BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030L22

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             258   6e-80   Nicotiana sylvestris
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-78   Nicotiana tomentosiformis
gb|AAD02557.1|  PGPS/NH15                                               241   3e-78   Petunia x hybrida [garden petunia]
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             252   9e-78   Solanum tuberosum [potatoes]
gb|AAQ90182.1|  ntp101                                                  251   2e-77   Nicotiana tabacum [American tobacco]
gb|AAQ90185.1|  ntp805                                                  249   1e-76   Nicotiana tabacum [American tobacco]
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-76   Nicotiana tomentosiformis
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             248   3e-76   Nicotiana sylvestris
gb|EPS72881.1|  pollen-specific protein                                 248   7e-76   Genlisea aurea
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             246   1e-75   Solanum tuberosum [potatoes]
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             245   5e-75   Solanum lycopersicum
gb|ABI52585.1|  pollen-specific protein                                 241   1e-73   Camellia sinensis [black tea]
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                241   2e-73   Erythranthe guttata [common monkey flower]
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                238   3e-72   Erythranthe guttata [common monkey flower]
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           236   2e-71   Petunia x hybrida [garden petunia]
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                235   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             234   4e-71   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             234   5e-71   
ref|XP_007014658.1|  SKU5 similar 13                                    234   5e-71   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             234   6e-71   Pyrus x bretschneideri [bai li]
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             234   6e-71   Sesamum indicum [beniseed]
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    234   8e-71   Nelumbo nucifera [Indian lotus]
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         234   9e-71   Jatropha curcas
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    234   9e-71   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    234   9e-71   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    233   9e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-70   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-70   Cucumis melo [Oriental melon]
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             233   1e-70   Prunus persica
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-70   Nicotiana sylvestris
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   232   2e-70   
dbj|BAL41449.1|  SKU5 similar 1                                         232   3e-70   Linum grandiflorum
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    232   3e-70   Nicotiana tabacum [American tobacco]
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             232   3e-70   Solanum tuberosum [potatoes]
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             232   5e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    231   6e-70   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             232   6e-70   Nicotiana tomentosiformis
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   231   7e-70   Morus notabilis
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             231   8e-70   Sesamum indicum [beniseed]
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             231   9e-70   Solanum lycopersicum
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             231   1e-69   Nicotiana alata [flowering tobacco]
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             230   2e-69   Nicotiana sylvestris
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             230   2e-69   Cucumis sativus [cucumbers]
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             229   4e-69   Eucalyptus grandis [rose gum]
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                229   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             229   6e-69   Pyrus x bretschneideri [bai li]
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             229   6e-69   Prunus mume [ume]
emb|CDP18567.1|  unnamed protein product                                229   8e-69   Coffea canephora [robusta coffee]
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             228   8e-69   Sesamum indicum [beniseed]
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             228   1e-68   Nicotiana tomentosiformis
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             228   1e-68   Sesamum indicum [beniseed]
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    228   1e-68   
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             228   2e-68   Sesamum indicum [beniseed]
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             228   2e-68   Sesamum indicum [beniseed]
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             228   2e-68   Sesamum indicum [beniseed]
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-67   Brassica rapa
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-67   Eucalyptus grandis [rose gum]
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-67   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             225   2e-67   
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             225   2e-67   Solanum tuberosum [potatoes]
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-67   Eucalyptus grandis [rose gum]
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         224   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             224   4e-67   Solanum lycopersicum
emb|CDX75708.1|  BnaC03g37910D                                          224   4e-67   
ref|XP_002523382.1|  multicopper oxidase, putative                      224   5e-67   Ricinus communis
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             223   6e-67   Cicer arietinum [garbanzo]
gb|KHN44494.1|  L-ascorbate oxidase like                                223   6e-67   Glycine soja [wild soybean]
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             223   6e-67   Tarenaya hassleriana [spider flower]
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             223   7e-67   Glycine max [soybeans]
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             223   7e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             223   8e-67   Populus euphratica
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             223   9e-67   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             223   1e-66   
gb|EPS68478.1|  hypothetical protein M569_06286                         223   1e-66   Genlisea aurea
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   1e-66   Populus euphratica
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   1e-66   Populus euphratica
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             223   2e-66   Nicotiana tomentosiformis
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             223   2e-66   Nicotiana sylvestris
emb|CDP04133.1|  unnamed protein product                                223   2e-66   Coffea canephora [robusta coffee]
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             222   2e-66   Eutrema salsugineum [saltwater cress]
emb|CDX82540.1|  BnaA03g32810D                                          222   2e-66   
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                223   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-66   Eucalyptus grandis [rose gum]
gb|KHN20513.1|  L-ascorbate oxidase like                                221   4e-66   Glycine soja [wild soybean]
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    221   4e-66   Arabis alpina [alpine rockcress]
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             219   4e-66   Cucumis melo [Oriental melon]
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         221   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002523381.1|  multicopper oxidase, putative                      221   6e-66   Ricinus communis
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             221   7e-66   Vitis vinifera
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             221   7e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             221   7e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         221   8e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             221   9e-66   Camelina sativa [gold-of-pleasure]
emb|CAN69061.1|  hypothetical protein VITISV_032605                     221   9e-66   Vitis vinifera
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             220   1e-65   Camelina sativa [gold-of-pleasure]
gb|KHG27164.1|  L-ascorbate oxidase                                     218   1e-65   Gossypium arboreum [tree cotton]
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             220   2e-65   Glycine max [soybeans]
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             220   2e-65   Populus euphratica
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA47177.1|  Bplo                                                   220   2e-65   Brassica napus [oilseed rape]
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-65   Cicer arietinum [garbanzo]
emb|CDX82541.1|  BnaA03g32800D                                          219   2e-65   
emb|CDY10549.1|  BnaC03g70650D                                          219   3e-65   Brassica napus [oilseed rape]
emb|CDY56013.1|  BnaA08g29220D                                          219   3e-65   Brassica napus [oilseed rape]
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-65   Brassica rapa
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-65   Brassica rapa
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-65   Brassica rapa
emb|CDY23597.1|  BnaC05g39970D                                          219   3e-65   Brassica napus [oilseed rape]
emb|CDY43994.1|  BnaA05g25890D                                          219   4e-65   Brassica napus [oilseed rape]
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             219   4e-65   Tarenaya hassleriana [spider flower]
emb|CDY43352.1|  BnaA01g29830D                                          218   4e-65   Brassica napus [oilseed rape]
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             219   4e-65   Capsella rubella
ref|NP_175953.1|  protein SKU5 similar 12                               219   5e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97352.1|  BnaA02g21430D                                          217   5e-65   
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    218   5e-65   Arabis alpina [alpine rockcress]
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY24188.1|  BnaC01g37680D                                          218   5e-65   Brassica napus [oilseed rape]
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             218   6e-65   Arabidopsis lyrata subsp. lyrata
ref|NP_187948.1|  protein SKU5-like 13                                  218   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             218   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   7e-65   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             218   7e-65   Brassica rapa
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             218   7e-65   Capsella rubella
gb|AAD10639.1|  putative pollen specific protein                        218   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    218   1e-64   Arabis alpina [alpine rockcress]
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             218   1e-64   Eutrema salsugineum [saltwater cress]
gb|KJB83388.1|  hypothetical protein B456_013G245000                    218   1e-64   Gossypium raimondii
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             218   1e-64   Phaseolus vulgaris [French bean]
gb|KJB83386.1|  hypothetical protein B456_013G244800                    217   1e-64   Gossypium raimondii
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    217   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             217   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             217   2e-64   Arabidopsis lyrata subsp. lyrata
emb|CDX75707.1|  BnaC03g37900D                                          217   2e-64   
emb|CAA47178.1|  Bplo                                                   217   2e-64   Brassica napus [oilseed rape]
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             217   2e-64   Camelina sativa [gold-of-pleasure]
ref|NP_564697.1|  SKU5 similar 14                                       217   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             217   2e-64   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    216   3e-64   Arabis alpina [alpine rockcress]
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             216   3e-64   Capsella rubella
gb|KJB83384.1|  hypothetical protein B456_013G2447001                   205   4e-64   Gossypium raimondii
ref|XP_007014661.1|  SKU5 similar 12                                    216   4e-64   Theobroma cacao [chocolate]
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             216   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             216   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             216   4e-64   Camelina sativa [gold-of-pleasure]
emb|CDY23596.1|  BnaC05g39980D                                          216   5e-64   Brassica napus [oilseed rape]
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   215   8e-64   Medicago truncatula
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             215   8e-64   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             215   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             215   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             215   1e-63   Camelina sativa [gold-of-pleasure]
ref|NP_187947.1|  protein SKU5-like 11                                  215   1e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05644.1|  L-ascorbate oxidase                                     214   1e-63   Gossypium arboreum [tree cotton]
gb|AGW80453.1|  pollen-specific protein                                 215   1e-63   Gossypium hirsutum [American cotton]
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             215   1e-63   Capsella rubella
gb|KDP30646.1|  hypothetical protein JCGZ_16211                         212   1e-63   Jatropha curcas
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             214   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-63   Camelina sativa [gold-of-pleasure]
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    214   2e-63   Brassica napus [oilseed rape]
gb|KJB15368.1|  hypothetical protein B456_002G173600                    214   2e-63   Gossypium raimondii
gb|AFC88081.1|  skewed-like protein                                     214   2e-63   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             214   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             214   3e-63   Solanum tuberosum [potatoes]
gb|ABV89619.1|  Sku5-like 11                                            213   4e-63   Brassica rapa
gb|KHN42951.1|  L-ascorbate oxidase like                                210   4e-63   Glycine soja [wild soybean]
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             213   5e-63   Phaseolus vulgaris [French bean]
ref|NP_001132891.1|  uncharacterized protein LOC100194388               209   8e-63   Zea mays [maize]
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             213   9e-63   Solanum lycopersicum
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             212   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83387.1|  hypothetical protein B456_013G244900                    211   3e-62   Gossypium raimondii
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             211   3e-62   Glycine max [soybeans]
gb|KHG03555.1|  L-ascorbate oxidase                                     211   4e-62   Gossypium arboreum [tree cotton]
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             211   5e-62   Glycine max [soybeans]
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    210   5e-62   Nicotiana tomentosiformis
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             210   6e-62   Phoenix dactylifera
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             210   6e-62   Phoenix dactylifera
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             210   7e-62   Fragaria vesca subsp. vesca
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             210   9e-62   Elaeis guineensis
dbj|BAK05994.1|  predicted protein                                      210   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12555.1|  L-ascorbate oxidase-like protein                        207   1e-61   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    209   2e-61   Nicotiana tomentosiformis
emb|CDY24189.1|  BnaC01g37690D                                          209   2e-61   Brassica napus [oilseed rape]
gb|EMS63309.1|  L-ascorbate oxidase-like protein                        203   2e-61   Triticum urartu
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             209   2e-61   Setaria italica
emb|CDY43353.1|  BnaA01g29840D                                          209   2e-61   Brassica napus [oilseed rape]
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             209   3e-61   Brassica rapa
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             209   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    209   3e-61   Zea mays [maize]
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             209   3e-61   Elaeis guineensis
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         208   4e-61   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             208   5e-61   Elaeis guineensis
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   207   9e-61   Medicago truncatula
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             207   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             206   2e-60   Phoenix dactylifera
emb|CAA47176.1|  Bplo                                                   206   2e-60   Brassica napus [oilseed rape]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      206   3e-60   Zea mays [maize]
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          206   3e-60   Sorghum bicolor [broomcorn]
gb|ACN34077.1|  unknown                                                 206   3e-60   Zea mays [maize]
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             206   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             205   8e-60   Citrus clementina [clementine]
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             204   2e-59   Elaeis guineensis
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             204   2e-59   Setaria italica
gb|EEC79422.1|  hypothetical protein OsI_20394                          201   3e-59   Oryza sativa Indica Group [Indian rice]
gb|AES71848.2|  L-ascorbate oxidase-like protein                        202   3e-59   Medicago truncatula
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             203   3e-59   Cicer arietinum [garbanzo]
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        203   4e-59   Cynodon dactylon
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             202   5e-59   Phaseolus vulgaris [French bean]
ref|NP_001044620.1|  Os01g0816700                                       202   5e-59   
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   202   6e-59   
gb|EEE55579.1|  hypothetical protein OsJ_03867                          202   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   202   8e-59   Medicago truncatula
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             202   9e-59   Prunus mume [ume]
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             202   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   202   9e-59   Medicago truncatula
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             202   9e-59   Phoenix dactylifera
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          202   9e-59   Amborella trichopoda
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           202   1e-58   
gb|ACF86554.2|  unknown                                                 202   1e-58   Zea mays [maize]
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             202   1e-58   Solanum tuberosum [potatoes]
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   201   1e-58   Medicago truncatula
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             201   2e-58   Phaseolus vulgaris [French bean]
gb|AAT01329.1|  putative L-ascorbate oxidase                            201   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          201   3e-58   Sorghum bicolor [broomcorn]
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             200   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             199   9e-58   Brachypodium distachyon [annual false brome]
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           199   9e-58   Zea mays [maize]
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   199   9e-58   Medicago truncatula
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             199   1e-57   
gb|AFK44839.1|  unknown                                                 194   2e-57   Medicago truncatula
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             198   2e-57   Oryza brachyantha
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             198   3e-57   Prunus mume [ume]
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    198   3e-57   Arabis alpina [alpine rockcress]
gb|ACN26659.1|  unknown                                                 198   3e-57   Zea mays [maize]
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             197   4e-57   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             197   4e-57   Prunus mume [ume]
gb|ABV89620.1|  Sku5-like 12                                            189   4e-57   Brassica rapa
gb|KJB27391.1|  hypothetical protein B456_004G016000                    194   7e-57   Gossypium raimondii
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   196   1e-56   Medicago truncatula
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             197   3e-56   
dbj|BAK07214.1|  predicted protein                                      194   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        192   3e-55   
emb|CDM84722.1|  unnamed protein product                                191   1e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             190   2e-54   Brassica rapa
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             190   3e-54   Prunus persica
emb|CAE53901.1|  putative L-ascorbate oxidase homolog                   177   2e-53   Triticum aestivum [Canadian hard winter wheat]
emb|CDY50029.1|  BnaA06g00300D                                          186   6e-53   Brassica napus [oilseed rape]
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          176   3e-49   Amborella trichopoda
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                175   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             172   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          169   2e-47   
ref|XP_010089486.1|  L-ascorbate oxidase-like protein                   164   2e-47   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        172   2e-47   Triticum urartu
gb|KJB23444.1|  hypothetical protein B456_004G098200                    171   3e-47   Gossypium raimondii
gb|KHG03845.1|  L-ascorbate oxidase                                     171   3e-47   Gossypium arboreum [tree cotton]
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             171   4e-47   Sesamum indicum [beniseed]
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             171   4e-47   Pyrus x bretschneideri [bai li]
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             171   4e-47   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             170   5e-47   Prunus mume [ume]
emb|CDY29530.1|  BnaA06g14400D                                          171   6e-47   Brassica napus [oilseed rape]
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             170   6e-47   Prunus mume [ume]
gb|KHN46930.1|  L-ascorbate oxidase like                                165   6e-47   Glycine soja [wild soybean]
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             170   7e-47   Prunus persica
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             169   1e-46   Nicotiana tomentosiformis
gb|AGT57427.1|  ascorbate oxidase                                       169   1e-46   Prunus persica
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             169   1e-46   Fragaria vesca subsp. vesca
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             169   1e-46   Phaseolus vulgaris [French bean]
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          169   1e-46   
ref|NP_001241709.1|  uncharacterized protein LOC100856887               164   1e-46   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   169   1e-46   Morus notabilis
dbj|BAH57047.1|  AT4G38420                                              165   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KJB40234.1|  hypothetical protein B456_007G052900                    169   2e-46   Gossypium raimondii
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   Nicotiana sylvestris
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             169   2e-46   Prunus persica
emb|CDX81353.1|  BnaC09g07640D                                          169   2e-46   
gb|KHG25743.1|  L-ascorbate oxidase                                     169   2e-46   Gossypium arboreum [tree cotton]
dbj|BAF01895.1|  hypothetical protein                                   162   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAD41439.1|AC007727_28  Strong similarity to gb|X96932 ascorba...    164   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   4e-46   Nicotiana sylvestris
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             168   4e-46   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             167   5e-46   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             167   5e-46   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             167   6e-46   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             167   6e-46   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             167   6e-46   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             167   6e-46   
emb|CDY18626.1|  BnaA09g07690D                                          167   7e-46   
gb|KJB47728.1|  hypothetical protein B456_008G038600                    164   8e-46   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   8e-46   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             167   8e-46   
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             167   9e-46   
emb|CBI18561.3|  unnamed protein product                                167   9e-46   
ref|XP_007047151.1|  SKU5 similar 16                                    167   9e-46   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             166   1e-45   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             166   1e-45   
gb|KHN05478.1|  L-ascorbate oxidase like                                166   1e-45   
emb|CDP10787.1|  unnamed protein product                                166   1e-45   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             166   2e-45   
gb|ACF85744.1|  unknown                                                 164   2e-45   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    165   2e-45   
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             166   2e-45   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             166   2e-45   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             166   2e-45   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    166   3e-45   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       164   3e-45   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   165   3e-45   
emb|CDY31468.1|  BnaC05g15770D                                          166   3e-45   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             165   4e-45   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             165   4e-45   
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             164   4e-45   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             165   4e-45   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             165   4e-45   
gb|KJB71075.1|  hypothetical protein B456_011G104400                    165   4e-45   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             165   4e-45   
gb|KJB57755.1|  hypothetical protein B456_009G179300                    165   4e-45   
gb|ADB28926.1|  multicopper oxidase protein                             160   5e-45   
gb|KGN43295.1|  hypothetical protein Csa_7G018770                       163   5e-45   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             165   6e-45   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             165   6e-45   
gb|KEH20500.1|  multi-copper oxidase-like protein                       165   6e-45   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             165   6e-45   
ref|NP_173604.1|  SKU5 similar 7 protein                                164   6e-45   
gb|AGJ03718.1|  multicopper oxidase                                     164   6e-45   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          164   6e-45   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             164   7e-45   
ref|XP_002528421.1|  multicopper oxidase, putative                      164   7e-45   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             164   7e-45   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             164   7e-45   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   164   8e-45   
gb|ABK95805.1|  unknown                                                 164   9e-45   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             164   9e-45   
gb|EPS63456.1|  hypothetical protein M569_11328                         160   1e-44   
ref|XP_003596959.1|  L-ascorbate oxidase-like protein                   163   1e-44   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             164   1e-44   
gb|KHN12597.1|  L-ascorbate oxidase like                                163   1e-44   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         164   1e-44   
gb|KHN20130.1|  L-ascorbate oxidase like                                159   1e-44   
gb|KHG21949.1|  L-ascorbate oxidase                                     164   1e-44   
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             163   1e-44   
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   
ref|XP_004305573.1|  PREDICTED: L-ascorbate oxidase homolog             158   1e-44   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             164   2e-44   
emb|CDY64276.1|  BnaCnng43630D                                          164   2e-44   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             164   2e-44   
gb|KEH29685.1|  multi-copper oxidase-like protein                       163   2e-44   
ref|NP_173603.1|  SKU5 similar 8 protein                                163   2e-44   
ref|XP_010550775.1|  PREDICTED: L-ascorbate oxidase homolog             156   2e-44   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             163   2e-44   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             163   2e-44   
ref|XP_007041705.1|  SKU5 similar 5                                     163   2e-44   
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             163   2e-44   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             163   2e-44   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             163   3e-44   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   163   3e-44   
gb|KJB47727.1|  hypothetical protein B456_008G038600                    163   3e-44   
gb|AAG52028.1|AC022456_9  pectinesterase, putative, 5' partial; 9...    158   3e-44   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             163   3e-44   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             163   3e-44   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             163   3e-44   
ref|NP_195555.2|  protein SKU5 similar 9                                162   4e-44   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             162   4e-44   
emb|CAB37498.1|  putative pectinesterase                                162   4e-44   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             162   4e-44   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    162   4e-44   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             162   4e-44   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    162   4e-44   
gb|KJB15897.1|  hypothetical protein B456_002G202300                    162   4e-44   
ref|XP_010550779.1|  PREDICTED: L-ascorbate oxidase homolog             155   5e-44   
gb|KHN33820.1|  L-ascorbate oxidase like                                162   5e-44   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             162   6e-44   
emb|CDY01453.1|  BnaA07g12260D                                          162   6e-44   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         162   6e-44   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             162   6e-44   
gb|ACL53812.1|  unknown                                                 162   6e-44   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         162   7e-44   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           162   7e-44   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             162   7e-44   
ref|XP_002522337.1|  multicopper oxidase, putative                      162   7e-44   
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             160   7e-44   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        162   7e-44   
gb|KHG07318.1|  L-ascorbate oxidase                                     162   7e-44   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             161   8e-44   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         161   8e-44   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             162   8e-44   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          162   8e-44   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             161   9e-44   
gb|KJB43624.1|  hypothetical protein B456_007G209900                    161   9e-44   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             161   9e-44   
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           161   9e-44   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             161   9e-44   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      161   9e-44   
gb|ACN28536.1|  unknown                                                 160   9e-44   
gb|EEC82126.1|  hypothetical protein OsI_26158                          161   9e-44   
gb|KJB14335.1|  hypothetical protein B456_002G120000                    161   9e-44   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
dbj|BAC83966.1|  putative PS60                                          162   1e-43   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     161   1e-43   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
gb|KHF99506.1|  L-ascorbate oxidase                                     161   1e-43   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    161   1e-43   
ref|XP_008466955.1|  PREDICTED: L-ascorbate oxidase homolog             156   1e-43   
ref|XP_002518462.1|  multicopper oxidase, putative                      161   1e-43   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             161   1e-43   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|NP_177743.1|  SKU5-like 5 protein                                   161   1e-43   
gb|AAL09733.1|  At1g76160/T23E18_10                                     161   1e-43   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             161   1e-43   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             161   1e-43   
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             161   1e-43   
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             160   2e-43   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           160   2e-43   
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             160   2e-43   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    160   2e-43   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
dbj|BAK04971.1|  predicted protein                                      160   2e-43   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          160   2e-43   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         160   2e-43   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             160   2e-43   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
emb|CDY54804.1|  BnaA06g40970D                                          161   2e-43   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          160   2e-43   
gb|KHN44868.1|  L-ascorbate oxidase like                                160   2e-43   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             160   2e-43   
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    160   2e-43   
gb|KJB67220.1|  hypothetical protein B456_010G181000                    159   3e-43   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             160   3e-43   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    160   3e-43   
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    160   3e-43   
gb|KHG11003.1|  L-ascorbate oxidase                                     160   3e-43   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_008359469.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    159   3e-43   
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    160   3e-43   
ref|XP_002393980.1|  hypothetical protein MPER_06203                    152   3e-43   
emb|CDX79120.1|  BnaA01g11870D                                          160   3e-43   
gb|KJB67218.1|  hypothetical protein B456_010G181000                    160   3e-43   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
emb|CDY68834.1|  BnaCnng60730D                                          160   3e-43   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
emb|CDY55201.1|  BnaCnng28410D                                          160   4e-43   
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_010478973.1|  PREDICTED: L-ascorbate oxidase homolog             158   4e-43   
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   159   4e-43   
ref|XP_002524823.1|  multicopper oxidase, putative                      160   4e-43   
gb|ABR18324.1|  unknown                                                 160   4e-43   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             160   4e-43   
ref|XP_008345816.1|  PREDICTED: L-ascorbate oxidase homolog             152   4e-43   
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             159   4e-43   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                159   4e-43   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             159   5e-43   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             159   5e-43   
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             159   5e-43   
ref|NP_001147597.1|  LOC100281206 precursor                             159   5e-43   
dbj|BAH20248.1|  AT1G41830                                              157   5e-43   
gb|KJB83390.1|  hypothetical protein B456_013G245100                    157   5e-43   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    159   5e-43   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             159   5e-43   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    159   5e-43   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             159   5e-43   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             159   5e-43   
emb|CDX82897.1|  BnaC01g13470D                                          159   6e-43   
gb|KGN43515.1|  hypothetical protein Csa_7G043570                       158   6e-43   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             159   6e-43   
gb|AAM97070.1|  pectinesterase, putative                                159   6e-43   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   159   6e-43   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             159   7e-43   
gb|KHG02352.1|  L-ascorbate oxidase                                     159   7e-43   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   159   7e-43   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             159   8e-43   
ref|XP_006396009.1|  hypothetical protein EUTSA_v10004223mg             157   8e-43   
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             159   8e-43   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             159   8e-43   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             159   8e-43   
gb|AFK45722.1|  unknown                                                 149   8e-43   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               159   9e-43   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    159   1e-42   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             159   1e-42   
gb|KHF99853.1|  L-ascorbate oxidase                                     158   1e-42   
gb|KHG04142.1|  L-ascorbate oxidase                                     159   1e-42   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          158   1e-42   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             158   1e-42   



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL E+F +P K FKYD+M D PP +L    T++PNV NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLVEFFGVPEKTFKYDLMADEPPSDLSK-VTISPNVKNATFRNFVEIIFENEEKTIQTYH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVGIEPGKWSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  450  LDGYSFFAVGIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSE  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  510  MWERFYLGQQLYFSVLSPSRSLRDEYNL  537



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL E+F +P K FKYD++ D PP +L    T++PNV NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLVEFFGVPEKTFKYDLIADEPPSDLSK-VTISPNVKNATFRNFVEIIFENQEKTIQTYH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPGKWSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  450  LDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSE  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  510  MWERFYLGQQLYFSVLSPSRSLRDEYNL  537



>gb|AAD02557.1| PGPS/NH15 [Petunia x hybrida]
Length=167

 Score =   241 bits (615),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  441  LAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYHL  262
            L EYF    K FKYD+M D PP +L    T+A NV NAT+RNFVEIIFEN EKTIQTYHL
Sbjct  1    LVEYFGASEKTFKYDLMADEPPSDLSK-VTIAANVKNATYRNFVEIIFENREKTIQTYHL  59

Query  261  DGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSEM  82
            DG+SFFAV IEPGKWSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAGMWNLRS+M
Sbjct  60   DGYSFFAVAIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDM  119

Query  81   WARTYLGQQMYFSVLSPERSLRDEHNM  1
            W + YLGQQ+YFSVLSP  SLRDE+N+
Sbjct  120  WEKFYLGQQLYFSVLSPSGSLRDEYNL  146



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPP---DNLENPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KL EYF +  K FKYD+MGD PP    N     T+APNV NATFRNFVEIIFEN EKTIQ
Sbjct  396  KLVEYFGVAEKTFKYDVMGDEPPTPSSNNNKVVTIAPNVKNATFRNFVEIIFENEEKTIQ  455

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            TYHLDG+SFFAVGIEPGKW PEKRKNYNLVDA+SRH+IQVYPNSWAAIMTTLDNAG+WNL
Sbjct  456  TYHLDGYSFFAVGIEPGKWKPEKRKNYNLVDAVSRHSIQVYPNSWAAIMTTLDNAGIWNL  515

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS+MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  516  RSDMWERNYLGQQLYFSVLSPSRSLRDEYNL  546



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL E+F +P K FKYD++ D PP +L    T++ NV NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLVEFFGVPEKTFKYDLIADEPPSDLSK-VTISSNVKNATFRNFVEIIFENQEKTIQTYH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPGKWSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  450  LDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSE  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  510  MWERFYLGQQLYFSVLSPSRSLRDEYNL  537



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  K+FKYD+M D P  +  N  T+APN+ NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTIQTYH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPGKWS EKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAG+WNLRSE
Sbjct  451  LDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSE  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  511  MWERYYLGQQLYFSVLSPARSLRDEYNL  538



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  K+FKYD+M D P  +  N  T+APN+ NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTIQTYH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPGKWS EKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAG+WNLRSE
Sbjct  451  LDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSE  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  511  MWERYYLGQQLYFSVLSPARSLRDEYNL  538



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF    K+FKYD+M D P     N  T+ PN+ NATFRNFVEIIFEN EKTIQTYH
Sbjct  391  KLAEYFGATDKLFKYDLMADEPQTEDLNKVTVVPNIKNATFRNFVEIIFENREKTIQTYH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAG+WNLRSE
Sbjct  451  LDGYSFFAVAIEPGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSE  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  511  MWERFYLGQQLYFSVLSPARSLRDEYNL  538



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD+M D P    E  A+LAPNVVNATFRNFVEI+FENHE+TIQT+H
Sbjct  416  KLAEYFGVGDKVFKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTIQTWH  475

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFAV +EPG+WSPEKRKNYNL DA+SRHTIQVYPNSWAA+MTTLDNAG+WNLRSE
Sbjct  476  LDGYAFFAVAVEPGRWSPEKRKNYNLEDAVSRHTIQVYPNSWAAVMTTLDNAGLWNLRSE  535

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ YFSVLSP RSLRDE+N+
Sbjct  536  MRERAYLGQQFYFSVLSPARSLRDEYNI  563



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF    KVFKYD+M D+ P    +  T+A N+ NATFRNFVEIIFENHEKTIQTYH
Sbjct  390  KLAEYFGATDKVFKYDLM-DDEPSTSSDKVTVASNIKNATFRNFVEIIFENHEKTIQTYH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+EPGKW+PEKRKNYNLVDAI+RH+IQVYPNSWAA+MTTLDNAG+W+LRSE
Sbjct  449  LDGYSFFAVGVEPGKWTPEKRKNYNLVDAINRHSIQVYPNSWAAVMTTLDNAGLWSLRSE  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  509  MWERFYLGQQLYFSVLSPARSLRDEYNL  536



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF    KVFKYD+M D P    ++  T+A N+ NATFRNFVEI+FENHEKTIQTYH
Sbjct  390  KLAEYFGATDKVFKYDLMPDQP-STPDDKVTIASNIKNATFRNFVEIVFENHEKTIQTYH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKW+PEKRKNYNLVDAISRH+IQVYPNSWAA+MTTLDNAG+W+LRSE
Sbjct  449  LDGYSFFAVAVEPGKWTPEKRKNYNLVDAISRHSIQVYPNSWAAVMTTLDNAGLWSLRSE  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  509  MWERFYLGQQLYFSVLSPARSLRDEYNL  536



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLEN--PATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KL EY+ I  KVFKYDI+ D P    E+     LAPNV+NATFRNFVEII ENHEKTIQT
Sbjct  392  KLVEYYGIQDKVFKYDIIKDEPEAASESNEKIVLAPNVLNATFRNFVEIILENHEKTIQT  451

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            +HLDG+SFFAV IEPG+W+PEKRKNYNLVDA+SRH IQVYP SWAAIMTTLDNAGMWN+R
Sbjct  452  WHLDGYSFFAVAIEPGRWTPEKRKNYNLVDAVSRHNIQVYPGSWAAIMTTLDNAGMWNMR  511

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            SEMW R YLGQQ YFSVLSP RSLRDE+N+
Sbjct  512  SEMWERAYLGQQFYFSVLSPARSLRDEYNL  541



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVF Y++M D P +  +N   LAP+VVNATFRNFVEIIFEN EKTIQT+H
Sbjct  389  KLAEYFGLGDKVFTYNLMKDEPTEG-DNKLALAPSVVNATFRNFVEIIFENREKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+W+PEKRKNYNL+DA+SRHTIQVYPNSWAA+MTTLDNAGMWNLRS+
Sbjct  448  LDGYSFFAVAVEPGRWAPEKRKNYNLLDAVSRHTIQVYPNSWAAVMTTLDNAGMWNLRSD  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  RTYLGQQ YFSVLSPE SLRDE+N+
Sbjct  508  MLERTYLGQQFYFSVLSPENSLRDEYNI  535



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVF Y++M D P +  +N   +AP+VVNATFRNFVEIIFEN EKTIQT+H
Sbjct  389  KLAEYFGLGDKVFTYNLMKDEPTEG-DNKLVVAPSVVNATFRNFVEIIFENREKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRK YNL+DA+SRHTIQVYPNSW+A+MTTLDNAGMWNLRS+
Sbjct  448  LDGYSFFAVAVEPGRWSPEKRKTYNLLDAVSRHTIQVYPNSWSAVMTTLDNAGMWNLRSD  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  RTYLGQQ YFSVLSPE SLRDE+N+
Sbjct  508  MLERTYLGQQFYFSVLSPENSLRDEYNI  535



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF    KVFKYD+M D PP    +  T+  N+ NAT+RN+VEIIFEN EKTIQTYH
Sbjct  392  KLAEYFGATDKVFKYDLMADEPPSG--DKVTVDHNIKNATYRNYVEIIFENREKTIQTYH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPGKWSPEKRKNYNLVDA+SRH+IQVYPNSWAA+MTTLDNAG+WNLRS+
Sbjct  450  LDGYSFFAVAIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSD  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDE  10
            MW R YLGQQ+YFSVL P RSLRDE
Sbjct  510  MWERYYLGQQLYFSVLLPTRSLRDE  534



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  +VFKYDI+ D+PP ++    T+APNV+   FRNFVEIIFENHEK++Q++H
Sbjct  383  KLAEYYGIQDQVFKYDIITDDPPADVGTKVTIAPNVITGIFRNFVEIIFENHEKSVQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV IEPG WSPEKRKNYNLVDA+SRHTIQVYP  WAAIMTTLDNAGMWN+RS 
Sbjct  443  LSGYSFFAVAIEPGTWSPEKRKNYNLVDAVSRHTIQVYPKGWAAIMTTLDNAGMWNMRSL  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQQ+Y SVLSP RSLRDE+NM
Sbjct  503  LLERNYLGQQLYVSVLSPARSLRDEYNM  530



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFEI  KVFKYD++ D  P       T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  378  KLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWH  437

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  438  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSE  497

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  498  LIENRYLGQQLYISVLSPARSLRDEYNI  525



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFEI  KVFKYD++ D  P       T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  385  KLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  505  LIENRYLGQQLYISVLSPARSLRDEYNI  532



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD++GD PP  +    T+ PNV+N TFRNFVEII ENHEK+IQ+YH
Sbjct  386  KLAEYYNVANKVFKYDVIGDEPPAKITG-VTVQPNVLNMTFRNFVEIILENHEKSIQSYH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKR+NYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWN+RSE
Sbjct  445  LDGYSFFAVAIEPGRWTPEKRRNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W RTYLGQQ+Y SV SP RSLRDE+N+
Sbjct  505  IWERTYLGQQLYASVASPVRSLRDEYNI  532



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D PP  +E+  TLAPNVVN TFR+FVEIIFENHEK+IQ++H
Sbjct  384  KLAEYFGVADKVFKYDTIEDEPPATVEDKITLAPNVVNQTFRDFVEIIFENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKRKNYNL+D +SRHTIQV+P SWAA+M T DNAGMWN+RSE
Sbjct  444  LDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAVMLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y SVLSP RSLRDE+N+
Sbjct  504  QPERRYLGQQFYVSVLSPARSLRDEYNL  531



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD++ D P  + E+  T+APNVVN TFRNF+EIIFENHEK+IQ++H
Sbjct  385  KLAEYFGVSDKVFKYDLIKDEPSADAEDHITIAPNVVNGTFRNFIEIIFENHEKSIQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+P KR NYNL+DAISRHTIQVYPNSWAAIMTTLDN GMWNLRS 
Sbjct  445  LDGYSFFAVAIEPGRWAPAKRANYNLIDAISRHTIQVYPNSWAAIMTTLDNCGMWNLRSV  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEH  7
               R YLGQQ+YFSV+SPE SLRDE+
Sbjct  505  SLERNYLGQQLYFSVVSPEHSLRDEY  530



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D P         + PNV+NATFRNFVEII ENHEK+IQ++H
Sbjct  384  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVGIEPGKW+PE+RKNYNL+DA+SRHT+QV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  444  LDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  IWDRFYLGQQLYVSVLSPARSLRDEYNI  531



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + D+PP  +E  ATLAPNV+N TFR+FVEIIFEN EKTIQ++H
Sbjct  384  KLAEYFGIADKVFKYDTIKDDPPAKVEE-ATLAPNVMNMTFRDFVEIIFENPEKTIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKR NYNL+DA+SRHT+QVYP SWAAI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVAVEPGTWTPEKRNNYNLLDAVSRHTVQVYPKSWAAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W +TYLGQQ+Y SVLSP RSLRDE+N+
Sbjct  503  IWEKTYLGQQLYASVLSPARSLRDEYNI  530



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYDI+ D  P       T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  386  KLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  506  LTENRYLGQQLYMSVLSPARSLRDEYNI  533



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D P         + PNV+NATFRNFVEII ENHEK+IQ++H
Sbjct  385  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVGIEPGKW+PE+RKNYNL+DA+SRHT+QV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  505  IWDRFYLGQQLYVSVLSPARSLRDEYNI  532



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D P         + PNV+NATFRNFVEII ENHEK+IQ++H
Sbjct  383  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVGIEPGKW+PE+RKNYNL+DA+SRHT+QV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  443  LDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  503  IWDRFYLGQQLYVSVLSPARSLRDEYNI  530



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF +  KVFKYD + D PP  +E+  TLAPNVVN TFR FVEIIFENHEK+IQ++H
Sbjct  384  KLAQYFGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRXFVEIIFENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKRKNYNL+D +SRHTIQV+P SWAAIM T DNAGMWN+RSE
Sbjct  444  LDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y SVLSP RSLRDE+N+
Sbjct  504  QPERRYLGQQFYVSVLSPARSLRDEYNL  531



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKYD + D       N  T+APNVVNATFRNFVEIIFENHEK++Q++H
Sbjct  385  KLAEYFEVADKVFKYDTISDEGSAKTANTVTIAPNVVNATFRNFVEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKRKNYNL+DA+SRHTIQV+P SW AI+ TLDNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWGAILLTLDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+YFSV SP RSLRDE+N+
Sbjct  505  LTENRYLGQQLYFSVQSPARSLRDEYNI  532



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D+PP  +E+  TLAPNVVN TFRNFVEIIFENHEK+IQ+++
Sbjct  384  KLAEYYGVADKVFKYDTIQDDPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSWN  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKRKNYNL+D +SRHTIQV+P SWAAIM T DNAGMWN+RSE
Sbjct  444  LDGYSFFAVAIEPGRWAPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y SVLSP RSLRDE+N+
Sbjct  504  QSERRYLGQQFYVSVLSPARSLRDEYNL  531



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +     T+A NV NAT+RNFVEIIFENHEKTI+TYH
Sbjct  387  KLVEYFGATDKAFKYDLMADEAPAD-STKLTIAANVKNATYRNFVEIIFENHEKTIRTYH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNLVD +SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+Q+YFSVLSP RSLRDE+N+
Sbjct  506  MWEKTYLGEQLYFSVLSPSRSLRDEYNI  533



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+++  KVFKYDI+ D PP N  +  T+A NVVN TFRNFVEIIFENHEK++QT+H
Sbjct  367  KLAEYYQVADKVFKYDIISDEPPANAGDKITVATNVVNQTFRNFVEIIFENHEKSLQTWH  426

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSP+KR  YNL+DA+SRHTIQV+P SWAAIM T DNAGMWNLRSE
Sbjct  427  LDGYSFFAVAIEPGRWSPDKRSRYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  486

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQQ+Y SV SP RSLRDE+NM
Sbjct  487  LTERRYLGQQLYISVQSPARSLRDEYNM  514



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD M D PP + +    + PNV+N TFRNFVEIIFENHEK+IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTMKDTPPSSDKVDIVMQPNVMNFTFRNFVEIIFENHEKSIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFAVGIEPG WSPEKRKNYNL+DA+SR TIQVYP SWAAI+ T DNAGMWN+RSE
Sbjct  444  LDGYAFFAVGIEPGIWSPEKRKNYNLLDAVSRTTIQVYPKSWAAILLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW RTYLGQQ Y S LSP RSLRDE+++
Sbjct  504  MWERTYLGQQFYVSTLSPGRSLRDEYSL  531



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +  +  T+A NV NAT+RNFVEIIFENHEKTI+TYH
Sbjct  387  KLVEYFGATNKAFKYDLMADEAPAD-PSKLTIATNVKNATYRNFVEIIFENHEKTIRTYH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNLVD +SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+Q+YFSVLSP RSLRDE+N+
Sbjct  506  MWEKTYLGEQLYFSVLSPSRSLRDEYNI  533



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +  +  T+APNV NAT+RNFVEIIFENHEK+I+TYH
Sbjct  387  KLVEYFGAADKTFKYDLMADEAPAD-PSKLTVAPNVKNATYRNFVEIIFENHEKSIRTYH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKWS EKRKNYNLVDA SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAVEPGKWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+Q+YFSVLSP RSLRDE+N+
Sbjct  506  MWEKTYLGEQLYFSVLSPGRSLRDEYNL  533



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D P         + PNV+NATFRNFVEII ENHEK+IQ++H
Sbjct  384  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVGIEPGKW+PE+RKNYNL+DA+SRHT+QV+P SWAAI+ T DNAGMWNLRSE
Sbjct  444  LDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPKSWAAILLTFDNAGMWNLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  IWDRFYLGQQLYVSVLSPARSLRDEYNI  531



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYDI+ D  P       T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  386  KLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+PNSWAAI+ T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLG Q+Y SVLSP RSLRDE+N+
Sbjct  506  LTENRYLGSQLYISVLSPARSLRDEYNI  533



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +  +  T+A NV NAT+RNFVEIIFENHEKTI+TYH
Sbjct  422  KLVEYFGATDKAFKYDLMADEAPAD-PSKLTIATNVKNATYRNFVEIIFENHEKTIRTYH  480

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNLVD +SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  481  LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  540

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+Q+YFSVLSP RSLRDE+N+
Sbjct  541  MWEKTYLGEQLYFSVLSPSRSLRDEYNI  568



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD++ D PP  L    TLAPNVVN TFRNFVEIIFENHEK++Q++H
Sbjct  382  KLAEYYGVADKVFKYDLIKDEPPKKLSGEVTLAPNVVNQTFRNFVEIIFENHEKSLQSWH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV IEPG+W PEKRKNYNL+DA+SRHTIQVYP S+AA++ T DNAGMWNLRSE
Sbjct  442  LAGYSFFAVSIEPGRWRPEKRKNYNLLDAVSRHTIQVYPKSYAAVLLTFDNAGMWNLRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSP RSLRDE+NM
Sbjct  502  LTENRYLGQQLYISVLSPARSLRDEYNM  529



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   N   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  389  KLAEYYGVADKVFTYNLMKDEPQEG--NKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKRKNYNL+DA+SR+TIQVYPN+WAA+MTTLDNAGMWNLRSE
Sbjct  447  LDGYSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNTWAAVMTTLDNAGMWNLRSE  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ YFSV+S  RSLRDE+++
Sbjct  507  MRERAYLGQQFYFSVVSEARSLRDEYSL  534



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +  +  T+APNV N T+RNFVEIIFENHEK+I+TYH
Sbjct  387  KLVEYFGAADKSFKYDLMADEAPAD-PSKLTVAPNVKNTTYRNFVEIIFENHEKSIRTYH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WS EKRKNYNLVDA SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  446  LDGYSFFAVAVEPGRWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+QMYFSVLSP RSLRDE+N+
Sbjct  506  MWEKTYLGEQMYFSVLSPSRSLRDEYNL  533



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    K FKYD+M D  P +     T+  NV NAT+RNFVEIIFENHEKTI+TYH
Sbjct  388  KLVEYFGATDKAFKYDLMADEAPADATK-LTITANVKNATYRNFVEIIFENHEKTIRTYH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNLVD +SR+ IQVYPNSWAAIM T DNAGMWNLRSE
Sbjct  447  LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLG+Q+YFSVLSP RSLRDE+N+
Sbjct  507  MWEKTYLGEQLYFSVLSPSRSLRDEYNI  534



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN---PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KLAEY+ +  KVFKYD++ D+   P    E   TLAPNVVN T+RNFVEIIFENHEK++Q
Sbjct  386  KLAEYYGVANKVFKYDLIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSVQ  445

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            ++HL G+SFFAV IEPGKW+PEKRKNYNL+DA+SR+TIQVYPNSWAAIMTT+DNAG+WNL
Sbjct  446  SFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLWNL  505

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS    R YLGQQ+YFSVLSP+R L+DE+NM
Sbjct  506  RSNSLERQYLGQQLYFSVLSPKRDLKDEYNM  536



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKYD + D       N  T+APNV+NATFRNFVEI+FEN EK++Q++H
Sbjct  385  KLAEYFEVADKVFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNL+DA+SRHTIQV+P SWAAI+ TLDNAGMWNLRSE
Sbjct  445  LDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTLDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQMYFSV SP RSLRDE+N+
Sbjct  505  LTENRYLGQQMYFSVQSPARSLRDEYNI  532



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K AEYF    KVFKYD++ D+PP+      TL PNV N TFR FVEIIFENHEK+IQ++H
Sbjct  384  KFAEYFGTADKVFKYDVIPDSPPEQEPKLVTLEPNVGNITFRTFVEIIFENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+W+PEKRK+YNL+DA+SRHT+QV+P SWAAIM T DNAGMWNLRSE
Sbjct  444  LDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQ+MY SVLSPERSLRDE+N+
Sbjct  504  LLERRYLGQEMYISVLSPERSLRDEYNL  531



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  K F YD++ D P +  +    LAP+VVNATFRNFVEIIFEN+E TIQT+H
Sbjct  393  KLAEYFGLADKAFNYDLVKDEPSN--DKKVVLAPSVVNATFRNFVEIIFENNENTIQTWH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IE GKW+PEKRKNYNL+DA+SRHTI VYP SWAA+MTTLDNAGMWNLRS+
Sbjct  451  LDGYSFFAVAIEAGKWNPEKRKNYNLLDAVSRHTIHVYPKSWAAVMTTLDNAGMWNLRSD  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  511  MAERAYLGQQLYFSVLSPARSLRDEYNI  538



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D P   +E+  TLAPNVVN TFR+FVEIIFENHEK+IQ++H
Sbjct  384  KLAEYFGVADKVFKYDTIQDEPRATVEDKVTLAPNVVNQTFRDFVEIIFENHEKSIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKRKNYNL+D +SRHTIQV+P SWAAIM T DNAGMWN+RSE
Sbjct  444  LDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y SVLSP  SLRDE+N+
Sbjct  504  QPERRYLGQQFYVSVLSPAHSLRDEYNL  531



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D PP  +E+  TLAPNVVN TFRNFVEIIFENHEK+IQ+++
Sbjct  384  KLAEYYGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSWN  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF V IEPG+W+PEKR NYNL+D +SRHTIQV+P SWAAIM T DNAGMWN+RSE
Sbjct  444  LDGYSFFTVAIEPGRWTPEKRNNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y SVLSP RSLRDE+N+
Sbjct  504  QSERRYLGQQFYVSVLSPARSLRDEYNL  531



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPA-TLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            K AEYF +  K+F+Y+++ D+    +  PA  +AP+VVNATFRNFVEIIFENHEKTIQTY
Sbjct  388  KHAEYFGVADKLFQYNLVKDDG-SAVNTPAPIIAPSVVNATFRNFVEIIFENHEKTIQTY  446

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            +LDG+SFFAV +EPG WSPEKRKNYNL+DAISRH +QVYP SWAAIMTTLDNAGMWNLRS
Sbjct  447  NLDGYSFFAVAVEPGTWSPEKRKNYNLLDAISRHNVQVYPGSWAAIMTTLDNAGMWNLRS  506

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EM  R YLGQQ+YFSVLSP RSLRDE+N+
Sbjct  507  EMQHRAYLGQQLYFSVLSPARSLRDEYNL  535



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   +   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG--DKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG SFFAV IEPG+WSPEKRKNYNL+DA+SR+TIQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  448  LDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSE  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+Y SV+S  RSLRDE+++
Sbjct  508  MRERAYLGQQLYLSVVSEARSLRDEYSL  535



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN---PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KLAEY+ +  KVFKYDI+ D+   P    E   TLAPNVVN T+RNFVEIIFENHEK++Q
Sbjct  386  KLAEYYSVADKVFKYDIIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSVQ  445

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            ++HL G+SFFAV IEPGKW+ EKRKNYNL+DA+SR+TIQVYPNSWAAIMTT+DNAG+WNL
Sbjct  446  SFHLAGYSFFAVAIEPGKWTAEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLWNL  505

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS    R YLGQQ+YFSVLSP+R L+DE+NM
Sbjct  506  RSNSLERQYLGQQLYFSVLSPKRDLKDEYNM  536



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   +   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG--DKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG SFFAV IEPG+WSPEKRKNYNL+DA+SR+TIQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  448  LDGFSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNSWAAVMTTLDNAGMWNLRSE  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+Y SV+S  RSLRDE+++
Sbjct  508  MRERAYLGQQLYLSVVSEARSLRDEYSL  535



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKYD + D       N  T+APNV+NATFRNFVEI+FEN EK++Q++H
Sbjct  385  KLAEYFEVADKVFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+WSPEKRKNYNL+DA+SRHTIQ +P SWAAI+ TLDNAGMWNLRSE
Sbjct  445  LDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTIQXFPKSWAAILLTLDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQMYFSV SP RSLRDE+N+
Sbjct  505  LTENRYLGQQMYFSVQSPARSLRDEYNI  532



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   N   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG--NKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG SFFAV IEPG+WS EKRKNYNL+DA+SR+TIQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  448  LDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSE  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+Y SV+S  RSLRDE+++
Sbjct  508  MRERAYLGQQLYLSVVSEARSLRDEYSL  535



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   +   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG--DKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG SFFAV IEPG+WSPEKRKNYNL+DA+SR+TIQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  448  LDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSE  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ Y SV+S  RSLRDE+++
Sbjct  508  MRERAYLGQQFYLSVVSEARSLRDEYSL  535



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF Y++M D P +   N   +APNVVN T+RNFVEIIFENHEKTIQT+H
Sbjct  389  KLAEYYGVADKVFTYNLMKDEPQEG--NKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG SFFAV IEPG+WS EKRKNYNL+DA+SR+TIQVYPNSWAA+MTTLDNAGMWNLRSE
Sbjct  447  LDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSE  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+Y SV+S  RSLRDE+++
Sbjct  507  MRERAYLGQQLYLSVVSEARSLRDEYSL  534



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  384  KLAEYFEMSEKVFKYNVIKDEPAAKVTT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYPNSW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  K+FKYD M D+ P    +  T+ PNV N T+R FVE+IFENHEK+IQ++H
Sbjct  383  KLAEYYGVADKIFKYDTMSDDAPATASDKITVEPNVANITYRTFVEVIFENHEKSIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG+W+PEKRK+YNL+DA+SRHT+QV+P SWAAIM T DNAGMWNLRSE
Sbjct  443  LDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQ++Y SVLSPERSLRDE+N+
Sbjct  503  LAERRYLGQELYISVLSPERSLRDEYNI  530



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKYD + D          T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  385  KLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLG Q+Y SVLSP RSLRDE+N+
Sbjct  505  LLENRYLGSQLYVSVLSPARSLRDEYNI  532



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKYD + D          T+APNVVNATFRNF+EIIFENHEK++Q++H
Sbjct  385  KLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLG Q+Y SVLSP RSLRDE+N+
Sbjct  505  LLENRYLGSQLYVSVLSPARSLRDEYNI  532



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN---PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KL EY+ +  K+FKYD+M D    P    E   TLAPNVV  T+RNFVEIIFENHEK++Q
Sbjct  385  KLVEYYGVEDKIFKYDLMKDEYEPPAGKAEEKITLAPNVVKVTYRNFVEIIFENHEKSVQ  444

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            ++HL G+SFFAV IEPGKW+PEKRKNYNL+DA+SR+TIQVYPNSWAAIMTTLDNAG+WNL
Sbjct  445  SFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNL  504

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS    R YLGQQ+YFS LSP+R L+DE+NM
Sbjct  505  RSNSVERQYLGQQLYFSALSPKRDLKDEYNM  535



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D P      P T APNV+N TFR FVEII ENHEK++Q++H
Sbjct  384  KLAEYYGVADKVFKYDTIPDEPLLEKATPVTPAPNVMNITFRTFVEIILENHEKSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF V IEPG+W+PEKRK+YNL+DA+SRHTIQV+P SWAAIM T DNAGMWNLRSE
Sbjct  444  LDGYSFFGVAIEPGRWTPEKRKSYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQ++Y SVLSPERSLRDE+NM
Sbjct  504  LAERRYLGQELYISVLSPERSLRDEYNM  531



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ +  KVFKYD + D+P  N+ N   +  PNV+N TFRNFVEIIFENHEK++Q+Y
Sbjct  384  KLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQSY  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRK+YNL+DA+SR T+QVYP SWAAI+ T DNAG+WN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVYPKSWAAILLTFDNAGLWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EMW R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  EMWERAYLGQQLYASVLSPARSLRDEYNL  532



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN---PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KLAEY+ +  KVFKYD+M D    P    E   TLAPNVV   +RN+VEIIFENHEK++Q
Sbjct  385  KLAEYYGVEDKVFKYDLMKDEYEPPAGKAEEKITLAPNVVKVIYRNYVEIIFENHEKSVQ  444

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            ++HL G+SFFAV IEPGKW+PEKRKNYNL+DA+SR+TIQVYPNSWAAIMTTLDNAG+WNL
Sbjct  445  SFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNL  504

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS    R YLGQQ+YFS LSP+R L+DE+NM
Sbjct  505  RSNSLERQYLGQQLYFSALSPKRDLKDEYNM  535



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  384  KLAEYFEMSEKVFKYNVIEDEPAAKVTT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPGKW+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGKWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD   DNPP  +    +  PNV+N TFRNFVEIIFEN EK+IQ++H
Sbjct  384  KLAEYFGVANKVFKYDTFQDNPPAKIGKIVS-QPNVLNMTFRNFVEIIFENPEKSIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF V +EPG W+PEKRKNYNL+DA+SR T+QV+P SWAAI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFVVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW RTYLGQQ+Y SVLSP RSLRDE+N+
Sbjct  503  MWERTYLGQQLYASVLSPARSLRDEYNI  530



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+GD PP +L    T+APNV+NATFR F+E+I EN  K+IQ+Y+
Sbjct  378  KLAEYYGVADKVFKYNIIGDEPPADL-TAITIAPNVINATFRTFIEVILENSGKSIQSYN  436

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPGKWSPEKRKNYNL+DAISRHTIQV+P SWAAIM T DNAGMWNLRSE
Sbjct  437  LDGYSFFAVACEPGKWSPEKRKNYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SVLSPE SLRDE+N+
Sbjct  497  QAENRYLGQQLYISVLSPELSLRDEYNL  524



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP  N+ N  T+ PNV+N T RNF+EIIFEN EKTIQ+YH
Sbjct  384  KLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF +GIEPG W+PEKRK+YNL+DA+SRHT+ V+P  WAAIM T DNAGMWNLRS+
Sbjct  444  LDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRSD  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSPE SLRDE+NM
Sbjct  504  IAESRYLGQQLYISVLSPEHSLRDEYNM  531



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVE+IFENHEK++Q+YH
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPAGKITG-LTVEPNVLNITFRTFVEVIFENHEKSMQSYH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+WSP KR+NYNL+DA+SRHT+QVYPNSW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVATEPGRWSPAKRENYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  502  NWERRYLGQQLYVSVLSPEKSLRDEYNI  529



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP  N+ N  T+ PNV+N T RNF+EIIFEN EKTIQ+YH
Sbjct  385  KLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSYH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF +GIEPG W+PEKRK+YNL+DA+SRHT+ V+P  WAAIM T DNAGMWNLRS+
Sbjct  445  LDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRSD  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSPE SLRDE+NM
Sbjct  505  IAESRYLGQQLYISVLSPEHSLRDEYNM  532



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKY+I+GD+PP +   P  +APNV+NATFRNF+EIIFEN E+++Q YH
Sbjct  394  KLAEYFGIADKVFKYNIIGDDPPASTA-PIKIAPNVMNATFRNFIEIIFENPERSMQAYH  452

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG+  GKW+P+ RK YNL+D +SRHTIQVY  SW+AIM T DNAGMWNLRSE
Sbjct  453  LDGYSFFPVGMGHGKWTPQSRKTYNLLDTVSRHTIQVYQRSWSAIMLTFDNAGMWNLRSE  512

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+NM
Sbjct  513  LWERRYLGQQLYISVLSPARSLRDEYNM  540



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ +  KVFKYD + D+P  N+ N   +  PNV+N TFRNFVEIIFENHEK++Q+Y
Sbjct  384  KLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQSY  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRK+YNL+DA+SR T+QV+P SWAAI+ T DNAG+WN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGLWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EMW R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  EMWERVYLGQQLYASVLSPARSLRDEYNL  532



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFEI  KVFKYD + D          T+APNVVN TFRNF+EIIFENHEK++Q++H
Sbjct  385  KLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV SP RSLRDE+N+
Sbjct  505  LTENRYLGQQLYMSVQSPARSLRDEYNI  532



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFEI  KVFKYD + D          T+APNVVN TFRNF+EIIFENHEK++Q++H
Sbjct  385  KLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+WSPEKR NYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  445  LDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV SP RSLRDE+N+
Sbjct  505  LTENRYLGQQLYMSVQSPARSLRDEYNI  532



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  K+FKYDI+ D+P  +  +  T+AP V+NATFRNFVEIIFEN EK++Q++H
Sbjct  365  KLAEYFGVGDKLFKYDIIKDDPSVDANSKITIAPIVLNATFRNFVEIIFENQEKSVQSWH  424

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV I+PGKW+P +R  YNLVDA+SRHTI VYP SWAAIMTTLDNAGMWNLRS 
Sbjct  425  LSGYSFFAVAIQPGKWTPARRAVYNLVDAVSRHTIHVYPKSWAAIMTTLDNAGMWNLRSM  484

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M  R YLGQQ+YFSVLSP +SLRDE+N+
Sbjct  485  MLERQYLGQQLYFSVLSPAKSLRDEYNI  512



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            K+AEY+ +  K+FKYD M D+P  N+ +   ++ PNV+N TFRNFVEIIFENHEK++Q+Y
Sbjct  384  KIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSY  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRK+YNL+DA+SR T+QV+P SWAAI+ T DNAGMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EMW R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  EMWERAYLGQQLYASVLSPARSLRDEYNI  532



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            K+AEY+ +  K+FKYD M D+P  N+ +   ++ PNV+N TFRNFVEIIFENHEK++Q+Y
Sbjct  368  KIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSY  427

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRK+YNL+DA+SR T+QV+P SWAAI+ T DNAGMWN+RS
Sbjct  428  HLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRS  487

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EMW R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  488  EMWERAYLGQQLYASVLSPARSLRDEYNI  516



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN--PPDNLE--NPATLAPNVVNATFRNFVEIIFENHEKTI  277
            KLAEY+ +  KVFKYD++ D+  P    E  +  TLAPNVVNAT+RNFVEIIFENH K++
Sbjct  384  KLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSV  443

Query  276  QTYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWN  97
            Q++HL GHSFFAVGIEPG+W+PEKR+NYNL+DA+SR+TIQVYPNSWAAIMTTLDNAG+WN
Sbjct  444  QSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWN  503

Query  96   LRSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            LRS    R YLG Q+YFSVLSP  S++DE+NM
Sbjct  504  LRSNSLERNYLGHQLYFSVLSPNHSVKDEYNM  535



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN--PPDNLE--NPATLAPNVVNATFRNFVEIIFENHEKTI  277
            KLAEY+ +  KVFKYD++ D+  P    E  +  TLAPNVVNAT+RNFVEIIFENH K++
Sbjct  384  KLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSV  443

Query  276  QTYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWN  97
            Q++HL G+SFFAVGIEPG+W+PEKR+NYNL+DA+SR+TIQVYPNSWAA+MTTLDNAG+WN
Sbjct  444  QSWHLSGYSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGLWN  503

Query  96   LRSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            LRS    R YLG Q+YFSVLSP RS++DE+NM
Sbjct  504  LRSNSLERNYLGHQLYFSVLSPNRSIKDEYNM  535



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLE---NPATLAPNVVNATFRNFVEIIFENHEKTIQ  274
            KLAEYF +  KVFKY+I+ D P  +     +  TLAPNVVNATFRNF+EII ENHEKT+Q
Sbjct  386  KLAEYFGVADKVFKYNIIQDEPSADATAKNHAITLAPNVVNATFRNFIEIILENHEKTVQ  445

Query  273  TYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNL  94
            ++HLDG+SFFAV IEPG W+PE+RK YNL+DAISR+TIQVYP SWAAIM T+DNAGMWNL
Sbjct  446  SWHLDGYSFFAVAIEPGTWTPERRKVYNLLDAISRNTIQVYPKSWAAIMLTMDNAGMWNL  505

Query  93   RSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            RS +  R YLGQQ+YFSVLSP  SLRDE+N+
Sbjct  506  RSTLLERQYLGQQLYFSVLSPNYSLRDEYNV  536



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPAAKI-TALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  502  NWERRYLGQQLYASVLSPEKSLRDEYNI  529



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P        T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  384  KLAEYFEMSEKVFKYNVIKDEPAAKATT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPD-NLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ +  KVFKYD++ D P D +L     +APNV+N TFRNFVEII ENH+K++QT+
Sbjct  397  KLAEYYGVADKVFKYDMIKDQPSDSDLAAEVIVAPNVINGTFRNFVEIILENHDKSVQTF  456

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            H+ G+SFFAV +EPG+W+ EKRKNYNL+DAIS+HT+QVYPNSW AIMTTLDNAGMWN+RS
Sbjct  457  HVSGYSFFAVAVEPGRWTEEKRKNYNLIDAISKHTVQVYPNSWTAIMTTLDNAGMWNMRS  516

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
                R YLG+Q+Y SVLSP RSLRDE+N+
Sbjct  517  MSLERQYLGEQIYVSVLSPNRSLRDEYNL  545



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+ + D+PP  + +  T+ PNV N TFR FVEII ENHE +IQ++H
Sbjct  383  KLAEYYNVVDKVFKYNAIQDDPPATVGDKVTVEPNVANITFRTFVEIILENHENSIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+P+KRKNYNL+DA+SRHT+ V+P SWAAIM T DNAG+WNLRSE
Sbjct  443  LDGYSFFAVAIEPGRWTPDKRKNYNLLDAVSRHTVPVFPKSWAAIMLTFDNAGIWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  R YLGQQMY SVLSPERSLRDE+N+
Sbjct  503  LLERRYLGQQMYLSVLSPERSLRDEYNI  530



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+++ D+P D      T+APNV+NATFR+F+E+IFEN  K IQ+Y+
Sbjct  349  KLAEYYGVADKVFKYNLISDSP-DTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYN  407

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFA+ +EPGKW+PEKRKNYNL+DAISRHTIQV+PNSWAAIM T DNAGMWNLRSE
Sbjct  408  LDGYSFFALAVEPGKWTPEKRKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSE  467

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  468  MAENRYLGQQLYVSVLSPNRSLRDEYNL  495



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  K+FKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++ ++H
Sbjct  384  KLAEYFGMAEKIFKYNVIKDEPAAKITT-LTVEPNVLNVTFRTFVEIIFENHEKSMASFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDGHSFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGHSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + D          T+APNVVN TFRNF+EIIFENHEK++Q++H
Sbjct  278  KLAEYFGVTDKVFKYDTISDEGLAEGATTVTVAPNVVNTTFRNFIEIIFENHEKSLQSWH  337

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG+W+PEKR +YNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  338  LDGYSFFAVAIEPGRWTPEKRSDYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  397

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV SP RSLRDE+N+
Sbjct  398  LAENRYLGQQLYMSVQSPARSLRDEYNI  425



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            K+AEY+ +  K+FKYD M D+P  ++ +   ++ PNV+N TFRNFVEIIFENHEK++Q+Y
Sbjct  384  KIAEYYGVADKLFKYDTMQDSPQADIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSY  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRK+YNL+DA+SR T+QV+P SWAAI+ T DNAGMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EMW R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  504  EMWERAYLGQQLYASVLSPARSLRDEYNI  532



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD + D+PP  +    T  PNV+N TFRNFVEIIFEN EK+IQ++H
Sbjct  384  KLAEYYGIADKVFKYDTIKDDPPPKITEVVT-QPNVLNMTFRNFVEIIFENPEKSIQSWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SR T+QV+P SWAAI  T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAIFLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W RTYLGQQ+Y SV+SP RSLRDE+N+
Sbjct  503  VWERTYLGQQLYASVISPARSLRDEYNI  530



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+ M D+PP        + PNV+N TFR FVEIIFENHEK+IQ++H
Sbjct  382  KLAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSWH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG+W+P+KRKNYNL+DA+SR+TIQVYP SW AI+ T DNAG+WNLRSE
Sbjct  442  LNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  502  TWERNYLGQQLYVSVLSPARSLRDEYNI  529



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLE--NPATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KL EY+++  K FKYD++ D PP N+E  +  T  PNV+N TFRNF+EIIFENHEK+IQ+
Sbjct  388  KLLEYYQVAQKAFKYDVIKDEPPANVETLDKFTTGPNVLNGTFRNFIEIIFENHEKSIQS  447

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            +HLDG+SFF V IE G+W+PEKRKNYNL+DA+SR+TIQVYP SWAAIM T DNAGMW+LR
Sbjct  448  WHLDGYSFFPVAIEVGQWTPEKRKNYNLLDAVSRYTIQVYPKSWAAIMLTTDNAGMWHLR  507

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +E   R++LGQQMY SVLSPERSLRDE+N+
Sbjct  508  NEAPERSFLGQQMYISVLSPERSLRDEYNL  537



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +    T+ PNV+N TFR FVE+IFENHEK++Q++H
Sbjct  384  KLAEYFGMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEVIFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K+AEY+ I  KVFKY+ + D P   +    T  PNV+N TFRNFVEIIFENHEK++Q+YH
Sbjct  384  KIAEYYGIADKVFKYNTIKDMPSAKIGKVVT-QPNVLNQTFRNFVEIIFENHEKSMQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG W+PEKRKNYNL+DA+SR TIQV+P SWAAI  T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAIFLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW +TYLGQQ+Y SVLSPE SLRDE+N+
Sbjct  503  MWEKTYLGQQLYVSVLSPELSLRDEYNI  530



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  384  KLAEYFGMAEKVFKYNVIKDEPAAKI-TALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDGHSFFAV  EPG+W+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGEQLYVSVLSPEKSLRDEYNI  530



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+ M D+PP        + PNV+N TFR FVEIIFENHEK+IQ++H
Sbjct  394  KLAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSWH  453

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG+W+P+KRKNYNL+DA+SR+TIQVYP SW AI+ T DNAG+WNLRSE
Sbjct  454  LNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRSE  513

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  514  TWERNYLGQQLYVSVLSPARSLRDEYNI  541



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  384  KLAEYFGMAEKVFKYNVIKDEPAAKI-TALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDGHSFFAV  EPG+W+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNVRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGEQLYISVLSPEKSLRDEYNI  530



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D PP +     TLAP V+N T RNFVEIIFENHE  IQ+YH
Sbjct  308  KLAEYYGVADKVFKYDTIPDEPPSD-NTKVTLAPIVLNMTHRNFVEIIFENHETAIQSYH  366

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAVG++ GKWSPEKR NYNL+DA+SRHTIQV+PNSW+AI+ T DN GMWNLRSE
Sbjct  367  LSGYSFFAVGMDIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSE  426

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSL+DE+N+
Sbjct  427  IWDRHYLGQQLYASVISPNRSLKDEYNL  454



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+++ D+P D      T+APNV+NATFR+F+E+IFEN  K IQ+Y+
Sbjct  390  KLAEYYGVADKVFKYNLISDSP-DTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYN  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFA+ +EPGKW+PEKRKNYNL+DAISRHTIQV+PNSWAAIM T DNAGMWNLRSE
Sbjct  449  LDGYSFFALAVEPGKWTPEKRKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSE  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  509  MAENRYLGQQLYVSVLSPNRSLRDEYNL  536



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K+AEY+ I  KVFKY+ + D P   +    T  PNV+N TFRNFVEIIFENHEK++Q+YH
Sbjct  384  KIAEYYGIADKVFKYNTIKDMPSAKIGKVVT-QPNVLNQTFRNFVEIIFENHEKSMQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG W+PEKRKNYNL+DA+SR TIQV+P SWAAI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW + YLGQQ+Y SVLSPE SLRDE+N+
Sbjct  503  MWEKAYLGQQLYVSVLSPELSLRDEYNI  530



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD + D+PP+    P T+APNV+NAT+R+++EII EN E++IQ YH
Sbjct  379  KLAEYYGIADKVFKYDSISDDPPET-NAPITVAPNVLNATYRDYIEIILENPERSIQCYH  437

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+  GKW+P  R+ YNL+DA+SRHTIQVYP SW+AIM T DNAGMW+LRSE
Sbjct  438  LDGYSFFAVGMGHGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  497

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+Y SV+SP RSLRDE+NM
Sbjct  498  MWERHYLGQQLYVSVVSPARSLRDEYNM  525



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYDI+ DNP P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGITDKVFKYDIITDNPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  ENSERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYDI+ D+PP  + +  TLAPNV+NATFR F+EII EN  KTIQ+Y+
Sbjct  378  KLAEYYGVADKVFKYDIISDDPPTVITD-ITLAPNVINATFRTFIEIILENPTKTIQSYN  436

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKW+PEKRKNYNL+D +SRHTIQV+P SWAAIM T DNAGMWNLRSE
Sbjct  437  LDGYSFFAVAVEPGKWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SVLSPE S RDE+N+
Sbjct  497  NTENKYLGQQLYISVLSPEFSNRDEYNL  524



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYDI+ DNP P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGITDKVFKYDIITDNPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  ENSERRYLGQQLYASVLSPEKSLRDEYNM  532



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKYD++ D P   +    T+ PNV+N TFR FVEIIFENHEK+++++H
Sbjct  383  KLAEYFQMAEKVFKYDVIKDEPAAQI-TALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  502  NLERRYLGQQLYVSVLSPEKSLRDEYNI  529



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKYD++ D P   +    T+ PNV+N TFR FVEIIFENHEK+++++H
Sbjct  383  KLAEYFQMAEKVFKYDVIKDEPAAQI-TALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  502  NLERRYLGQQLYVSVLSPEKSLRDEYNI  529



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKYD++ D P   +    T+ PNV+N TFR FVEIIFENHEK+++++H
Sbjct  383  KLAEYFQMAEKVFKYDVIKDEPAAQI-TALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  502  NLERRYLGQQLYVSVLSPEKSLRDEYNI  529



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYDI+ DNP P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGITDKVFKYDIITDNPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y S+LSPE+SLRDE+NM
Sbjct  504  ENSERRYLGQQLYASILSPEKSLRDEYNM  532



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  385  KLAEYFEMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  444  LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  504  NWERRYLGQQMYVSVLSPEKSLRDEYNI  531



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  385  KLAEYFEMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  444  LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  504  NWERRYLGQQMYVSVLSPEKSLRDEYNI  531



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  385  KLAEYFEMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  444  LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  504  NWERRYLGQQMYVSVLSPEKSLRDEYNI  531



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   ++   T+ PNV+N TFR FVE+IFEN EK++Q+YH
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPGAMIKQ-LTVEPNVLNITFRTFVEVIFENREKSMQSYH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+P KR+NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVATEPGRWTPAKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  502  NWERRYLGQQMYVSVLSPEKSLRDEYNI  529



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHE+++Q++H
Sbjct  342  KLAEYFEMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHERSMQSFH  400

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  401  LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  460

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  461  NWERRYLGQQMYVSVLSPEKSLRDEYNI  488



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF    KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  384  KLVEYFGFADKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDGHSFFAV  EPG+W+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGHSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+QMY SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGEQMYVSVLSPEKSLRDEYNI  530



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF +  KVFKYD + DNP PD ++N   + PNV+N T R F+E++FENHE+++Q++
Sbjct  386  KLAEYFGVADKVFKYDTISDNPNPDQIKN-IKIEPNVLNITHRTFIEVVFENHERSVQSW  444

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  445  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  ENAERRYLGQQLYASVLSPEKSLRDEYNM  533



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYDI+ DNP  +      + PNV+N T R F+E++FENHEK++Q++H
Sbjct  319  KLAEYFGVADKVFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  378

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  379  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  438

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLR E+NM
Sbjct  439  NSERRYLGQQLYASVLSPEKSLRGEYNM  466



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYDI+ DNP         + PNV+N T R F+E+IFENHEK++Q++H
Sbjct  386  KLAEYFGVADKVFKYDIISDNPTPEQIKKIKMEPNVLNITHRTFIEVIFENHEKSVQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  446  LDGYSFFAVAVEPGVWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  506  NSERRYLGQQLYASVLSPEKSLRDEYNM  533



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD +GD PP++     T+APNV+NATFR+++EII EN E++IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTIGDEPPESSAT-ITVAPNVLNATFRDYIEIILENPERSIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+  GKW+P  R++YNL+DA+SRHTIQVYP SW+AIM T DNAGMW+LRSE
Sbjct  443  LDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSLRDE+N+
Sbjct  503  LWERHYLGQQLYISVVSPARSLRDEYNI  530



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYFE+  KVFKY+++ D P   +    T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  383  KLAEYFEMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIVFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  502  NWERRYLGQQMYVSVLSPEKSLRDEYNI  529



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF +  KVFKYD + DNP PD ++N   + PNV+N T R F+E++FENHE+++Q++
Sbjct  386  KLAEYFGVADKVFKYDTISDNPNPDQIKN-IKIEPNVLNITHRTFIEVVFENHERSVQSW  444

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  445  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  ENSERRYLGQQLYASVLSPEKSLRDEYNM  533



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +    T+ PNV+N TFR FVE++FENHEK++Q++H
Sbjct  384  KLAEYFGMSEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEVVFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQLYVSVLSPEKSLRDEYNI  530



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  384  KLAEYFGMAEKVFKYNVIKDEPAAKI-TALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGEQLYVSVLSPEKSLRDEYNI  530



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD +GD PP++     T+APNV+NATFR+++EII EN E++IQ+YH
Sbjct  390  KLAEYYGVADKVFKYDTIGDEPPESSAT-ITVAPNVLNATFRDYIEIILENPERSIQSYH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+  GKW+P  R++YNL+DA+SRHTIQVYP SW+AIM T DNAGMW+LRSE
Sbjct  449  LDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSLRDE+N+
Sbjct  509  LWERHYLGQQLYISVVSPARSLRDEYNI  536



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP  +      + PNV+N T RNF+E++FENHE+++Q++H
Sbjct  386  KLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEVVFENHERSVQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  WAAI+ T DN GMWN+RSE
Sbjct  446  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  506  NSERRYLGQQLYASVLSPEKSLRDEYNM  533



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP         + PNV+N T RNF+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYDTITDNPTPEQTKNIKIEPNVLNITHRNFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NTERRYLGQQLYASVLSPEKSLRDEYNM  532



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEKT+Q++H
Sbjct  392  KLAEYFQMSEKVFKYNVIKDEPAAKI-TALTVQPNVLNITFRTFVEIIFENHEKTMQSFH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKR+NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  451  LDGYSFFAVASEPGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  511  NLERKYLGEQLYVSVLSPEKSLRDEYNI  538



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMSEKVFKYNVIKDEPASKITT-LTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  502  NSERKYLGEQLYVSVLSPEKSLRDEYNI  529



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP  +      + PNV+N T RNF+EI+FENHE+++Q++H
Sbjct  384  KLAEYFGVVDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEIVFENHERSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  444  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  NSERRYLGQQLYASVLSPEKSLRDEYNM  531



>gb|KJB83388.1| hypothetical protein B456_013G245000 [Gossypium raimondii]
 gb|KJB83389.1| hypothetical protein B456_013G245000 [Gossypium raimondii]
Length=551

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D PP +     TLAP V+N T RNFVEIIFENHE  IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTIPDEPPSD-NTRVTLAPIVLNMTHRNFVEIIFENHETAIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAVG++ GKWSPEKR NYNL+DA+SRHTIQV+PNSW+AI+ T DN GMWNLRSE
Sbjct  443  LSGYSFFAVGMDIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSL+DE+N+
Sbjct  503  IWDRHYLGQQLYASVISPNRSLKDEYNL  530



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+ + D PP +L +  T APNV+NATFR+F+EIIFEN  KT+Q+Y+
Sbjct  382  KLAEYYGVADKVFKYNTISDEPPVDLSS-ITKAPNVINATFRDFIEIIFENDGKTVQSYN  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKWSP KRKNYNL+DA+SRHT+QV+P SW+AIM T DNAGMWNLRSE
Sbjct  441  LDGYSFFAVAMEPGKWSPVKRKNYNLLDAVSRHTVQVFPKSWSAIMLTFDNAGMWNLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SVLSP+RSLRDE+N+
Sbjct  501  HAENRYLGQQLYISVLSPQRSLRDEYNL  528



>gb|KJB83386.1| hypothetical protein B456_013G244800 [Gossypium raimondii]
Length=551

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D PP +     TLAP V+N T RNFVEIIFENHE  IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTIPDVPPSD-NTKVTLAPIVLNMTHRNFVEIIFENHETAIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAVG++ GKWSPEKR NYNL+DA+SRHTIQV+PNSW+AI+ T DN GMWNLRSE
Sbjct  443  LSGYSFFAVGMDIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSL+DE+N+
Sbjct  503  IWDRHYLGQQLYASVISPNRSLKDEYNL  530



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMADKVFKYNVIKDEPAAKI-TALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPGKW+PE RKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+R+E
Sbjct  442  LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SV SPE+SLRDE+N+
Sbjct  502  NWERRYLGEQLYVSVQSPEKSLRDEYNI  529



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPGKW+PE RKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+R+E
Sbjct  442  LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SV SPE+SLRDE+N+
Sbjct  502  NWERRYLGEQLYVSVQSPEKSLRDEYNI  529



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMSEKVFKYNVIKDEPAAKI-TALTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKRKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  502  NLERRYLGEQLYVSVLSPEKSLRDEYNI  529



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYDI+ D+P P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGITDKVFKYDIITDDPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y S+LSPE+SLRDE+NM
Sbjct  504  ENSERRYLGQQLYASILSPEKSLRDEYNM  532



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYDI+ D+P P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGITDKVFKYDIITDDPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y S+LSPE+SLRDE+NM
Sbjct  504  ENSERRYLGQQLYASILSPEKSLRDEYNM  532



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPAAKITT-LTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPGKW+PE RKNYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+R+E
Sbjct  442  LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SV SPE+SLRDE+N+
Sbjct  502  NWERRYLGEQLYVSVQSPEKSLRDEYNI  529



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEKT+Q++H
Sbjct  383  KLAEYFQMSEKVFKYNVIKDEPAAKI-TALTVQPNVLNITFRTFVEIIFENHEKTMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  EPG+W+PEKR+NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+RSE
Sbjct  442  LDGYSFFAVASEPGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  502  NLERKYLGEQLYVSVLSPEKSLRDEYNI  529



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I GK FKY++  D PP     PA LA NV+   FR FVEIIFEN EK +Q+YH
Sbjct  382  KLAEYFGIGGKSFKYNLTSDEPPSG-GAPAILATNVITIEFRTFVEIIFENPEKNVQSYH  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFF VG+ PGKW+PE RK YNL+DA+SRH +QVYP SWAAIM T DNAGMWNLRSE
Sbjct  441  LNGYSFFLVGMGPGKWTPESRKTYNLLDAVSRHAVQVYPKSWAAIMLTFDNAGMWNLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV SP RSLRDE+N+
Sbjct  501  LWERRYLGQQLYISVQSPARSLRDEYNL  528



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP         + PNV+N T R FVE++FENHEK++Q++H
Sbjct  385  KLAEYFGIGDKVFKYDSITDNPTPEQIKSIKILPNVLNITHRTFVEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQMY SVLSPE+SLRDE+NM
Sbjct  505  NSERRYLGQQMYASVLSPEKSLRDEYNM  532



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF++  KVFKY+++ D P   +    T+ PNV+N TFR FVEIIFENHEK++Q++H
Sbjct  383  KLAEYFQMAEKVFKYNVIKDEPEAKI-TALTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV  E GKW+PEKR NYNL+DA+SRHT+QVYP SW+AI+ T DNAGMWN+R+E
Sbjct  442  LDGYSFFAVASEAGKWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLG+Q+Y SVLSPE+SLRDE+N+
Sbjct  502  NWERRYLGEQLYVSVLSPEKSLRDEYNI  529



>gb|KJB83384.1| hypothetical protein B456_013G2447001, partial [Gossypium raimondii]
Length=157

 Score =   205 bits (521),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = -2

Query  411  VFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGI  232
            VFKYD + D PP +     TLAP V+N T RNFVEIIFENHE  IQ+YHL G+SFFAVG+
Sbjct  1    VFKYDTIPDEPPSD-NTKVTLAPIVLNMTHRNFVEIIFENHETAIQSYHLSGYSFFAVGM  59

Query  231  EPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSEMWARTYLGQQM  52
            + GKWSPEKR NYNL+DA+SRHTIQV+PNSW+AI+ T DN GMWNLRSE+W R YLGQQ+
Sbjct  60   DIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSEIWDRHYLGQQL  119

Query  51   YFSVLSPERSLRDEHNM  1
            Y SV+SP RSL+DE+N+
Sbjct  120  YASVISPNRSLKDEYNL  136



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  K FKYDI+ D+PP  +    T+ P VVN T+R FVEIIFEN E  IQ++H
Sbjct  384  KLAEYYNVADKSFKYDILRDDPPAKISEEITVQPIVVNLTYRTFVEIIFENRETAIQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV +E G W+PEKRKNYNL+DA+SRHTIQV+PNSWAAI+ T DN GMWN+RSE
Sbjct  444  LSGYSFFAVAVETGTWTPEKRKNYNLLDAVSRHTIQVFPNSWAAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSPE SLRDE+N+
Sbjct  504  IWDRHYLGQQLYASVLSPEHSLRDEYNI  531



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD + D PP     P T  PNV+NAT+R ++EII EN E++IQ YH
Sbjct  386  KLAEYYGIADKVFKYDSINDEPP-AASAPITATPNVLNATYRTYIEIILENPERSIQCYH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG+  GKW+PE RK YNL+DA+SRHTIQVYP SW+AIM T DNAGMWNLRSE
Sbjct  445  LDGYSFFPVGMGHGKWTPESRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLGQQ+Y SV SPERSLRDE+N+
Sbjct  505  MWERHYLGQQIYISVTSPERSLRDEYNI  532



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NTERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NTERRYLGQQLYASVLSPEKSLRDEYNM  532



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYD + D+P P+ ++N   + PNV+N T RNF+E++FENHEK++Q++
Sbjct  385  KLAEYFGISDKVFKYDTITDDPTPEQIKN-IKIEPNVLNITHRNFIEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFF+V +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  ENTERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVF+YD+  DNPP  + N    A NV+N TFR FVEIIFEN  K IQ+Y+
Sbjct  378  KLAEYYGVANKVFQYDLTSDNPPAVIGNLRVEA-NVLNVTFRTFVEIIFENPTKVIQSYN  436

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKW+PEKRKNYNL+DA+SRHT+QV+P SWAAIM T DNAGMWNLRSE
Sbjct  437  LDGYSFFAVAVEPGKWTPEKRKNYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            M    YLGQQMY SVLSPE+S RDE+N+
Sbjct  497  MAENRYLGQQMYMSVLSPEKSNRDEYNL  524



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYDI+ D PP +      LAPNVVN TFR FVEIIFEN E+++Q YH
Sbjct  384  KLAEYYGIADKVFKYDIISDEPPADGAQ-IKLAPNVVNTTFRTFVEIIFENPERSMQAYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG+  GKW+P  RK YNL+DA+SRHTIQVY  SW+A+M T DNAGMWNLRSE
Sbjct  443  LDGYSFFPVGMGHGKWTPASRKTYNLLDAVSRHTIQVYQRSWSAVMLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+YF+V SP RSLRDE+NM
Sbjct  503  LWERRYLGQQLYFTVQSPARSLRDEYNM  530



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYDSITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NTERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD +GD PP +  +  T+APNV+NAT+R+++EII EN E++IQ YH
Sbjct  385  KLAEYYGISDKVFKYDSIGDEPPASGAS-ITVAPNVLNATYRDYIEIILENPERSIQCYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFA G+  GKW+P  R+ YNL+DA+SRHTIQVYP SW+AIM T DNAGMW+LRSE
Sbjct  444  LDGYSFFAAGMGHGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSLRDE+NM
Sbjct  504  LWERHYLGQQLYISVVSPARSLRDEYNM  531



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF +  KVFKYD + DNP PD ++    + PNV+N T R F+E++FENHEK++Q++
Sbjct  386  KLAEYFGVTDKVFKYDSISDNPNPDQIKT-IKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QV+P  WAAI+ T DN GMWN+RS
Sbjct  445  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRS  504

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  ENSERRYLGQQLYASVLSPEKSLRDEYNM  533



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  385  KLAEYFGVADKVFKYDSITDNPTPEQIKSIKIVPNVLNITHRTFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NSERRYLGQQLYASVLSPEKSLRDEYNM  532



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D+PP  +    T+ P V+N T RNF+EIIFEN E  IQ+YH
Sbjct  368  KLAEYYNVADKVFKYDNIPDDPPAEITK-VTMEPIVLNMTHRNFIEIIFENRETAIQSYH  426

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IE GKWSPEKRKNYNL+DA+SRHTIQV+P SWAAI+ T DN GMWN+RSE
Sbjct  427  LDGYSFFAVAIETGKWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNCGMWNIRSE  486

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP +SL+DE+NM
Sbjct  487  VWDRHYLGQQLYASVVSPNKSLKDEYNM  514



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 3/149 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ +  KVFKYD + D P  DN +   TLAP V+N T RNFVEIIFENHE  IQ+Y
Sbjct  384  KLAEYYGVADKVFKYDTIPDEPQSDNTK--VTLAPIVLNMTHRNFVEIIFENHESAIQSY  441

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HL G+SFFAVG++ GKWSPEKR NYNL+DA+SRHTIQV+PNSW+AI+ T DN GMWNLRS
Sbjct  442  HLSGYSFFAVGMDVGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRS  501

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E+W R YLGQQ+Y SV+SP RSL+DE+N+
Sbjct  502  EIWDRHYLGQQLYASVISPNRSLKDEYNL  530



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+I+ DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  386  KLAEYFGVADKVFKYNIITDNPNPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  446  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  506  NSERRYLGQQLYASVLSPEKSLRDEYNM  533



>gb|KDP30646.1| hypothetical protein JCGZ_16211 [Jatropha curcas]
Length=450

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  414  KVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVG  235
            KVFKYD + D+PP  +    T  PNVVN T RNFVEIIFENHEK+I+++HLDG+SFFAV 
Sbjct  293  KVFKYDTIQDDPPAKIRKVIT-QPNVVNMTHRNFVEIIFENHEKSIESWHLDGYSFFAVA  351

Query  234  IEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSEMWARTYLGQQ  55
            +E G WSPEKRKNYNL+DA+SR T+QV+P SWAAI+ T DN GMWNLRSEMW RTYLGQQ
Sbjct  352  VEAGTWSPEKRKNYNLLDAVSRTTVQVFPKSWAAILLTFDNCGMWNLRSEMWERTYLGQQ  411

Query  54   MYFSVLSPERSLRDEHNM  1
            +Y SVLSP RSLRDE+N+
Sbjct  412  LYASVLSPARSLRDEYNV  429



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP         + PNV+N T R F+E++FENHEK++Q++H
Sbjct  385  KLAEYFGVADKVFKYDSITDNPTPEQIKSIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  445  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  505  NSERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF +  KVFKYD + DNP PD ++    + PNV+N T R F+E++FENHEK++Q++
Sbjct  386  KLAEYFGVTDKVFKYDSISDNPNPDQIKT-IKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QV+P  WAAI+ T DN GMWN+RS
Sbjct  445  HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRS  504

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+N+
Sbjct  505  ENSERRYLGQQLYVSVLSPEKSLRDEYNL  533



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYD + D+P P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGISDKVFKYDTITDDPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFF+V +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  ENTERRYLGQQLYASVLSPEKSLRDEYNM  532



>gb|KJB15368.1| hypothetical protein B456_002G173600 [Gossypium raimondii]
Length=551

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+++  KVFKYD + D+PP  +    T+ P V+N T RNFVEIIFEN E  IQ+YH
Sbjct  384  KLAEYYKVADKVFKYDNIPDDPPSEITK-VTMEPIVLNMTHRNFVEIIFENRETAIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IE G WSPEKRKNYNL+DA+SRHTIQV+P SWAAI+ T DN GMWN+RSE
Sbjct  443  LDGYSFFAVAIETGNWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNCGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP +SL+DE+NM
Sbjct  503  VWDRRYLGQQLYASVVSPNKSLKDEYNM  530



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYD + D+P P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  385  KLAEYFGISDKVFKYDTITDDPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  443

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFF+V +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  444  HLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRS  503

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  ENTERRYLGQQLYASVLSPEKSLRDEYNM  532



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP  +      + PNV+N T R F+E++FENHEK++Q++H
Sbjct  386  KLAEYFGVTDKVFKYDSISDNPNADQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QV+P  WAAI+ T DN GMWN+RSE
Sbjct  446  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  506  NSERRYLGQQLYASVLSPEKSLRDEYNM  533



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+++ D P   +     + PNV+N TFR FVEI+FENHEK++Q+++
Sbjct  384  KLAEYFGLAEKVFKYNVIKDEPAAKITT-LVVEPNVLNITFRTFVEIVFENHEKSMQSFN  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF V  EPG+W+PEKRKNYNL+DA+SRHT+QV+P SW+AI+ T DNAGMWN+RSE
Sbjct  443  LDGYSFFNVASEPGRWTPEKRKNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W R YLGQQMY SVLSPE+SLRDE+N+
Sbjct  503  NWERRYLGQQMYVSVLSPEKSLRDEYNI  530



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGD----NPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTI  277
            KLAEY+    KVFKYD++ D    +P    ++  T+APNVVNAT+RNFVEI+ ENH K++
Sbjct  385  KLAEYYGAGDKVFKYDLIKDEYEPSPGQAGQDKITVAPNVVNATYRNFVEIVIENHGKSV  444

Query  276  QTYHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWN  97
            Q++HL GHSFFAVGIEPG+W+PEKR+NYNL+DA+SR+TIQVYP S+A IMTTLDNAG+WN
Sbjct  445  QSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLWN  504

Query  96   LRSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            LRS    R YLG Q+YFSVLSP +S++DE+NM
Sbjct  505  LRSNSLERNYLGHQLYFSVLSPNKSIKDEYNM  536



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNP-PDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEYF I  KVFKYD + D+P P+ ++N   + PNV+N T R FVE++FENHEK++Q++
Sbjct  383  KLAEYFGISDKVFKYDTITDDPTPEQIKN-IKIEPNVLNITHRTFVEVVFENHEKSVQSW  441

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HLDG+SFF+V +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RS
Sbjct  442  HLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRS  501

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E   R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  502  ENTERRYLGQQLYASVLSPEKSLRDEYNM  530



>gb|KHN42951.1| L-ascorbate oxidase like [Glycine soja]
Length=421

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +P KVFKYDI+ DNP  ++     L PNV+    R F+EIIFEN EK++Q+YH
Sbjct  254  KLAEYFGVPEKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFIEIIFENPEKSVQSYH  313

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFAV IEPG W+PEKRKNYNL+DA+SRHT+ V+P SWAAI+ + DN G+WNLRSE
Sbjct  314  LNGYAFFAVAIEPGTWTPEKRKNYNLLDAVSRHTMPVFPKSWAAILLSFDNVGVWNLRSE  373

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVL+PERSLRDE+N+
Sbjct  374  LAENRYLGQQLYISVLTPERSLRDEYNI  401



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  +VFKY+I+ D+P   + + A  APNV+NATFR+F+EIIFEN  K  Q+Y+
Sbjct  380  KLAEYYGVSDQVFKYNIISDDPASPIGDLAC-APNVINATFRDFIEIIFENPTKVPQSYN  438

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+EPGKWSPEKRKNYN +D +SRHTIQV+P SW+AIM T DNAGMWNLRSE
Sbjct  439  LDGYSFFAVGMEPGKWSPEKRKNYNNLDGVSRHTIQVFPKSWSAIMLTFDNAGMWNLRSE  498

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVLSP RSLRDE+NM
Sbjct  499  LGENRYLGQQLYVSVLSPNRSLRDEYNM  526



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+YDI+GD PP     P  +APNV+ A FR F+E++FEN EK+I T H
Sbjct  253  KLAEYFNTTDGVFQYDIIGDVPPSK-SAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIH  311

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+P  R  YNL+D +SRHTIQVYP SW A+M T DNAGMW++RS 
Sbjct  312  IDGYAFFAVGMGPGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSN  371

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SPERSLRDE+NM
Sbjct  372  IWERQYLGEQLYVSVISPERSLRDEYNM  399



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN-PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+    KVFKY+++ D   P+  ++  T+APNVVNAT+RN+VEI+ ENH KT+Q++
Sbjct  385  KLAEYYGAGDKVFKYNLIKDEYEPNPGQDKITVAPNVVNATYRNYVEIVIENHGKTVQSW  444

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            HL GHSFFAVGIEPG+W+PE+RKNYNL+DA+SR+TIQVYP S+A IMTTLDNAG+WNLRS
Sbjct  445  HLSGHSFFAVGIEPGRWAPERRKNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLWNLRS  504

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
                R YLG Q+YFSVLSP +S++DE+NM
Sbjct  505  NSLERNYLGHQLYFSVLSPNKSIKDEYNM  533



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD + D PP       T APNV+NATFR+++EII EN E++IQ++H
Sbjct  384  KLAEYYGIADKVFKYDSISDEPP-AASATITAAPNVLNATFRDYIEIILENPERSIQSFH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+  GKW+P  RK YNL+DA+SRHTIQVYP SW+AIM T DNAGMW+LRSE
Sbjct  443  LDGYSFFAVGMGHGKWTPASRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP RSLRDE+++
Sbjct  503  LWERHYLGQQLYISVLSPARSLRDEYSI  530



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKYD + D P  + + P  + PNVVNAT+R F+EI+FEN ++++Q YH
Sbjct  473  KLAEYYGIADKVFKYDTIADEPAAS-DAPIKIVPNVVNATYRTFIEIVFENPDRSMQAYH  531

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFA G+  GKW+PE RK YNL DA+SRHTIQVY  SW+AI+ T DNAGMWNLRSE
Sbjct  532  LDGYSFFAAGMGHGKWTPESRKRYNLADAVSRHTIQVYQRSWSAILLTFDNAGMWNLRSE  591

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SPERSLRDE NM
Sbjct  592  LWERRYLGQQLYISVVSPERSLRDESNM  619



>gb|KJB83387.1| hypothetical protein B456_013G244900 [Gossypium raimondii]
Length=551

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D+PP  +    T+ P V+N T RNF+EIIFEN E  IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTISDDPPAEITK-VTMEPVVLNLTHRNFMEIIFENRETAIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G++FFAV +E G+WSPEKRKNYNL+DA+SRHTIQV+P SWAAI+ + DN GMWN+RSE
Sbjct  443  LCGYAFFAVAVETGQWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLSFDNCGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP +SLRDE+NM
Sbjct  503  VWDRRYLGQQLYVSVVSPNKSLRDEYNM  530



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLEN-PATLAPNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ +  KVFKY+++ D P   + +    +APNV+NATFRNF+E+I EN  K  Q+Y
Sbjct  381  KLAEYYGVADKVFKYNLISDAPDAAIASRDPIIAPNVINATFRNFIEVILENPTKVTQSY  440

Query  267  HLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            +LDG+SFFAV +EPG+WSPEKRK YNL+DA+SRHTIQV+P SWAAIM T DNAGMWNLRS
Sbjct  441  NLDGYSFFAVAVEPGQWSPEKRKCYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRS  500

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            EM    YLGQQ+Y SVLSP RSLRDE+N+
Sbjct  501  EMAENRYLGQQLYVSVLSPNRSLRDEYNL  529



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D+PP  +    T+ P V+N T RNF+EIIFEN E  IQ+YH
Sbjct  384  KLAEYYGVADKVFKYDTIPDDPPAEITK-ITMEPVVLNLTHRNFMEIIFENRETAIQSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G++FFAV +E G+WSPEKRKNYNL+DA+SRHTIQV+P SWAAI+ + DN GMWN+RSE
Sbjct  443  LCGYAFFAVAVETGQWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLSFDNCGMWNIRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SVLSP +SLRDE+NM
Sbjct  503  IWDRRYLGQQLYVSVLSPNKSLRDEYNM  530



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +P KVFKYDI+ DNP  ++     L PNV+    R F+EIIFEN EK++Q+YH
Sbjct  385  KLAEYFGVPEKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFIEIIFENPEKSVQSYH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFAV IEPG W+PEKRKNYNL+DA+SRHT+ V+P SWAAI+ + DN G+WNLRSE
Sbjct  445  LNGYAFFAVAIEPGTWTPEKRKNYNLLDAVSRHTMPVFPKSWAAILLSFDNVGVWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SVL+PERSLRDE+N+
Sbjct  505  LAENRYLGQQLYISVLTPERSLRDEYNI  532



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN--PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KLAE + +  KVFKYD++ D    P   E   TLAPNVVNAT+RNFVEII ENHEK++Q+
Sbjct  351  KLAELYGVADKVFKYDLIKDEYIAPSGNEK-ITLAPNVVNATYRNFVEIILENHEKSVQS  409

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            +HL G++FFAV IE G+W PE+R+NYNL+DA+SR+TIQVYPNSWAAIMTTLDNAG+WNLR
Sbjct  410  WHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLR  469

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            S    R YLG Q+YFSVLSP  SL+DE+NM
Sbjct  470  SNSLERQYLGHQLYFSVLSPSCSLKDEYNM  499



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VFKY +MGD PP   + P TLAPNV+   FR F+EIIFEN EK+IQ+YH
Sbjct  385  KLAEYFNLSNPVFKYSLMGDAPPAP-DTPVTLAPNVIAVEFRTFIEIIFENTEKSIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF  G+ PGKWSPE RK YNL+D +SRH++ V+P SW AI+ T DNAGMWNLRS 
Sbjct  444  LDGYAFFPAGMGPGKWSPESRKRYNLLDTVSRHSVHVFPKSWTAILLTFDNAGMWNLRSM  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W   YLGQQ+Y SV SPERSLRDE+NM
Sbjct  504  NWENKYLGQQLYVSVTSPERSLRDEYNM  531



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL+EY+ I  K FKY+I+GD PP + ++P  +APNV+  TFR F+EII EN E++I +YH
Sbjct  384  KLSEYYSITDKEFKYNIIGDEPPAD-KSPIVIAPNVIKCTFRTFIEIILENPERSIHSYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF  G+  G+WSPEKR+ YNL+DA+SRHT+QVYP SW+AIM T DNAGMWNLR+ 
Sbjct  443  LDGYSFFPAGMGHGEWSPEKRRTYNLLDAVSRHTVQVYPKSWSAIMLTFDNAGMWNLRTM  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W + YLGQQ+Y SV+SPERSLRDE+N+
Sbjct  503  IWDKQYLGQQLYISVISPERSLRDEYNI  530



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K AEYF +  KVFKYDI+ D+P    E   TLAPNVVN T+R+FVEIIFENH K+IQ++H
Sbjct  385  KYAEYFGVADKVFKYDIIKDDPSPEAEAKITLAPNVVNQTYRDFVEIIFENHGKSIQSWH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF V IE G+W+PEKR+NYNL+DAISRHT+QVYP SWAAIM T DNAGMWNLRS 
Sbjct  445  LDGYAFFPVAIEFGRWAPEKRRNYNLLDAISRHTVQVYPGSWAAIMLTFDNAGMWNLRSA  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SV +  RSLRDE+ +
Sbjct  505  QAERAYLGQQLYLSVENVARSLRDEYML  532



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL+EYF I  K FKY+I+GD PP   ++P T+APNVVN TFR F+EII EN E++I  YH
Sbjct  384  KLSEYFGIADKEFKYNIIGDEPPTG-KSPITIAPNVVNCTFRTFIEIILENPERSIHAYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FF VG+  G+W PEKR+ YNL+DA SRHT+QVYP SW+AIM T DNAGMWNLR+ 
Sbjct  443  IDGYAFFPVGMGHGEWDPEKRRTYNLLDASSRHTVQVYPKSWSAIMLTFDNAGMWNLRTL  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W + YLGQQ+YFSV+SP RSLRDE+N+
Sbjct  503  VWDKQYLGQQLYFSVVSPARSLRDEYNI  530



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  +VFKY+ M D PP  +  P  +APNV+ A FR F+E++FEN EK++ + H
Sbjct  392  KLAEYFNISDQVFKYNQMADTPP-AVNGPMHVAPNVITAEFRTFIEVVFENPEKSMDSVH  450

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+P++RK YNL+DA+SRHTIQVYP SW+A+M T DNAGMWN+RS 
Sbjct  451  IDGYAFFAVGMGPGKWTPDQRKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSN  510

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  511  LWERHYLGEQLYMSVVSPARSLRDEYNM  538



>gb|EMT12555.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=440

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  +VFKY+ MGD PP  +  P  + PNV+ A FR F+E++FEN EK++++ H
Sbjct  272  KLAEYFNVSDQVFKYNQMGDEPPA-VNGPMHVVPNVITAEFRTFIEVVFENPEKSMESMH  330

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+  +RK YNL+DA+SRHTIQVYP SW+A+M T DNAGMWN+RS 
Sbjct  331  IDGYAFFAVGMGPGKWTAAERKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSN  390

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  391  LWERHYLGEQLYMSVVSPARSLRDEYNM  418



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN--PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KLAE + +  KVFKYD++ D    P   E   TLAPNVVNAT+RNFVEII ENHEK++Q+
Sbjct  380  KLAELYGVADKVFKYDLIKDEYIAPSGNEK-ITLAPNVVNATYRNFVEIILENHEKSVQS  438

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            +HL G++FFAV IE G+W PE+R+NYNL+DA+SR+TIQVYPNSWAAIMTTLDNAG+WNLR
Sbjct  439  WHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLR  498

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            S    R YLG Q+YFSVLSP  SL+DE+NM
Sbjct  499  SNSLERQYLGHQLYFSVLSPSCSLKDEYNM  528



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKY+ + DNP         + P+V+N T RNF+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYNSV-DNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  444  LNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  NTERRYLGQQLYVSVLSPEKSLRDEYNM  531



>gb|EMS63309.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=329

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  +VF Y+ MGD PP  +  P  + PNV+ A FR F+E++FEN EK++ + H
Sbjct  161  KLAEYFNVSDQVFHYNQMGDEPPA-VNGPMHVVPNVITAEFRTFIEVVFENPEKSMDSVH  219

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+  +RK YNL+DA+SRHTIQVYP SW+A+M T DNAGMWN+R+ 
Sbjct  220  IDGYAFFAVGMGPGKWTAAERKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRTN  279

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  280  LWERHYLGEQLYMSVVSPARSLRDEYNM  307



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y+ MGD PP  +  P ++ PNV+ A FR F+EIIFEN EK++ + H
Sbjct  387  KLAEYFNVTDGVFSYNQMGDVPP-AVNGPLSVIPNVITAEFRTFIEIIFENPEKSMDSLH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PGKWSPE RK YNL+DA+SRHTIQVYP SW+AIM T DNAGMWN+RS 
Sbjct  446  LDGYAFFGVGMGPGKWSPELRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNIRSN  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  506  IWERHYLGEQLYMSVVSPARSLRDEYNM  533



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKY+ + DNP         + P+V+N T RNF+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYNSV-DNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  444  LNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  NTERRYLGQQLYVSVLSPEKSLRDEYNM  531



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKY+ + DNP         + P+V+N T RNF+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYNSV-DNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+RSE
Sbjct  444  LNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  NTERRYLGQQLYVSVLSPEKSLRDEYNM  531



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+I+ D+P  +      + PN++N T R FVE+IFENHE+++Q++H
Sbjct  386  KLAEYFGMADKVFKYNIISDSPTSDQTKTIKIEPNILNVTHRTFVEVIFENHERSVQSWH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAV +EPG W+PEKR+NYNL+DA+SRHT+QV+P  WAA++ + DN GMWN+RSE
Sbjct  446  IDGYAFFAVAVEPGTWTPEKRENYNLLDAVSRHTVQVFPKCWAAVLLSFDNCGMWNVRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE SLRDE+NM
Sbjct  506  NMERRYLGQQLYLSVLSPESSLRDEYNM  533



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+YDI+GD PP     P  +APNV+ A FR F+E++FEN EK+I T H
Sbjct  389  KLAEYFNTTDGVFQYDIIGDVPPSK-SAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+P  R  YNL+D +SRHTIQVYP SW A+M T DNAGMW++RS 
Sbjct  448  IDGYAFFAVGMGPGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSN  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SPERSLRDE+NM
Sbjct  508  IWERQYLGEQLYVSVISPERSLRDEYNM  535



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VFKY++MGD PP   + P TL PNV+ A FR F+EIIFEN E++IQ+YH
Sbjct  385  KLAEYFNASSPVFKYNLMGDVPPAP-DAPLTLVPNVITAEFRTFIEIIFENTERSIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PGKWSPE RK YNL+D +SRH+I+V+P SW AI+ T DNAGMWNLRS 
Sbjct  444  LDGYAFFPVGMGPGKWSPESRKRYNLLDTVSRHSIEVFPRSWTAILLTFDNAGMWNLRSM  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W   YLGQQ+Y SV SP RSLRDE+NM
Sbjct  504  NWENKYLGQQLYVSVTSPARSLRDEYNM  531



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 6/154 (4%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLA-PNVVNATFRNFVEIIFENHEKTIQTY  268
            KLAEY+ I  KVFKYD + D P  N+ +   +  PNV+N TFRNFVEI+FENHEK++Q+Y
Sbjct  343  KLAEYYGIAHKVFKYDTIPDMPLANIASAKVVTHPNVINQTFRNFVEIVFENHEKSMQSY  402

Query  267  HLDGHSFFAV-----GIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGM  103
            HLDG+SFFA+      IEP  W+PEKRK+YNL+DA+SR TIQV+P SWAAI+ T DNAGM
Sbjct  403  HLDGYSFFALYTNIHNIEPDTWTPEKRKSYNLLDAVSRTTIQVFPKSWAAILLTFDNAGM  462

Query  102  WNLRSEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            WN+RSEMW RTYLGQQ+Y SVL P  SL+DE+N+
Sbjct  463  WNIRSEMWERTYLGQQLYVSVLCPGCSLKDEYNV  496



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y++MGD PP  L+ P  LAPNV+ A FR F+EIIFEN E++IQ+YH
Sbjct  385  KLAEYFNLSNPVFNYNLMGDVPPA-LDIPVKLAPNVITAEFRTFIEIIFENTERSIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PGKWSPE R+ YNL+D +SRH+I V+P SW AIM T DNAGMWNLRS 
Sbjct  444  LDGYAFFPVGMGPGKWSPESRRLYNLLDTVSRHSIHVFPKSWTAIMLTFDNAGMWNLRSM  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W   YLGQQ+Y SV SP RSLRDE+NM
Sbjct  504  NWENKYLGQQLYVSVTSPARSLRDEYNM  531



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKYD + D P +NL    TLAPNV+    R F+EI+FENHEK++Q+Y+
Sbjct  384  KLAEYYNVAEKVFKYDTIPDMP-ENLGTSVTLAPNVLKFKHRTFIEIVFENHEKSVQSYN  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV IEPG W+PEKRK YNL+DA+SRHTIQV+P SWAAIM + DN G+WNLRSE
Sbjct  443  LDGYSFFAVAIEPGLWTPEKRKTYNLLDAVSRHTIQVFPKSWAAIMLSFDNVGVWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV +PERSLRDE+N+
Sbjct  503  IAENRYLGQQLYISVPTPERSLRDEYNL  530



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K  EYF +  K FKY++ GD P +    P  LAPNV+   FR FVE+IFEN EK  Q YH
Sbjct  384  KHLEYFGVADKFFKYNLTGDEPREG-SGPVNLAPNVITVEFRTFVEVIFENPEKGPQFYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+ PGKW PE RK YNL+DA+SRH IQVYP SW AIM T DNAGMWNLRSE
Sbjct  443  LDGYSFFAVGMGPGKWKPESRKRYNLLDAVSRHAIQVYPKSWTAIMLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV SP RSLRDE+++
Sbjct  503  LWERRYLGQQLYISVQSPARSLRDEYSL  530



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +    F+Y++MGD PP   + P TLAPNV+ A FR F+EIIFEN E++IQ+YH
Sbjct  385  KLAEYFNLSKPAFEYNLMGDVPPAP-DAPVTLAPNVITAEFRTFIEIIFENTERSIQSYH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF  G+ PGKWSPE RK YN +D +SRH+IQV+P SW AIM T DNAGMWNLRS 
Sbjct  444  LDGYAFFPAGMGPGKWSPESRKRYNHLDTVSRHSIQVFPRSWTAIMLTFDNAGMWNLRSM  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
             W   YLGQQ+Y SV SP RSLRDE+NM
Sbjct  504  NWENKYLGQQLYVSVTSPARSLRDEYNM  531



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKY+ + DNP         + P+V+N T RNF+E++FENHEK++Q++H
Sbjct  385  KLAEYFGIADKVFKYNSV-DNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV +EPG W+PEKRKNYNL+DA+SRHT+QVYP  WAAI+ T DN GMWN+ SE
Sbjct  444  LNGYSFFAVAVEPGSWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIASE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  504  NTERRYLGQQLYVSVLSPEKSLRDEYNM  531



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VFKY+++GD PP N   P  +APNV++A FR F+E++FEN EK+I T H
Sbjct  391  KLAEYFNASDGVFKYNLIGDVPPSNTA-PTKMAPNVISAEFRTFIEVVFENPEKSIDTIH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+   R  YNL+D +SRHTIQVYP SW A+M T DNAGMW++RS 
Sbjct  450  IDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSN  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SPERSLRDE+NM
Sbjct  510  IWERQYLGEQLYVSVISPERSLRDEYNM  537



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+YD++GD PP     P  +APNV+ A FR F+E++FEN EK+I T+H
Sbjct  390  KLAEYFNATDGVFQYDLIGDVPPAK-SAPTKMAPNVLRAEFRTFIEVVFENPEKSIDTFH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+P  R  YNL+D +SRHT+QVYP SW A+M T DNAGMW++RS 
Sbjct  449  IDGYAFFAVGMGPGKWTPACRSTYNLLDTVSRHTVQVYPRSWTAVMMTFDNAGMWSIRSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV SPERSLRDE+NM
Sbjct  509  IWERNYLGEQLYISVTSPERSLRDEYNM  536



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VFKY+++GD PP N   P  +APNV++A FR F+E++FEN EK+I T H
Sbjct  391  KLAEYFNASDGVFKYNLIGDVPPSNTA-PTKMAPNVISAEFRTFIEVVFENPEKSIDTIH  449

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKW+   R  YNL+D +SRHTIQVYP SW A+M T DNAGMW++RS 
Sbjct  450  IDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSN  509

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SPERSLRDE+NM
Sbjct  510  IWERQYLGEQLYVSVISPERSLRDEYNM  537



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K  EYF +  K FKY+++GD PP + + P TLAPNV+   FR +VEII EN E+ +Q+YH
Sbjct  386  KHGEYFGVGDKFFKYNLIGDVPPAS-KAPFTLAPNVITIEFRTYVEIILENPERNLQSYH  444

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG+ PGKW+P  RK YNL+DA+SRHTIQVYP SW+AIM T DNAGMWNLRSE
Sbjct  445  LDGYSFFPVGMGPGKWTPASRKGYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNLRSE  504

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R Y GQQ+Y SV SP RSLRDE+++
Sbjct  505  LWERRYQGQQLYISVQSPARSLRDEYSL  532



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            K AEY+ IP +VFKY+++ D P D +EN  TL PNV++AT++ F+EI+ EN + T+Q++ 
Sbjct  393  KFAEYYGIPEEVFKYNVISDKPADEIEN-VTLQPNVMDATYKAFMEIVLENRQNTMQSWI  451

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFAVG+EPG W+P+KRK+YNL+DA+SR+TIQV+PN WAAI+ ++DNAGMWNLRS 
Sbjct  452  LDGYAFFAVGMEPGTWNPDKRKSYNLIDAVSRYTIQVFPNCWAAILVSMDNAGMWNLRSN  511

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV   +RSLRDE+NM
Sbjct  512  IWERNYLGQQLYLSVRLHKRSLRDEYNM  539



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL+EY+ I  K FKY+I+GD PP + ++   ++PNVVN TFR F+EII EN E++I  YH
Sbjct  384  KLSEYYGIAEKEFKYNIIGDEPPAD-KSTIVISPNVVNCTFRTFIEIILENPERSIHAYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG+  G+W+PE+R+ YNL+DA+SRHT+QVYP SW+A+M T DNAGMWNLR+ 
Sbjct  443  LDGYSFFPVGMGHGEWTPERRRTYNLLDAVSRHTVQVYPKSWSAVMLTFDNAGMWNLRTL  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W + YLGQQ+Y SV+SP RSLRDE+N+
Sbjct  503  IWDKQYLGQQLYISVVSPARSLRDEYNI  530



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+IMGD PP     P  +APNV++A FR F+E++FEN EK+I T+H
Sbjct  389  KLAEYFNATDGVFQYNIMGDVPPA-AGTPIKMAPNVISAEFRTFIEVVFENPEKSIDTFH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            ++G++FFA G+ PG WSP  RK YNL+D +SRHTIQVYP SW A+M T DNAGMWN+RS 
Sbjct  448  INGYAFFAAGMGPGTWSPASRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSN  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV SP RSLRDE+NM
Sbjct  508  LWERHYLGEQLYVSVTSPARSLRDEYNM  535



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF+Y+ M D PP  +  P  + PNV+ A FR F+EIIFEN EK++ + H
Sbjct  298  KLAEYFNVTDGVFRYNQMTDVPP-AVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVH  356

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFAVG+ PGKWS E+RK YNL+D +SRH++QVYP SW AIM T DNAGMWN+RS 
Sbjct  357  LDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSN  416

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  417  IWERHYLGEQLYISVVSPARSLRDEYNM  444



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKY+I+ D PP +L+   T+APNV+  TFR F+EIIFEN EK +Q+Y+
Sbjct  346  KLAEYYGIADKVFKYNIISDEPPTDLK-AITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  404

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  405  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  464

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  465  HAEHRYLGQQLYLSVESEEKSTRDEYNL  492



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  KVFKYD + D P  ++ +  TL PNV+N   R F+EIIFENHEK++Q+++
Sbjct  384  KLAEYFGIAEKVFKYDSIPDMP-QSVPSSVTLQPNVLNFKHRTFIEIIFENHEKSVQSFN  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFF V IEPG W+PEKRK YNL+DA+SRHT+QV+P SWAAIM T DN G+WNLRSE
Sbjct  443  LNGYSFFKVAIEPGTWTPEKRKCYNLLDAVSRHTVQVFPKSWAAIMLTFDNVGVWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV++PERSLRDE+N+
Sbjct  503  LAENRYLGQQLYISVITPERSLRDEYNI  530



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++ D PP     P  LAPNV++A FR F+E++FEN EK+I ++H
Sbjct  382  KLAEYFNATDGVFQYNLISDVPP-KAGTPIKLAPNVLSAEFRTFIEVVFENPEKSIDSFH  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FF  G+ PG WSP+ RK YNL+D +SRHTIQVYP SW A+M T DNAGMWN+RS 
Sbjct  441  IDGYAFFTAGMGPGTWSPQSRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNVRSN  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+QMY SV+SP RSLRDE+NM
Sbjct  501  LWERQYLGEQMYISVISPARSLRDEYNM  528



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKY+ + D PP +L     + PNV+N T R F+EIIFEN EK+IQ+YH
Sbjct  382  KLAEYFGVSDKVFKYNTIQDEPPADLGASVKIQPNVLNVTHRKFIEIIFENPEKSIQSYH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VGIEPG W+P+KRK+YN  DA+SRHT+QV+P  WAAI+ + DN GMWNLRS 
Sbjct  442  LDGYAFFVVGIEPGTWTPDKRKSYNPFDAVSRHTVQVFPKCWAAILLSTDNVGMWNLRSL  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y S++SPE SLRDE+NM
Sbjct  502  TAENMYLGQQLYISIMSPEGSLRDEYNM  529



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++GD PP     P  LAPNV++A FR F+E++FEN EK+I ++H
Sbjct  385  KLAEYFNASSGVFEYNLIGDVPPATTV-PQKLAPNVISAEFRTFIEVVFENPEKSIDSFH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            ++G++FFA G+ PG W+PE RK YNL+D +SRHTIQVYP SW A+M T DNAGMWN+RS 
Sbjct  444  INGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSN  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLG Q+Y SV+SP RSLRDE+NM
Sbjct  504  MWERYYLGAQLYVSVVSPARSLRDEYNM  531



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ I  KVFKY+I+ D PP +L+   T+APNV+  TFR F+EIIFEN EK +Q+Y+
Sbjct  387  KLAEYYGIADKVFKYNIISDEPPTDLKA-ITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  446  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  506  HAEHRYLGQQLYLSVESEEKSTRDEYNL  533



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++GD PP     P  LAPNV++A FR F+E++FEN EK+I ++H
Sbjct  382  KLAEYFNASSGVFEYNLIGDVPPATTV-PQKLAPNVISAEFRTFIEVVFENPEKSIDSFH  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            ++G++FFA G+ PG W+PE RK YNL+D +SRHTIQVYP SW A+M T DNAGMWN+RS 
Sbjct  441  INGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSN  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLG Q+Y SV+SP RSLRDE+NM
Sbjct  501  MWERYYLGAQLYVSVVSPARSLRDEYNM  528



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L+   T+APNV+  TFR F+EIIFEN EK +Q+Y+
Sbjct  382  KLAEYYGVADKVFKYNIISDEPPTDLKA-ITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  441  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  501  HAEHRYLGQQLYLSVESEEKSTRDEYNL  528



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+++  KVFK+D M D PP    +  T+ PNVVN T R+FVEIIFEN EK++QT+H
Sbjct  384  KLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSLQTWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+VG EPG W+PEKR NYNL+DA+SR+T+QV+P SWAAIM T D+AGMWN+RSE
Sbjct  444  LDGYSFFSVGSEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y  V +  RSLR+E+NM
Sbjct  504  QPERRYLGQQFYVGVENIARSLRNEYNM  531



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLE--NPATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KLAEY+E P KVFKYD +GD PP N+E  +  T+AP V+N   R+F+E+IFENHEK++Q+
Sbjct  387  KLAEYYEAPAKVFKYDPIGDEPPANIEKLDKITIAPIVLNFKHRDFIEVIFENHEKSVQS  446

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            + L G++FF V IE G WSP KRKNYNL+DA+S++ IQVYP SWAAI+ T DN GMWN+R
Sbjct  447  FRLAGYAFFPVAIEVGTWSPAKRKNYNLMDAVSKYNIQVYPKSWAAILLTFDNVGMWNVR  506

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +E   R YLGQQ+Y SV +PER LRDE+N+
Sbjct  507  NECMERAYLGQQLYISVPTPERVLRDEYNL  536



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L+   T+APNV+  TFR F+EIIFEN EK +Q+Y+
Sbjct  382  KLAEYYGVADKVFKYNIISDEPPTDLKA-ITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  441  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  501  HAEHRYLGQQLYLSVESEEKSTRDEYNL  528



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL+EY+ I  K FKY I+GD PP N ++  T+APNV+N TFR F+E+I EN E++I  YH
Sbjct  384  KLSEYYGIADKEFKYSIIGDEPP-NGKSLITIAPNVINCTFRTFIEVILENPERSIHAYH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF  G+  G+W+PEKR  YNL+DA SRHT+QVYP SW+AIM T DNAGMWNLR+ 
Sbjct  443  LDGYAFFPAGMGHGEWTPEKRVTYNLLDAASRHTVQVYPKSWSAIMLTFDNAGMWNLRTL  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W + YLGQQ+Y SV SP RSLRDE+NM
Sbjct  503  VWDKQYLGQQLYISVASPARSLRDEYNM  530



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  +VF    + D PP + +    LAP VV   FR+F+EI+FEN EK+IQ++H
Sbjct  381  KLAEYYGVAARVFDTKAIADMPPASPQ--IKLAPAVVKGNFRDFIEIVFENREKSIQSWH  438

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAVG+  G+W+P  RK YNL+DA+S+HTIQVYPNSW A++ T+DNAGMW+LRSE
Sbjct  439  LDGYSFFAVGMSGGQWTPASRKVYNLLDAVSKHTIQVYPNSWTAVLLTIDNAGMWSLRSE  498

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y SV+SP RSLRDE+NM
Sbjct  499  LWERQYLGQQLYLSVVSPARSLRDEYNM  526



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y+ MGD PP  +  P  + PNV+ A FR F+EI+FEN EK+I + H
Sbjct  390  KLAEYFNVTDGVFSYNQMGDVPP-AVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PG WSPE RK YNL+D +SRHTIQVYP SW AIM T DNAGMW++RS 
Sbjct  449  LDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q Y SV+SP RSLRDE+NM
Sbjct  509  VWERYYLGEQFYISVISPARSLRDEYNM  536



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y+ MGD PP  +  P  + PNV+ A FR F+EI+FEN EK+I + H
Sbjct  390  KLAEYFNVTDGVFSYNQMGDVPP-AVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PG WSPE RK YNL+D +SRHTIQVYP SW AIM T DNAGMW++RS 
Sbjct  449  LDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q Y SV+SP RSLRDE+NM
Sbjct  509  VWERYYLGEQFYISVISPARSLRDEYNM  536



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDN--PPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQT  271
            KLA+Y+ +  KVFKY +  D   PP   E   T+APNVVN T+RNFVEII ENHEK++Q+
Sbjct  383  KLAQYYGVADKVFKYGLCKDEYIPPSGNE-VITIAPNVVNVTYRNFVEIILENHEKSVQS  441

Query  270  YHLDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLR  91
            +HLDG +FFAV I PG+W PE R+NYNL+DA+SR TIQVYPNSWAAI+TTLDNAG+WNLR
Sbjct  442  WHLDGFNFFAVAIAPGRWKPEMRQNYNLLDAVSRSTIQVYPNSWAAIITTLDNAGLWNLR  501

Query  90   SEMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            S    + YLG Q+YFSV +P  SL+DE+NM
Sbjct  502  SNALEKQYLGHQLYFSVNAPNTSLKDEYNM  531



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L    T+APNV+  TFR F+EIIFEN EK +Q+Y+
Sbjct  382  KLAEYYGVADKVFKYNIISDEPPTDLRA-ITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  441  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  501  HAEHRYLGQQLYLSVESEEKSTRDEYNL  528



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL++Y+ I  K FK D + D P  +L +  TLAPNV+   +R F+EIIFENHEK++Q+Y+
Sbjct  386  KLSDYYGIGSKFFKNDTIPDQPAADLGSAVTLAPNVMKFEYRTFIEIIFENHEKSVQSYN  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAV IEPG W+PEKRK YNL+D +SRHT+QV+P SWAAIM T DN GMWNLRSE
Sbjct  446  LNGYSFFAVAIEPGTWTPEKRKGYNLLDGVSRHTVQVFPKSWAAIMLTFDNVGMWNLRSE  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +    YLGQQ+Y SV +PE SLRDE+N+
Sbjct  506  IAENRYLGQQLYISVPTPEGSLRDEYNI  533



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF+Y+ M D PP  +  P  + PNV+ A FR F+EIIFEN EK++ + H
Sbjct  388  KLAEYFNVTDGVFRYNQMTDVPP-AVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFAVG+ PGKWS E+RK YNL+D +SRH++QVYP SW AIM T DNAGMWN+RS 
Sbjct  447  LDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSN  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  507  IWERHYLGEQLYISVVSPARSLRDEYNM  534



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y+ MGD PP  +  P  + PNV+ A FR F+EI+FEN EK++ + H
Sbjct  390  KLAEYFNVTDGVFSYNQMGDVPP-AVNGPLHVVPNVITAEFRTFIEIVFENPEKSLDSIH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG+ PG+WSPE R  YNL+DA+SRHTIQVYP SW AIM T DNAGMW++RS 
Sbjct  449  LDGYAFFGVGMGPGQWSPEARVTYNLLDAVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q Y SV+SPE SLRDE+NM
Sbjct  509  IWERYYLGEQFYISVISPEHSLRDEYNM  536



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+ I  KVFK+D M  +P        T+ PNV+N T ++FVEIIFEN EK++QT+H
Sbjct  384  KLADYYGIREKVFKFDTMKVDPQSTPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFAV +EPGKW+PEKRKNYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  444  LNGYAFFAVAVEPGKWTPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y  V + +RSLR+E+NM
Sbjct  504  QPERRYLGQQLYVGVENIKRSLRNEYNM  531



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++GD PP     P  +APN++ A FR F+E++FEN EK+I ++H
Sbjct  389  KLAEYFNATTGVFEYNLIGDTPPKE-GTPIKVAPNILTAEFRTFIEVVFENPEKSIDSFH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFA G+ PG W+P+ RK YNL+D +SRHTIQVYP SW AIM T DNAGMWNLR+ 
Sbjct  448  LNGYAFFAAGMGPGLWTPDCRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWNLRTN  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R Y+G+Q+Y SV SP RSLRDE+NM
Sbjct  508  IWERYYMGEQLYMSVTSPARSLRDEYNM  535



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +   VF Y+ MGD PP  +  P  + PNV+ A FR F+EI+FEN EK+I + H
Sbjct  390  KLAEYFNVTDGVFSYNQMGDVPP-AVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FF VG+ PGKWSPE RK YNL+D +SRHTIQVYP SW AIM T DNAGMW++ S 
Sbjct  449  VDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVHSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q Y SV+SP RSLRDE+NM
Sbjct  509  IWERYYLGEQFYISVVSPARSLRDEYNM  536



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L    T+APNV+  TFR F+EIIFEN  K +Q+Y+
Sbjct  382  KLAEYYGVADKVFKYNIISDEPPTDLRA-ITIAPNVMQTTFRTFIEIIFENPGKVLQSYN  440

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFFAV  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  441  LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  501  HAEHRYLGQQLYLSVESEEKSTRDEYNL  528



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KL EYF +   VFKY+ M D PP  +  P  + PNV+ A FR F+E++FEN EK++ + H
Sbjct  372  KLLEYFNVTDPVFKYNQMADVPP-AVMGPLQVVPNVITAEFRTFIEVVFENPEKSMDSVH  430

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FFAVG+ PGKWSPE RK YNL+DA+SRH+IQVYP SW+A+M T DNAGMWN+RS 
Sbjct  431  IDGYAFFAVGMGPGKWSPELRKTYNLLDAVSRHSIQVYPRSWSAVMLTFDNAGMWNVRSN  490

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R Y G+Q Y SV SP RSLRDE+NM
Sbjct  491  VWERYYTGEQFYISVTSPARSLRDEYNM  518



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L    T+APNV+  TFR F+EIIFEN  K +Q+Y+
Sbjct  208  KLAEYYGVADKVFKYNIISDEPPIDLR-AITIAPNVMQTTFRTFIEIIFENPGKVLQSYN  266

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFF V  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW L SE
Sbjct  267  LGGYSFFVVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLGSE  326

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  327  HAEHRYLGQQLYLSVESEEKSTRDEYNL  354



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++GD PP        LAPNV+   FR F+E++FEN EK+I ++H
Sbjct  387  KLAEYFNATAGVFEYNLIGDVPPA-AGAAVKLAPNVIQTEFRTFIEVVFENPEKSIDSFH  445

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            ++G++FFA G+ PG W+P+ RK YNL+D +SRHTIQVYP SW A+M T DNAGMWN+RS 
Sbjct  446  INGYAFFAAGMGPGTWTPDCRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSN  505

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            MW R YLG+Q+Y SV+SP RSLRDE+NM
Sbjct  506  MWERFYLGEQLYVSVISPARSLRDEYNM  533



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+++  KVFK+D M D PP    +  T+ PNVVN T R+FVEIIFEN EK+ QT+H
Sbjct  384  KLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSPQTWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SR+T+QV+P SWAAIM T D+AGMWN+RSE
Sbjct  444  LDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y  V +  RSLR+E+NM
Sbjct  504  QPERRYLGQQFYVGVENIARSLRNEYNM  531



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF +  KVFKYD + D P     +   + PNV+N   R FVEI+FENHEKT Q++H
Sbjct  389  KLAQYFGVADKVFKYDTIKDEPTAAETSKILVQPNVLNIEHRAFVEIVFENHEKTTQSWH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  W AI+ T DN GMWN+RSE
Sbjct  449  LDGYSFFAVAVEPGNWTPEKRKNYNLLDAVSRHTIQVYPKCWGAILLTFDNCGMWNIRSE  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  + YLGQQ+Y +V  PE S+RDE++ 
Sbjct  509  ILEKRYLGQQLYVNVGPPELSMRDEYSF  536



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF Y+ MGD PP  +  P  + PNV+ A FR F+EI+FEN EK+I + H
Sbjct  390  KLAEYFNATDGVFSYNQMGDVPP-AVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLH  448

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            +DG++FF VG+ PGKWSPE RK YNL+D +SRHTIQVYP SW AIM T DNAGMW++ S 
Sbjct  449  VDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVHSN  508

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q Y SV+SP RSLRDE+NM
Sbjct  509  IWERYYLGEQFYISVVSPARSLRDEYNM  536



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+ I  KVFK+D M  +P    E   T+ PNV+N T ++FVEIIFEN EK++QT+H
Sbjct  384  KLADYYGIREKVFKFDTMKVDPQSPAEK-ITMEPNVLNITIKDFVEIIFENPEKSLQTWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFAV +EPGKW+PEKRKNYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  443  LNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y  V + +RSLR+E+NM
Sbjct  503  QPERRYLGQQLYVGVENIKRSLRNEYNM  530



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+++  KVFK+D M D PP    +  T+ PNVVN T R+FVEIIFEN E ++QT+H
Sbjct  384  KLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPENSLQTWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+PEKR NYNL+DA+SR+T+QV+P SWAAIM T D+AGMWN+RSE
Sbjct  444  LDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y  V +  RSLR+E+NM
Sbjct  504  QPERRYLGQQFYVGVENIARSLRNEYNM  531



>gb|ABV89620.1| Sku5-like 12 [Brassica rapa]
Length=229

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF +  KVFKYD + D P     +   + PNV+N   R+FVEI+FEN E+T Q++H
Sbjct  59   KLAQYFGVADKVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFVEIVFENQERTTQSWH  118

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKW+P KRKNYNL+DA+ RHTIQVYP  W AI+ T DN GMWN+R E
Sbjct  119  LDGYSFFAVAVEPGKWTPAKRKNYNLLDAVYRHTIQVYPKCWGAILLTFDNCGMWNIRFE  178

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHN  4
            +  + YLGQQ+Y +V  PE S RDE++
Sbjct  179  ILEKRYLGQQLYVNVGPPELSQRDEYS  205



>gb|KJB27391.1| hypothetical protein B456_004G016000 [Gossypium raimondii]
Length=421

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF I  K F+YD + DNPP+  E    + P V+N T R+FVEIIFENH+  IQ+YH
Sbjct  255  KLAEYFNIVKKEFEYDTIPDNPPEKTET-IQVKPIVLNITHRHFVEIIFENHKTAIQSYH  313

Query  264  LDGHSFFAVGIEPGKWSPEKRKN-YNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRS  88
            L G+SF AV IE G WSPEKRKN YNL+DA+SRHTIQV+P SWAAI+ T DN GMWN+RS
Sbjct  314  LSGYSF-AVAIETGTWSPEKRKNNYNLLDAVSRHTIQVFPKSWAAILLTFDNCGMWNIRS  372

Query  87   EMWARTYLGQQMYFSVLSPERSLRDEHNM  1
            E+W R YLGQQ+Y SVLSP  S +DE+N+
Sbjct  373  EVWDRFYLGQQLYVSVLSPNLSTKDEYNI  401



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEY+ +  KVFKY+I+ D PP +L    T+APNV+  TFR F+EIIFEN  K +Q+Y+
Sbjct  383  KLAEYYGVADKVFKYNIISDEPPIDLRA-ITIAPNVMQTTFRTFIEIIFENPGKVLQSYN  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L G+SFF V  EPG W+PEKRK YNL+DAISRHTIQV+P SWAAIM T DNAGMW LRSE
Sbjct  442  LGGYSFFVVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
                 YLGQQ+Y SV S E+S RDE+N+
Sbjct  502  HAEHRYLGQQLYLSVESEEKSTRDEYNL  529



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+ I  KVFK+D M  +P    E   T+ PNV+N T ++FVEIIFEN EK++QT+H
Sbjct  384  KLADYYGIREKVFKFDTMKVDPQSPAEK-ITMEPNVLNITIKDFVEIIFENPEKSLQTWH  442

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFAV +EPGKW+PEKRKNYNL+DA+SRHTIQV+P SWAAI+ T DNAGMWNLRSE
Sbjct  443  LNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  502

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y  V + +RSLR+E+NM
Sbjct  503  QPERRYLGQQLYVGVENIKRSLRNEYNM  530



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++ D PP     P  LAPNV+ A  R ++E++FEN E++I T+H
Sbjct  389  KLAEYFNATKGVFEYNLITDTPPKE-GTPIKLAPNVITAEHRTYIEVVFENPERSIDTFH  447

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFA G+ PG W+ E RK YNL+D +SRHTIQVYP SW A+M T DNAGMWNLRS 
Sbjct  448  LNGYAFFAAGMGPGLWTAESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  507

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y S  SP RSLRDE+NM
Sbjct  508  LWERYYLGEQLYVSCTSPARSLRDEYNM  535



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++ D PP     P  +AP+V+ A  R ++EI+FEN EK+I T+H
Sbjct  388  KLAEYFNATKGVFEYNLVTDTPPKE-GTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FFA G+ PG W+ E RK YNL+D +SRHTIQVYP SW A+M T DNAGMWNLRS 
Sbjct  447  LDGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y S  SP RSLRDE+NM
Sbjct  507  LWERYYLGEQLYVSCTSPARSLRDEYNM  534



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF     VF+Y+++ D PP     P  +AP+V+ A  R ++EI+FEN EK+I T+H
Sbjct  388  KLAEYFNATKGVFEYNLVTDTPPKE-GTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFH  446

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G++FFA G+ PG W+ E RK YNL+D +SRHTIQVYP SW A+M T DNAGMWNLRS 
Sbjct  447  LNGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  506

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLG+Q+Y S  SP RSLRDE+NM
Sbjct  507  LWERYYLGEQLYVSCTSPARSLRDEYNM  534



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF +  KVFKYD + D P     +   + PNV+N   R+FVEI+FEN E+T Q++H
Sbjct  384  KLAQYFGVADKVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFVEIVFENQERTTQSWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPGKW+P KRKNYNL+DA+ RHTIQVYP  W AI+ T DN GMWN+RSE
Sbjct  444  LDGYSFFAVAVEPGKWTPAKRKNYNLLDAVYRHTIQVYPKCWGAILLTFDNCGMWNIRSE  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +  + YLGQQ+Y +V  PE S RDE++ 
Sbjct  504  ILEKRYLGQQLYVNVGPPELSQRDEYSF  531



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+++  KVFK D M D PP    +  T+  NVVN T ++FVEIIFEN EK++QT+H
Sbjct  384  KLADYYKVWDKVFKPDTMKDTPPATAADKITMVTNVVNITIKDFVEIIFENPEKSLQTWH  443

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF+V  EPG W+P KR NYNL+DA+SR+++QV+P SWAAIM T DNAGMWN+RS+
Sbjct  444  LDGYSFFSVASEPGTWTPAKRSNYNLLDAVSRYSVQVFPKSWAAIMLTFDNAGMWNIRSD  503

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ Y  V +  RSLR+E+NM
Sbjct  504  QPERRYLGQQFYVDVENIARSLRNEYNM  531



>emb|CAE53901.1| putative L-ascorbate oxidase homolog [Triticum aestivum]
Length=156

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  KYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEP  226
            +Y+++ D PP     P  +AP+V+ A  R ++EI+FEN EK+I T+HL+G++FFA G+ P
Sbjct  1    EYNLVTDTPPKE-GTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFHLNGYAFFAAGMGP  59

Query  225  GKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSEMWARTYLGQQMYF  46
            G W+ E RK YNL+D +SRHTIQVYP SW A+M T DNAGMWNLRS +W R YLG+Q+Y 
Sbjct  60   GLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSNLWERYYLGEQLYV  119

Query  45   SVLSPERSLRDEHNM  1
            S  SP RSLRDE+NM
Sbjct  120  SCTSPARSLRDEYNM  134



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 15/148 (10%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLAEYF +  KVFKYD + DNP  +      + PN               NHE+++Q++H
Sbjct  386  KLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPN---------------NHERSVQSWH  430

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFFAV +EPG W+PEKRKNYNL+DA+SRHTIQVYP  WAAI+ T DN GMWN+RSE
Sbjct  431  LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSE  490

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
               R YLGQQ+Y SVLSPE+SLRDE+NM
Sbjct  491  NSERRYLGQQLYASVLSPEKSLRDEYNM  518



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+Y+E+  +V+    M D+PP+      T   NVV+   R+F+EI+FEN EKT+QT+H
Sbjct  379  KLADYYEMGKEVWCDKCMPDSPPEEEMKEET---NVVDGVHRDFIEIVFENREKTVQTWH  435

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            L+G+SFFAVG+  G W+PE R  YNL DAISR  IQVYP SW+AI+ T DNAGMW+LRSE
Sbjct  436  LNGYSFFAVGMSRGTWTPESRNVYNLFDAISRSNIQVYPKSWSAILLTTDNAGMWSLRSE  495

Query  84   MWARTYLGQQMYFSVLSPERSLRDEHNM  1
            +W R YLGQQ+Y  + SP  SLRDE+++
Sbjct  496  IWERQYLGQQLYLRIPSPVHSLRDEYDI  523



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF I G VF+   + DNPP  L N   L  +V+ A +R FVEI+FEN E  +Q++H
Sbjct  379  KLADYFNISG-VFRVGSISDNPP--LGNGINLDTSVMGADYRAFVEIVFENRENIVQSWH  435

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG++FF VG++ G W+ + RK YNLVDA+SR T QVYPNSW A+   LDN GMWN+RSE
Sbjct  436  LDGYAFFLVGMDGGTWTSDSRKQYNLVDAVSRSTTQVYPNSWTAVYVALDNVGMWNIRSE  495

Query  84   MWARTYLGQQMYFSVLSPERSLRDEH  7
             WAR YLGQQ Y  V +P +S+RDE+
Sbjct  496  YWARQYLGQQYYLRVYTPVKSVRDEY  521



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   172 bits (436),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 84/146 (58%), Positives = 101/146 (69%), Gaps = 4/146 (3%)
 Frame = -2

Query  444  KLAEYFEIPGKVFKYDIMGDNPPDNLENPATLAPNVVNATFRNFVEIIFENHEKTIQTYH  265
            KLA+YF+I G VF+   + DNP         L  +V+ A FR FVEI+FENHE  +Q++H
Sbjct  386  KLADYFKI-GGVFRLGSISDNPTGGQR---YLDTSVMPADFRAFVEIVFENHESIVQSWH  441

Query  264  LDGHSFFAVGIEPGKWSPEKRKNYNLVDAISRHTIQVYPNSWAAIMTTLDNAGMWNLRSE  85
            LDG+SFF VG++ GKW+P  RK YNL DAI R T QVYP SW AI   LDN GMWNLR+E
Sbjct  442  LDGYSFFVVGMDGGKWTPTSRKQYNLRDAIVRCTTQVYPKSWTAIYVALDNVGMWNLRTE  501

Query  84   MWARTYLGQQMYFSVLSPERSLRDEH  7
             WAR YLGQQ Y  V SP  S+RDE+
Sbjct  502  FWARQYLGQQFYLRVYSPVESIRDEY  527



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880