbjct  286  EKEGEFVAQFKFTVLLMPNGPMRITCGPFEPELFKSEFEVQDAELKALL  334



>ref|XP_008003570.1| PREDICTED: proliferation-associated protein 2G4 [Chlorocebus 
sabaeus]
Length=313

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  110  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  168

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  169  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  228

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  229  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  277



>ref|XP_010183489.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4, partial [Mesitornis unicolor]
Length=262

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  83   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  141

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  142  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  201

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+K ++
Sbjct  202  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKGFV  250



>ref|XP_005876787.1| PREDICTED: proliferation-associated protein 2G4 [Myotis brandtii]
 ref|XP_006093721.1| PREDICTED: proliferation-associated protein 2G4 [Myotis lucifugus]
 ref|XP_006777912.1| PREDICTED: proliferation-associated protein 2G4 [Myotis davidii]
 ref|XP_008146840.1| PREDICTED: proliferation-associated protein 2G4 [Eptesicus fuscus]
 gb|EPQ14237.1| Proliferation-associated protein 2G4 [Myotis brandtii]
Length=394

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 113/169 (67%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQE--LNVTKPIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P +       K + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSDKEVQDAELKALL  358



>ref|XP_006987432.1| PREDICTED: proliferation-associated protein 2G4 [Peromyscus maniculatus 
bairdii]
Length=373

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  170  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  228

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  229  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  288

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  289  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEMEVQDAELKALL  337



>ref|XP_005826372.1| hypothetical protein GUITHDRAFT_96731 [Guillardia theta CCMP2712]
 gb|EKX39392.1| hypothetical protein GUITHDRAFT_96731 [Guillardia theta CCMP2712]
Length=378

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F  DG KV+ + +     ++E  FE+NE Y++D+V STGEGK + LD K  T++KRA 
Sbjct  195  KRFTTDGTKVITNKNVPGHNIEECTFEQNEAYAVDVVVSTGEGKCRELDTK-CTVFKRAP  253

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            D  YNLKMK +R    +I +  P MPF+ RE+++ R RLG+ ECV H+LLQP+PVL+EK 
Sbjct  254  DAKYNLKMKTAREALFKIEKSHPKMPFSLREIDDTRTRLGITECVRHELLQPHPVLYEKD  313

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVT--KPIDDPEI  268
            G++VA IKF VLLM NG  +IT   L ELN    K ++D E+
Sbjct  314  GEIVAQIKFCVLLMANGPVKITGSDLPELNAKSDKQVEDEEL  355



>ref|XP_009557265.1| PREDICTED: proliferation-associated protein 2G4 [Cuculus canorus]
Length=340

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>emb|CAJ82581.1| proliferation-associated 2G4 [Xenopus (Silurana) tropicalis]
Length=367

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDMYKSELEVQDSELKALL  358



>ref|XP_009485967.1| PREDICTED: proliferation-associated protein 2G4, partial [Pelecanus 
crispus]
Length=319

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>gb|KFO74722.1| Proliferation-associated protein 2G4, partial [Cuculus canorus]
Length=302

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  119  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  177

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  178  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  237

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  238  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  286



>gb|KFP07640.1| Proliferation-associated protein 2G4, partial [Calypte anna]
Length=343

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_005311138.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Chrysemys picta bellii]
Length=394

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 111/169 (66%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLVSTGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPL--QELNVTKPIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT  P   +       + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITCGPFEPERYKSEFEVQDAELKALL  358



>gb|KFO08279.1| Proliferation-associated protein 2G4, partial [Balearica regulorum 
gibbericeps]
Length=343

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_005235817.1| PREDICTED: proliferation-associated protein 2G4 [Falco peregrinus]
 ref|XP_005435802.1| PREDICTED: proliferation-associated protein 2G4 [Falco cherrug]
 ref|XP_009329482.1| PREDICTED: proliferation-associated protein 2G4 [Pygoscelis adeliae]
 ref|XP_010076535.1| PREDICTED: proliferation-associated protein 2G4 [Pterocles gutturalis]
 ref|XP_010311595.1| PREDICTED: proliferation-associated protein 2G4 [Balearica regulorum 
gibbericeps]
 ref|XP_010563412.1| PREDICTED: proliferation-associated protein 2G4 [Haliaeetus leucocephalus]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>ref|XP_010725225.1| PREDICTED: proliferation-associated protein 2G4 [Meleagris gallopavo]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>ref|XP_005499208.1| PREDICTED: proliferation-associated protein 2G4 [Columba livia]
 ref|XP_009805626.1| PREDICTED: proliferation-associated protein 2G4 [Gavia stellata]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>ref|XP_005031270.1| PREDICTED: proliferation-associated protein 2G4 [Anas platyrhynchos]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>gb|KFR05935.1| Proliferation-associated protein 2G4, partial [Opisthocomus hoazin]
Length=343

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_008500839.1| PREDICTED: proliferation-associated protein 2G4 [Calypte anna]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>gb|KGL92866.1| Proliferation-associated protein 2G4, partial [Charadrius vociferus]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>gb|KFP09829.1| Proliferation-associated protein 2G4, partial [Egretta garzetta]
 gb|KFP53941.1| Proliferation-associated protein 2G4, partial [Cathartes aura]
 gb|KFQ07668.1| Proliferation-associated protein 2G4, partial [Haliaeetus albicilla]
 gb|KFQ72416.1| Proliferation-associated protein 2G4, partial [Phaethon lepturus]
 gb|KFV49969.1| Proliferation-associated protein 2G4, partial [Gavia stellata]
 gb|KFZ59418.1| Proliferation-associated protein 2G4, partial [Podiceps cristatus]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_005533908.1| PREDICTED: proliferation-associated protein 2G4 [Pseudopodoces 
humilis]
Length=401

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  198  KQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  256

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  257  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRALEDEKKARMGVVECAKHELLQPFNVLY  316

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  +   + D E+KA L
Sbjct  317  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSDLEVQDGELKALL  365



>gb|KFV11001.1| Proliferation-associated protein 2G4, partial [Pterocles gutturalis]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>gb|KFQ63630.1| Proliferation-associated protein 2G4, partial [Pelecanus crispus]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>gb|KFM08039.1| Proliferation-associated protein 2G4, partial [Aptenodytes forsteri]
 gb|KFW72179.1| Proliferation-associated protein 2G4, partial [Pygoscelis adeliae]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>ref|XP_007533407.1| PREDICTED: proliferation-associated protein 2G4 [Erinaceus europaeus]
Length=394

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKALL  358



>ref|NP_001008439.1| ErbB3-binding protein 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80337.1| MGC79578 protein [Xenopus (Silurana) tropicalis]
Length=390

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDMYKSELEVQDSELKALL  358



>ref|XP_009929445.1| PREDICTED: proliferation-associated protein 2G4 [Opisthocomus 
hoazin]
Length=344

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  304



>ref|XP_001363571.1| PREDICTED: proliferation-associated protein 2G4 [Monodelphis 
domestica]
Length=394

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKALL  358



>emb|CAA59260.1| p38-2G4 [Mus musculus]
Length=340

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  304



>ref|XP_010282642.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Phaethon lepturus]
Length=377

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  174  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  232

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  233  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  292

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  293  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  341



>ref|XP_009882846.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Charadrius vociferus]
Length=377

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  174  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  232

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  233  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  292

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  293  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  341



>gb|KFP66746.1| Proliferation-associated protein 2G4, partial [Cariama cristata]
Length=348

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>gb|AAD00646.1| erbB3 binding protein EBP1 [Homo sapiens]
Length=340

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  137  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  195

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  196  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  255

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  256  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  304



>ref|XP_009701955.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Cariama cristata]
Length=377

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  174  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  232

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  233  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  292

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  293  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  341



>ref|XP_009586223.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Fulmarus glacialis]
Length=376

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  173  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  231

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  232  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  291

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  292  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  340



>ref|XP_423059.4| PREDICTED: proliferation-associated protein 2G4, partial [Gallus 
gallus]
Length=374

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  171  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  229

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  230  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  289

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  290  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  338



>ref|XP_009278316.1| PREDICTED: proliferation-associated protein 2G4 [Aptenodytes 
forsteri]
Length=377

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  174  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  232

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  233  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  292

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  293  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  341



>gb|KFV99294.1| Proliferation-associated protein 2G4, partial [Fulmarus glacialis]
Length=350

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  327



>gb|KDD75813.1| hypothetical protein H632_c489p2 [Helicosporidium sp. ATCC 50920]
Length=372

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 107/159 (67%), Gaps = 0/159 (0%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAV  568
            K+F+++G + V      ++R ++ EFE  EVY++D++ STGEGK +++DEK+TT++KRA+
Sbjct  191  KRFIMEGDRSVAVAPGPDSRAEDFEFEAGEVYAVDVLVSTGEGKGRMVDEKETTLFKRAL  250

Query  567  DKNYNLKMKASRFIYSEISQKFPLMPFTARELEEKRARLGLVECVNHDLLQPYPVLHEKP  388
            +  YNLK+K SR ++ EI +KFP   F  R LE K A +GL EC +H L+  YPVLH++P
Sbjct  251  EVQYNLKLKISRAVFGEIKRKFPTTYFAVRGLETKNASMGLKECTSHGLINAYPVLHDRP  310

Query  387  GDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKPIDDPE  271
              LVA  K T+L+    SDRITA P   L+  + I D E
Sbjct  311  KALVAQAKGTLLVFAEASDRITAAPTAFLDAPREIKDEE  349



>ref|XP_009921703.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Haliaeetus albicilla]
Length=377

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  174  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  232

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  233  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  292

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  293  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  341



>gb|KFQ36395.1| Proliferation-associated protein 2G4, partial [Mesitornis unicolor]
Length=247

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  83   KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  141

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  142  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  201

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  307
            EK G+ VA  KFTVLLMPNG  RIT+ P +
Sbjct  202  EKEGEFVAQFKFTVLLMPNGPMRITSGPFE  231



>dbj|BAF84485.1| unnamed protein product [Homo sapiens]
Length=367

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>gb|EHB06549.1| Proliferation-associated protein 2G4, partial [Heterocephalus 
glaber]
Length=349

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  167  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  225

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  226  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  285

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  286  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  334



>ref|XP_006908945.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus alecto]
 ref|XP_011374000.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus vampyrus]
Length=394

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++DI+ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDILVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>gb|AAH03777.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH05593.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH28926.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH37623.1| Pa2g4 protein, partial [Mus musculus]
Length=372

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>ref|XP_004700624.1| PREDICTED: proliferation-associated protein 2G4 [Echinops telfairi]
Length=394

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDIYKSEMEVQDAELKALL  358



>gb|AAH32111.1| PA2G4 protein, partial [Homo sapiens]
 gb|AAH72007.1| PA2G4 protein, partial [Homo sapiens]
Length=373

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>gb|KFO54080.1| Proliferation-associated protein 2G4, partial [Corvus brachyrhynchos]
Length=324

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 107/150 (71%), Gaps = 4/150 (3%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++   + + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  307
            EK G+LVA  KFTVLLMPNG  RIT+ P +
Sbjct  279  EKEGELVAQFKFTVLLMPNGPMRITSGPFE  308



>ref|XP_008066667.1| PREDICTED: proliferation-associated protein 2G4, partial [Tarsius 
syrichta]
Length=373

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  + EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFDDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-ELNVTK-PIDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P + EL  ++  + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEMEVQDAELKALL  358



>ref|NP_001085830.1| ErbB3-binding protein 1 [Xenopus laevis]
 gb|AAH73401.1| MGC80858 protein [Xenopus laevis]
Length=390

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPTKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSELEVQDSELKALL  358



>ref|XP_004093117.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Nomascus leucogenys]
Length=394

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>gb|KFM70392.1| Proliferation-associated protein 2G4, partial [Stegodyphus mimosarum]
Length=217

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 120/170 (71%), Gaps = 9/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQF IDG K ++       R +  + EFE +EVY+ID++ STGEGK + +D + TT++K+
Sbjct  7    KQFRIDGEKSIIQNPTEAQRKEHEKCEFELHEVYAIDVLVSTGEGKGREMDTR-TTVFKK  65

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
              D+ Y LKMKASR  +SE+ ++F  MPFT R  E EK+AR+G+VECVNH L++P+ VL+
Sbjct  66   T-DEVYQLKMKASRAFFSEVDKRFGNMPFTLRSFEDEKKARMGVVECVNHKLVEPFTVLY  124

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMP+GS +IT+ P+ +L++ +    +DD  +KA L
Sbjct  125  EKEGEYVAQFKFTVLLMPSGSHKITSGPI-DLDLYETELVVDDDSLKALL  173



>ref|XP_008846918.1| PREDICTED: proliferation-associated protein 2G4 [Nannospalax 
galili]
Length=394

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSELEVQDAELKALL  358



>gb|KFQ91587.1| Proliferation-associated protein 2G4, partial [Nipponia nippon]
Length=344

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  160  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  218

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  219  DPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  278

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  279  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEFEVQDGELKALL  327



>ref|NP_001004206.1| proliferation-associated protein 2G4 [Rattus norvegicus]
 sp|Q6AYD3.1|PA2G4_RAT RecName: Full=Proliferation-associated protein 2G4 [Rattus norvegicus]
 gb|AAH79095.1| Proliferation-associated 2G4 [Rattus norvegicus]
 gb|EDL84836.1| proliferation-associated 2G4, isoform CRA_a [Rattus norvegicus]
Length=394

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>ref|XP_002711114.1| PREDICTED: proliferation-associated protein 2G4 [Oryctolagus 
cuniculus]
Length=394

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSELEVQDAELKALL  358



>ref|XP_003506238.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 ref|XP_007633754.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|EGW12518.1| Proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|ERE91717.1| proliferation-associated protein 2G4-like protein [Cricetulus 
griseus]
Length=394

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSDMEVQDAELKALL  358



>ref|XP_002752647.1| PREDICTED: proliferation-associated protein 2G4 [Callithrix jacchus]
Length=390

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>ref|NP_006182.2| proliferation-associated protein 2G4 [Homo sapiens]
 ref|NP_001233412.1| proliferation-associated protein 2G4 [Pan troglodytes]
 ref|XP_008575383.1| PREDICTED: proliferation-associated protein 2G4 [Galeopterus 
variegatus]
 ref|XP_008976873.1| PREDICTED: proliferation-associated protein 2G4 [Pan paniscus]
 ref|XP_009246137.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pongo 
abelii]
 sp|Q9UQ80.3|PA2G4_HUMAN RecName: Full=Proliferation-associated protein 2G4; AltName: 
Full=Cell cycle protein p38-2G4 homolog; Short=hG4-1; AltName: 
Full=ErbB3-binding protein 1 [Homo sapiens]
 pdb|3J2I|A Chain A, Structure Of Late Pre-60s Ribosomal Subunits With Nuclear 
Export Factor Arx1 Bound At The Peptide Exit Tunnel
 gb|AAD05561.1| cell cycle protein [Homo sapiens]
 gb|AAH01951.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH07561.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH69786.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|EAW96884.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|EAW96885.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|ABM84372.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 gb|ABM87750.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAG73585.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAK63634.1| proliferation-associated protein 2G4 [Pan troglodytes]
 gb|AIC49332.1| PA2G4, partial [synthetic construct]
Length=394

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSEMEVQDAELKALL  358



>ref|XP_010348255.1| PREDICTED: proliferation-associated protein 2G4 [Saimiri boliviensis 
boliviensis]
Length=394

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  KQFVIDGXKVVLSVSNAETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  574
            KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ TTIYKR
Sbjct  191  KQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-TTIYKR  249

Query  573  AVDKNYNLKMKASRFIYSEISQKFPLMPFTARELE-EKRARLGLVECVNHDLLQPYPVLH  397
               K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+
Sbjct  250  DPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLY  309

Query  396  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQELNVTKP---IDDPEIKAWL  256
            EK G+ VA  KFTVLLMPNG  RIT+ P  E ++ K    + D E+KA L
Sbjct  310  EKEGEFVAQFKFTVLLMPNGPMRITSGPF-EPDLYKSELEVQDAELKALL  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630