BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030L20

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        329   8e-106   Sesamum indicum [beniseed]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    323   9e-104   Gossypium raimondii
gb|KJB26282.1|  hypothetical protein B456_004G235100                    323   2e-103   Gossypium raimondii
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             323   2e-103   Nicotiana sylvestris
gb|KJB26284.1|  hypothetical protein B456_004G235100                    323   3e-103   Gossypium raimondii
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             323   3e-103   Nicotiana tomentosiformis
ref|XP_006432049.1|  hypothetical protein CICLE_v10000673mg             313   6e-102   
emb|CDP04035.1|  unnamed protein product                                318   2e-101   Coffea canephora [robusta coffee]
emb|CBI15802.3|  unnamed protein product                                303   3e-100   Vitis vinifera
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             313   8e-100   
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                314   1e-99    Erythranthe guttata [common monkey flower]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             313   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             313   3e-99    Citrus clementina [clementine]
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   310   1e-98    Citrus sinensis [apfelsine]
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   310   4e-98    Citrus sinensis [apfelsine]
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         309   7e-98    
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        306   1e-96    Solanum tuberosum [potatoes]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    304   1e-96    
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        305   2e-96    Populus euphratica
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 305   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             305   3e-96    Solanum lycopersicum
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    305   3e-96    Vitis vinifera
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         304   4e-96    Jatropha curcas
ref|XP_010094443.1|  Root phototropism protein 2                        304   7e-96    Morus notabilis
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        303   2e-95    Cucumis sativus [cucumbers]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       303   2e-95    
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    301   6e-95    Cucumis melo [Oriental melon]
ref|XP_002533880.1|  Root phototropism protein, putative                299   2e-94    
gb|ADL36608.1|  BZIP domain class transcription factor                  300   3e-94    Malus domestica [apple tree]
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        300   3e-94    Populus euphratica
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        300   4e-94    Populus euphratica
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             299   5e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             299   7e-94    Fragaria vesca subsp. vesca
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             298   2e-93    Prunus persica
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 298   2e-93    
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    300   3e-93    
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        297   3e-93    Pyrus x bretschneideri [bai li]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    297   3e-93    Prunus mume [ume]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    297   3e-93    Prunus mume [ume]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        296   5e-93    
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             293   8e-92    Eucalyptus grandis [rose gum]
ref|NP_001280895.1|  root phototropism protein 2-like                   293   1e-91    Malus domestica [apple tree]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        290   2e-91    Glycine max [soybeans]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        291   4e-91    Pyrus x bretschneideri [bai li]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    291   8e-91    
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             290   3e-90    Capsella rubella
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        289   4e-90    Glycine max [soybeans]
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             288   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        288   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             287   2e-89    Phaseolus vulgaris [French bean]
ref|NP_001280845.1|  root phototropism protein 2-like                   287   2e-89    Malus domestica [apple tree]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        286   3e-89    Glycine max [soybeans]
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    287   3e-89    
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             286   4e-89    
gb|ACJ85866.1|  unknown                                                 280   5e-89    Medicago truncatula
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          286   5e-89    Amborella trichopoda
dbj|BAJ33924.1|  unnamed protein product                                286   5e-89    Eutrema halophilum
gb|ACJ85743.1|  unknown                                                 276   6e-89    Medicago truncatula
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        286   6e-89    Camelina sativa [gold-of-pleasure]
gb|AAB63086.1|  unknown protein                                         281   7e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             285   2e-88    Phaseolus vulgaris [French bean]
gb|KEH28209.1|  root phototropism-like protein                          283   2e-88    Medicago truncatula
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             285   2e-88    
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        285   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_003616056.1|  Root phototropism protein                          283   9e-88    Medicago truncatula
ref|NP_001031446.1|  Root phototropism protein 2                        281   2e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01791.1|  hypothetical protein                                   281   4e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02185.1|  hypothetical protein                                   281   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           281   4e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAF33112.1|AF181683_1  RPT2                                          280   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|EPS73802.1|  hypothetical protein M569_00954                         280   1e-86    Genlisea aurea
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        279   2e-86    Cicer arietinum [garbanzo]
ref|XP_003600551.1|  Root phototropism protein                          277   3e-86    
gb|AES70802.2|  root phototropism-like protein                          277   5e-86    Medicago truncatula
gb|KFK22949.1|  root phototropism protein 2                             279   5e-86    Arabis alpina [alpine rockcress]
ref|XP_003600550.1|  Root phototropism protein                          277   1e-85    Medicago truncatula
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        275   1e-84    Cicer arietinum [garbanzo]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        272   1e-83    Eucalyptus grandis [rose gum]
emb|CDY10743.1|  BnaA05g11930D                                          271   4e-83    Brassica napus [oilseed rape]
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             271   5e-83    Brassica rapa
emb|CDX84827.1|  BnaA03g14030D                                          270   5e-83    
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        270   6e-83    Brassica rapa
emb|CDY23992.1|  BnaC03g16990D                                          268   3e-82    Brassica napus [oilseed rape]
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    265   3e-81    
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    265   6e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     265   7e-81    Eucalyptus grandis [rose gum]
emb|CDY02075.1|  BnaC04g14260D                                          263   3e-80    
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    259   4e-79    
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    259   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08105.1|  Root phototropism 2 -like protein                       251   2e-76    Gossypium arboreum [tree cotton]
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             250   2e-75    Sesamum indicum [beniseed]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             237   3e-70    Elaeis guineensis
gb|KHN18647.1|  Root phototropism protein 2                             226   9e-69    Glycine soja [wild soybean]
gb|EMS47631.1|  Root phototropism protein 2                             217   2e-64    Triticum urartu
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        221   6e-64    Setaria italica
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             218   6e-63    Phoenix dactylifera
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        214   1e-61    Setaria italica
ref|XP_008669932.1|  PREDICTED: root phototropism protein 2-like        213   4e-61    Zea mays [maize]
dbj|BAJ91259.1|  predicted protein                                      209   7e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92463.1|  predicted protein                                      209   9e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002450159.1|  hypothetical protein SORBIDRAFT_05g001300          206   1e-58    
gb|KHN24717.1|  Root phototropism protein 2                             194   2e-58    Glycine soja [wild soybean]
ref|XP_006663162.1|  PREDICTED: root phototropism protein 2-like        200   6e-57    
ref|XP_003577852.1|  PREDICTED: root phototropism protein 2             191   1e-52    Brachypodium distachyon [annual false brome]
gb|EEC68739.1|  hypothetical protein OsI_37246                          187   9e-52    Oryza sativa Indica Group [Indian rice]
gb|ABG22339.1|  RPT2, putative, expressed                               186   2e-51    Oryza sativa Japonica Group [Japonica rice]
gb|ABA95649.1|  RPT2, putative, expressed                               186   4e-51    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065596.1|  Os11g0118300                                       186   5e-51    
ref|NP_001066000.1|  Os12g0117400                                       186   6e-51    
gb|EEC67555.1|  hypothetical protein OsI_34888                          185   7e-51    Oryza sativa Indica Group [Indian rice]
gb|AFW55920.1|  putative phototropic-responsive NPH3 family protein     180   8e-49    
ref|XP_008661889.1|  PREDICTED: LOC100281201 isoform X1                 180   1e-48    
ref|NP_001147592.1|  LOC100281201                                       179   2e-48    
ref|XP_002463481.1|  hypothetical protein SORBIDRAFT_01g000540          169   3e-47    
ref|XP_009374446.1|  PREDICTED: putative disease resistance prote...    177   8e-47    Pyrus x bretschneideri [bai li]
ref|XP_002441790.1|  hypothetical protein SORBIDRAFT_08g002330          164   4e-43    
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    147   6e-37    
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    147   6e-37    
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    146   8e-37    Nelumbo nucifera [Indian lotus]
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...    144   2e-36    Populus euphratica
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...    144   3e-36    Populus euphratica
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    144   3e-36    Populus euphratica
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    144   3e-36    Populus euphratica
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             142   3e-35    Populus trichocarpa [western balsam poplar]
gb|AFK45576.1|  unknown                                                 140   4e-35    Medicago truncatula
gb|KHN36285.1|  BTB/POZ domain-containing protein                       141   6e-35    Glycine soja [wild soybean]
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             141   7e-35    
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-34    Phoenix dactylifera
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-34    Glycine max [soybeans]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-34    Glycine max [soybeans]
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    139   3e-34    
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-34    
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-34    
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             138   7e-34    
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             138   9e-34    Selaginella moellendorffii
gb|AAN77296.1|  Hypothetical protein                                    138   9e-34    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74727.1|  hypothetical protein OsI_10455                          138   1e-33    Oryza sativa Indica Group [Indian rice]
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    137   2e-33    Glycine max [soybeans]
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    137   2e-33    Glycine max [soybeans]
gb|KHN12984.1|  BTB/POZ domain-containing protein                       137   2e-33    Glycine soja [wild soybean]
ref|XP_002533158.1|  Root phototropism protein, putative                137   2e-33    Ricinus communis
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          136   3e-33    
emb|CDP02580.1|  unnamed protein product                                136   3e-33    Coffea canephora [robusta coffee]
gb|KJB48679.1|  hypothetical protein B456_008G080700                    133   6e-33    Gossypium raimondii
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    135   7e-33    Pyrus x bretschneideri [bai li]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    135   9e-33    Glycine max [soybeans]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         135   9e-33    
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Eucalyptus grandis [rose gum]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Eucalyptus grandis [rose gum]
ref|XP_010412681.1|  PREDICTED: putative BTB/POZ domain-containin...    130   1e-32    Camelina sativa [gold-of-pleasure]
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  134   1e-32    
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    134   2e-32    Eucalyptus grandis [rose gum]
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             134   2e-32    Prunus persica
ref|XP_010905283.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-32    Elaeis guineensis
gb|ACL53070.1|  unknown                                                 133   2e-32    Zea mays [maize]
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    134   2e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    134   3e-32    Elaeis guineensis
gb|KJB48678.1|  hypothetical protein B456_008G080700                    132   3e-32    Gossypium raimondii
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    133   5e-32    
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    132   6e-32    Tarenaya hassleriana [spider flower]
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    132   6e-32    Tarenaya hassleriana [spider flower]
gb|KJB48677.1|  hypothetical protein B456_008G080700                    132   7e-32    Gossypium raimondii
gb|ACL52494.1|  unknown                                                 132   9e-32    Zea mays [maize]
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...    132   1e-31    
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             132   1e-31    Phaseolus vulgaris [French bean]
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    132   1e-31    Citrus sinensis [apfelsine]
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   132   1e-31    Citrus sinensis [apfelsine]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             132   2e-31    Citrus clementina [clementine]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    132   2e-31    Nicotiana sylvestris
ref|XP_008368005.1|  PREDICTED: BTB/POZ domain-containing protein...    126   2e-31    
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...    130   3e-31    
dbj|BAK07863.1|  predicted protein                                      130   4e-31    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS72379.1|  hypothetical protein M569_02379                         130   5e-31    Genlisea aurea
ref|NP_001152299.1|  transposon protein Mutator sub-class               130   5e-31    Zea mays [maize]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    130   6e-31    Pyrus x bretschneideri [bai li]
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             130   6e-31    Selaginella moellendorffii
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    129   7e-31    Camelina sativa [gold-of-pleasure]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    130   7e-31    Cicer arietinum [garbanzo]
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             129   8e-31    Selaginella moellendorffii
gb|KEH27511.1|  phototropic-responsive NPH3 family protein              129   8e-31    Medicago truncatula
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    130   8e-31    Cicer arietinum [garbanzo]
emb|CDY37857.1|  BnaAnng05180D                                          129   1e-30    Brassica napus [oilseed rape]
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    130   1e-30    
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    129   1e-30    
emb|CAN71562.1|  hypothetical protein VITISV_007563                     129   1e-30    Vitis vinifera
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    129   1e-30    Cicer arietinum [garbanzo]
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    129   1e-30    Vitis vinifera
ref|XP_003597110.1|  Root phototropism protein                          129   2e-30    
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-30    Brassica rapa
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-30    Brassica rapa
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    128   2e-30    Arabis alpina [alpine rockcress]
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-30    Solanum tuberosum [potatoes]
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    128   3e-30    Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    128   3e-30    
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    127   4e-30    Solanum lycopersicum
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    127   5e-30    Setaria italica
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    127   8e-30    Nicotiana tomentosiformis
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             127   8e-30    Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                                126   1e-29    Eutrema halophilum
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    127   1e-29    Sesamum indicum [beniseed]
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    125   2e-29    Arabis alpina [alpine rockcress]
gb|AES90666.2|  phototropic-responsive NPH3 family protein              125   2e-29    Medicago truncatula
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             125   2e-29    Phaseolus vulgaris [French bean]
gb|KDP32052.1|  hypothetical protein JCGZ_12513                         125   2e-29    Jatropha curcas
gb|AAU05485.1|  At5g67385                                               125   3e-29    Arabidopsis thaliana [mouse-ear cress]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              125   3e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484509.1|  PREDICTED: BTB/POZ domain-containing protein...    124   4e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-29    Elaeis guineensis
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                124   9e-29    Erythranthe guttata [common monkey flower]
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    123   1e-28    Brassica rapa
emb|CBI33715.3|  unnamed protein product                                122   2e-28    Vitis vinifera
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    122   2e-28    Camelina sativa [gold-of-pleasure]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600          122   3e-28    Amborella trichopoda
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    122   3e-28    Solanum tuberosum [potatoes]
gb|KJB43883.1|  hypothetical protein B456_007G221600                    120   4e-28    Gossypium raimondii
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-28    Nicotiana sylvestris
gb|KJB43882.1|  hypothetical protein B456_007G221600                    120   6e-28    Gossypium raimondii
ref|XP_006290338.1|  hypothetical protein CARUB_v10016995mg             120   6e-28    
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...    120   9e-28    Camelina sativa [gold-of-pleasure]
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             121   1e-27    Capsella rubella
ref|XP_002866705.1|  signal transducer                                  121   1e-27    Arabidopsis lyrata subsp. lyrata
gb|AAV50010.1|  phototropic response-like protein                       113   1e-27    Malus domestica [apple tree]
gb|KJB43880.1|  hypothetical protein B456_007G221600                    120   1e-27    Gossypium raimondii
ref|XP_001769248.1|  predicted protein                                  120   2e-27    
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    Brachypodium distachyon [annual false brome]
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    119   4e-27    Brassica rapa
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    119   4e-27    Oryza brachyantha
gb|EEE59569.1|  hypothetical protein OsJ_11863                          117   7e-27    Oryza sativa Japonica Group [Japonica rice]
gb|ABR25380.1|  transposon protein                                      115   9e-27    Oryza sativa Indica Group [Indian rice]
dbj|BAF95168.1|  similar to ROOT PHOTOTROPISM2 protein binding          109   1e-26    Ipomoea nil [qian niu]
ref|XP_010687037.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-26    Beta vulgaris subsp. vulgaris [field beet]
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...    117   2e-26    Oryza sativa Japonica Group [Japonica rice]
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...    118   2e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    117   2e-26    Fragaria vesca subsp. vesca
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...    118   2e-26    
gb|AAT85278.1|  NPH3 family protein                                     117   2e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...    117   2e-26    Brachypodium distachyon [annual false brome]
ref|XP_010679605.1|  PREDICTED: BTB/POZ domain-containing protein...    116   3e-26    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY57436.1|  BnaAnng14510D                                          117   3e-26    Brassica napus [oilseed rape]
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    116   4e-26    
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459    118   4e-26    
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    Glycine max [soybeans]
ref|XP_011096666.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    Sesamum indicum [beniseed]
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26    Fragaria vesca subsp. vesca
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26    Fragaria vesca subsp. vesca
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26    
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    Fragaria vesca subsp. vesca
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          116   6e-26    
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    Malus domestica [apple tree]
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...    116   7e-26    Pyrus x bretschneideri [bai li]
ref|XP_010234279.1|  PREDICTED: BTB/POZ domain-containing protein...    115   7e-26    Brachypodium distachyon [annual false brome]
ref|XP_001763717.1|  predicted protein                                  115   7e-26    
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             115   1e-25    Phaseolus vulgaris [French bean]
ref|XP_009410501.1|  PREDICTED: BTB/POZ domain-containing protein...    114   1e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573346.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    Brachypodium distachyon [annual false brome]
gb|EEC82855.1|  hypothetical protein OsI_27703                          115   2e-25    Oryza sativa Indica Group [Indian rice]
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         115   2e-25    Jatropha curcas
ref|NP_001060924.1|  Os08g0130600                                       115   2e-25    
ref|XP_004134651.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    Cucumis sativus [cucumbers]
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             114   2e-25    Prunus persica
gb|KJB26098.1|  hypothetical protein B456_004G225600                    114   3e-25    Gossypium raimondii
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             114   3e-25    Eutrema salsugineum [saltwater cress]
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680          114   3e-25    Sorghum bicolor [broomcorn]
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    114   3e-25    Malus domestica [apple tree]
ref|XP_008439559.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    
ref|XP_006653803.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    Oryza brachyantha
emb|CDY12841.1|  BnaC07g15920D                                          114   4e-25    Brassica napus [oilseed rape]
ref|XP_003533834.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    Glycine max [soybeans]
ref|XP_011089989.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    Sesamum indicum [beniseed]
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    Elaeis guineensis
ref|XP_006659093.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    Oryza brachyantha
ref|XP_001770455.1|  predicted protein                                  114   5e-25    
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    113   5e-25    Prunus mume [ume]
gb|ADZ04641.1|  hypothetical protein                                    113   6e-25    Oryza punctata
ref|NP_001168297.1|  putative phototropic-resoponsive NPH3 family...    113   6e-25    
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...    113   6e-25    
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    113   6e-25    
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800          113   6e-25    
gb|KJB35735.1|  hypothetical protein B456_006G125900                    113   7e-25    
gb|KHG15697.1|  hypothetical protein F383_22812                         113   8e-25    
ref|XP_004488271.1|  PREDICTED: BTB/POZ domain-containing protein...    113   8e-25    
ref|XP_003595495.1|  BTB/POZ domain-containing protein                  113   9e-25    
ref|XP_009399039.1|  PREDICTED: BTB/POZ domain-containing protein...    113   9e-25    
ref|XP_007138529.1|  hypothetical protein PHAVU_009G216900g             113   1e-24    
ref|XP_010275929.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_010275928.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
gb|KHN41442.1|  BTB/POZ domain-containing protein                       112   1e-24    
ref|XP_008784787.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_007015158.1|  BZIP domain class transcription factor             112   1e-24    
ref|XP_010275927.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
dbj|BAJ87289.1|  predicted protein                                      111   1e-24    
ref|XP_002526612.1|  Root phototropism protein, putative                112   1e-24    
ref|XP_002521098.1|  protein binding protein, putative                  112   1e-24    
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_003546563.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
gb|EMT21744.1|  BTB/POZ domain-containing protein                       112   2e-24    
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             112   2e-24    
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_010520662.1|  PREDICTED: putative BTB/POZ domain-containin...    109   2e-24    
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g             110   2e-24    
ref|XP_011015340.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_010241171.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    112   2e-24    
ref|XP_002317350.2|  hypothetical protein POPTR_0011s09340g             111   2e-24    
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...    111   2e-24    
ref|XP_010922793.1|  PREDICTED: BTB/POZ domain-containing protein...    111   3e-24    
ref|XP_010941534.1|  PREDICTED: BTB/POZ domain-containing protein...    111   3e-24    
ref|XP_010941535.1|  PREDICTED: BTB/POZ domain-containing protein...    111   3e-24    
emb|CDP05630.1|  unnamed protein product                                111   3e-24    
gb|EPS73600.1|  hypothetical protein M569_01153                         111   3e-24    
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             111   3e-24    
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    111   4e-24    
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg             111   4e-24    
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...    111   4e-24    
ref|XP_009593550.1|  PREDICTED: BTB/POZ domain-containing protein...    111   4e-24    
ref|XP_009763589.1|  PREDICTED: BTB/POZ domain-containing protein...    111   4e-24    
ref|XP_004978267.1|  PREDICTED: BTB/POZ domain-containing protein...    110   5e-24    
ref|XP_010486408.1|  PREDICTED: putative BTB/POZ domain-containin...    110   5e-24    
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    110   5e-24    
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             110   5e-24    
ref|XP_010027852.1|  PREDICTED: putative BTB/POZ domain-containin...    110   6e-24    
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...    110   6e-24    
gb|KHG21232.1|  hypothetical protein F383_08117                         110   8e-24    
emb|CDX90249.1|  BnaA08g17350D                                          110   8e-24    
ref|XP_011469652.1|  PREDICTED: BTB/POZ domain-containing protein...    110   8e-24    
gb|AFO63285.1|  bZIP6                                                   110   8e-24    
emb|CDY09586.1|  BnaC05g23330D                                          110   1e-23    
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         110   1e-23    
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    109   1e-23    
gb|EMT33147.1|  BTB/POZ domain-containing protein                       109   1e-23    
ref|XP_010100164.1|  BTB/POZ domain-containing protein                  109   1e-23    
gb|EMT33625.1|  BTB/POZ domain-containing protein                       109   1e-23    
ref|XP_010683440.1|  PREDICTED: BTB/POZ domain-containing protein...    109   1e-23    
ref|XP_003579359.1|  PREDICTED: BTB/POZ domain-containing protein...    109   1e-23    
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    109   2e-23    
ref|XP_006349069.1|  PREDICTED: BTB/POZ domain-containing protein...    108   2e-23    
ref|XP_002445002.1|  hypothetical protein SORBIDRAFT_07g002590          109   2e-23    
emb|CDY27653.1|  BnaUnng00030D                                          109   2e-23    
dbj|BAK04900.1|  predicted protein                                      109   2e-23    
ref|NP_001130370.1|  putative phototropic-resoponsive NPH3 family...    109   2e-23    
ref|XP_010056964.1|  PREDICTED: BTB/POZ domain-containing protein...    109   2e-23    
ref|NP_187478.1|  phototropic-responsive NPH3 family protein            108   2e-23    
ref|XP_002447182.1|  hypothetical protein SORBIDRAFT_06g030040          108   2e-23    
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg             108   3e-23    
gb|KDO75322.1|  hypothetical protein CISIN_1g006764mg                   108   3e-23    
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23    
emb|CAN72130.1|  hypothetical protein VITISV_002335                     108   3e-23    
ref|XP_009406573.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23    
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              108   3e-23    
ref|XP_009140160.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23    
gb|KJB42465.1|  hypothetical protein B456_007G154300                    108   3e-23    
ref|XP_009140161.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23    
gb|KHG00255.1|  hypothetical protein F383_19997                         108   4e-23    
ref|XP_009757420.1|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
gb|EMT10715.1|  BTB/POZ domain-containing protein                       109   4e-23    
ref|XP_006349068.1|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g             108   4e-23    
ref|XP_009397397.1|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
gb|AAO16690.1|  hypothetical protein-like protein                       108   4e-23    
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
gb|ADV56692.1|  NPH3 family protein                                     108   4e-23    
ref|XP_010032181.1|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    108   4e-23    
ref|XP_010110255.1|  BTB/POZ domain-containing protein                  108   4e-23    
ref|XP_009397396.1|  PREDICTED: BTB/POZ domain-containing protein...    108   5e-23    
ref|NP_001131511.1|  uncharacterized protein LOC100192849               106   5e-23    
ref|XP_004251006.1|  PREDICTED: BTB/POZ domain-containing protein...    108   5e-23    
gb|KHN13450.1|  BTB/POZ domain-containing protein                       108   5e-23    
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...    107   5e-23    
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    108   5e-23    
ref|XP_006359095.1|  PREDICTED: BTB/POZ domain-containing protein...    108   5e-23    
ref|XP_009109587.1|  PREDICTED: BTB/POZ domain-containing protein...    108   5e-23    
ref|NP_001266239.1|  Hop-interacting protein THI063                     107   5e-23    
ref|XP_002312014.2|  hypothetical protein POPTR_0008s03850g             107   5e-23    
ref|XP_011046734.1|  PREDICTED: BTB/POZ domain-containing protein...    107   6e-23    
ref|XP_002298828.2|  phototropic-responsive NPH3 family protein         107   6e-23    
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    107   6e-23    
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    107   6e-23    
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...    107   6e-23    
ref|XP_006577128.1|  PREDICTED: BTB/POZ domain-containing protein...    106   7e-23    
gb|KJB55402.1|  hypothetical protein B456_009G074400                    107   7e-23    
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  107   7e-23    
gb|KDO46252.1|  hypothetical protein CISIN_1g0470461mg                  106   8e-23    
emb|CDP03873.1|  unnamed protein product                                107   8e-23    
gb|KJB55404.1|  hypothetical protein B456_009G074400                    107   9e-23    
ref|XP_004156559.1|  PREDICTED: putative BTB/POZ domain-containin...    107   9e-23    
gb|KJB55403.1|  hypothetical protein B456_009G074400                    107   9e-23    
ref|XP_004137290.1|  PREDICTED: putative BTB/POZ domain-containin...    107   9e-23    
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...    107   9e-23    
gb|KDP29118.1|  hypothetical protein JCGZ_16507                         107   9e-23    
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22    
gb|KFK44855.1|  hypothetical protein AALP_AA1G311200                    107   1e-22    
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                   106   1e-22    
ref|XP_006436442.1|  hypothetical protein CICLE_v10031240mg             106   1e-22    
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22    
ref|XP_010098595.1|  BTB/POZ domain-containing protein                  107   1e-22    
gb|KEH38919.1|  phototropic-responsive NPH3 family protein              107   1e-22    
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             107   1e-22    
ref|XP_010499573.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22    
ref|XP_011090549.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22    
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22    
gb|KGN58361.1|  hypothetical protein Csa_3G627720                       106   1e-22    
ref|NP_196864.1|  phototropic-responsive NPH3 family protein            106   1e-22    
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  106   1e-22    
ref|XP_006415473.1|  hypothetical protein EUTSA_v10007010mg             107   1e-22    
ref|XP_008794467.1|  PREDICTED: BTB/POZ domain-containing protein...    105   1e-22    
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    106   1e-22    
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    106   1e-22    
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_010244572.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_010543146.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
gb|KHN28223.1|  BTB/POZ domain-containing protein                       106   2e-22    
ref|XP_002890870.1|  phototropic-responsive NPH3 family protein         106   2e-22    
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|NP_001054018.1|  Os04g0636500                                       106   2e-22    
gb|EEC78096.1|  hypothetical protein OsI_17587                          106   2e-22    
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             106   2e-22    
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_007159657.1|  hypothetical protein PHAVU_002G256200g             106   2e-22    
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
gb|EYU19133.1|  hypothetical protein MIMGU_mgv1a004464mg                105   2e-22    
ref|XP_006602728.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_002877714.1|  predicted protein                                  105   2e-22    
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
emb|CBI17097.3|  unnamed protein product                                106   2e-22    
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_010478425.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_003632267.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    105   2e-22    
ref|XP_006485653.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22    
gb|KDP21845.1|  hypothetical protein JCGZ_00632                         105   2e-22    
ref|XP_004246916.1|  PREDICTED: BTB/POZ domain-containing protein...    105   2e-22    
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    105   2e-22    
gb|KHF98556.1|  hypothetical protein F383_12747                         106   2e-22    
ref|XP_008647352.1|  PREDICTED: uncharacterized protein LOC100192...    106   2e-22    
ref|XP_009338091.1|  PREDICTED: putative BTB/POZ domain-containin...    106   2e-22    
ref|XP_010558762.1|  PREDICTED: putative BTB/POZ domain-containin...    105   2e-22    
ref|XP_009622877.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
gb|ACN35855.1|  unknown                                                 106   3e-22    
gb|AFW74482.1|  putative phototropic-responsive NPH3 family protein     106   3e-22    
ref|XP_008794466.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
ref|XP_007204975.1|  hypothetical protein PRUPE_ppa002796mg             105   3e-22    
ref|XP_008647351.1|  PREDICTED: uncharacterized protein LOC100192...    105   3e-22    
gb|KDP44378.1|  hypothetical protein JCGZ_20058                         105   3e-22    
ref|NP_174332.1|  phototropic-responsive NPH3-like protein              105   3e-22    
gb|AAF19742.1|AC009917_1  Contains a bZIP transcription factor PF...    105   3e-22    
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
ref|XP_008228112.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
gb|KEH43247.1|  phototropic-responsive NPH3 family protein              105   3e-22    
ref|XP_006306918.1|  hypothetical protein CARUB_v10008482mg             105   3e-22    
emb|CAN78287.1|  hypothetical protein VITISV_008137                     105   3e-22    
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         105   3e-22    
gb|KHN43539.1|  BTB/POZ domain-containing protein                       105   3e-22    
ref|XP_010492128.1|  PREDICTED: putative BTB/POZ domain-containin...    105   3e-22    
gb|ACA64834.1|  SKIP interacting protein 17                             105   3e-22    
gb|ADN33739.1|  phototropic-responsive NPH3 family protein              105   3e-22    
ref|XP_006306917.1|  hypothetical protein CARUB_v10008482mg             105   3e-22    
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg                105   3e-22    
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230          105   3e-22    
ref|XP_010460834.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22    
gb|ABA99392.2|  transposon protein, putative, Mutator sub-class, ...    105   4e-22    
emb|CDY02293.1|  BnaA09g26090D                                          105   4e-22    
gb|ABR17518.1|  unknown                                                 105   4e-22    
emb|CDX84515.1|  BnaC03g49850D                                          105   4e-22    
ref|XP_001764279.1|  predicted protein                                  105   4e-22    
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    105   4e-22    
ref|XP_011033589.1|  PREDICTED: BTB/POZ domain-containing protein...    104   4e-22    
ref|XP_008455672.1|  PREDICTED: putative BTB/POZ domain-containin...    105   4e-22    
ref|XP_010067313.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22    
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22    
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22    
ref|XP_010931398.1|  PREDICTED: BTB/POZ domain-containing protein...    104   4e-22    
ref|XP_007009861.1|  Phototropic-responsive NPH3 family protein         105   4e-22    
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22    
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750          105   4e-22    
gb|KHG06087.1|  hypothetical protein F383_05585                         105   5e-22    
gb|KJB27631.1|  hypothetical protein B456_005G002800                    105   5e-22    
ref|XP_009337391.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
ref|XP_008233313.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...    105   5e-22    
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g             105   5e-22    
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    105   5e-22    
ref|XP_009337389.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
ref|XP_009115147.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22    
gb|KFK38267.1|  hypothetical protein AALP_AA3G091600                    104   5e-22    
dbj|BAK06168.1|  predicted protein                                      105   6e-22    
gb|AEP03595.1|  NPH3 family domain-like protein                         104   6e-22    



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   329 bits (844),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 181/206 (88%), Gaps = 8/206 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ ELSISKFNGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  366  GEIATYGELSISKFNGIANLVPKTARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  425

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D K TP+A+ TRNQLQAD +LV
Sbjct  426  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDHK-TPDALTTRNQLQADTSLV  484

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I D+Q        S   +S  + +KPTFFSS+SK LGKLNPFKH
Sbjct  485  KENEALRTELLKMKMYIQDIQK-------SQGTTSKGSAKKPTFFSSVSKTLGKLNPFKH  537

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTSN+DDG VD+TKPRRRRFSIS
Sbjct  538  GSKDTSNIDDGMVDLTKPRRRRFSIS  563



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDP
Sbjct  330  AEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDP  389

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LV
Sbjct  390  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLV  449

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+H
Sbjct  450  KENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRH  505

Query  202  GSKDTSNLDDG-EVDITKPRRRRFSIS  125
            GSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  506  GSKDTSHIDDNLGVDVTKPRRRRFSIS  532



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDP
Sbjct  356  AEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDP  415

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LV
Sbjct  416  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLV  475

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+H
Sbjct  476  KENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRH  531

Query  202  GSKDTSNLDDG-EVDITKPRRRRFSIS  125
            GSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  532  GSKDTSHIDDNLGVDVTKPRRRRFSIS  558



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +L+I+KFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  373  GEIATFGDLTIAKFNGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDT  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P+A+ATRNQLQADV+LV
Sbjct  433  LKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPDAMATRNQLQADVSLV  492

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKH
Sbjct  493  KENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKH  548

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS +DD  VDITKPRRRRFSIS
Sbjct  549  GSKDTSMIDDATVDITKPRRRRFSIS  574



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 178/207 (86%), Gaps = 5/207 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDP
Sbjct  372  AEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LV
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLV  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+H
Sbjct  492  KENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRH  547

Query  202  GSKDTSNLDDG-EVDITKPRRRRFSIS  125
            GSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  548  GSKDTSHIDDNLGVDVTKPRRRRFSIS  574



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 176/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +L+I+KFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  374  GEIATFGDLTIAKFNGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDT  433

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P A+ATRNQLQADV+LV
Sbjct  434  LKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPEAMATRNQLQADVSLV  493

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKH
Sbjct  494  KENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKH  549

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS +DD  VDITKPRRRRFSIS
Sbjct  550  GSKDTSMIDDATVDITKPRRRRFSIS  575



>ref|XP_006432049.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45289.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=382

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 177/209 (85%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDP
Sbjct  174  GEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDP  233

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+
Sbjct  234  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLI  293

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFK
Sbjct  294  KENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFK  353

Query  205  HGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            HGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  354  HGSKDTSNIDDDVAAMDGTKPRRRRFSIS  382



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  E SISKFNGIA LV K ARKVDDD+YRA+DIYLKAHP LDEIEREKVCSVMDP
Sbjct  373  GEIATFSEFSISKFNGIAILVPKAARKVDDDVYRAVDIYLKAHPNLDEIEREKVCSVMDP  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ED K  PNAI TR QLQAD +L 
Sbjct  433  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTEDQK-MPNAITTRRQLQADTSLA  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LRTELL+MKM+IAD+Q            ++A++ ++PTFFSSMSK LGKLNPFKH
Sbjct  492  RENEELRTELLKMKMYIADLQK----TQGPSTKATAASSKRPTFFSSMSKTLGKLNPFKH  547

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTSNLDD  VDI+KPRRRRFSIS
Sbjct  548  GSKDTSNLDDALVDISKPRRRRFSIS  573



>emb|CBI15802.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 7/207 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDP
Sbjct  13   GEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDP  72

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV
Sbjct  73   LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLV  129

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKLNPF+H
Sbjct  130  RENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKLNPFRH  186

Query  202  GSKDTSNLDD-GEVDITKPRRRRFSIS  125
            GSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  187  GSKDTSNIDDETAVDVTKPRRRRFSIS  213



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 177/209 (85%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDP
Sbjct  333  GEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDP  392

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+
Sbjct  393  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLI  452

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFK
Sbjct  453  KENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFK  512

Query  205  HGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            HGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  513  HGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 179/214 (84%), Gaps = 8/214 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ EL ISKFNGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  369  GEIATYGELGISKFNGIANLVPKAARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVTL  386
            LKLSYEARVHASQNKRLPVQIVLHALYYDQL +RSGA ED   TP+A +TRNQLQADV+L
Sbjct  429  LKLSYEARVHASQNKRLPVQIVLHALYYDQLMLRSGADEDDHKTPDAGSTRNQLQADVSL  488

Query  385  VKENEALRTELLQMKMFIADMQN-------kgssqgssvkgssasaVRKPTFFSSMSKKL  227
             KENEALRTELL+MKM+I D+Q          S+  S+   +SAS  RKP FFSSMSK L
Sbjct  489  AKENEALRTELLKMKMYIQDIQRPQGTTSKAVSTSTSTSASASASTSRKPKFFSSMSKTL  548

Query  226  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            GKLNPFKHGSKDT NLD+G  D+TKPRRRRFSIS
Sbjct  549  GKLNPFKHGSKDTLNLDEGMPDLTKPRRRRFSIS  582



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 175/206 (85%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ +L+ISKFNGIA LV K ARKVDDDLYRAIDIYLKAH  LDEIEREKVCSVMDP
Sbjct  372  GEIATYEDLAISKFNGIATLVPKTARKVDDDLYRAIDIYLKAHQNLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D + T +A+ TRNQ+QADV+L+
Sbjct  432  HKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVIDDRKTQDALMTRNQIQADVSLI  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+MKM+I+D+Q       +    S +   RKPTFFSS+SK LGKLNPF+H
Sbjct  492  KENEALRTELLKMKMYISDLQK------NQGTSSKSGGSRKPTFFSSVSKTLGKLNPFRH  545

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTSN+DD  +D+TKPRRRRFS+S
Sbjct  546  GSKDTSNIDDSAIDLTKPRRRRFSVS  571



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 177/209 (85%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDP
Sbjct  376  GEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDP  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+
Sbjct  436  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLI  495

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFK
Sbjct  496  KENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFK  555

Query  205  HGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            HGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  556  HGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 176/209 (84%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDP
Sbjct  333  GEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDP  392

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+
Sbjct  393  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLI  452

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFK
Sbjct  453  KENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFK  512

Query  205  HGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            HGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  513  HGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 176/209 (84%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDP
Sbjct  376  GEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDP  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+
Sbjct  436  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLI  495

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFK
Sbjct  496  KENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFK  555

Query  205  HGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            HGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  556  HGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 177/209 (85%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  EL+I+KFNGIA LV KGARKV+DDLYRAIDIYLKAHP LDEIEREKVCS MDP
Sbjct  372  GEIATVDELTIAKFNGIAILVPKGARKVEDDLYRAIDIYLKAHPNLDEIEREKVCSSMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTPNAIATRNQLQADVT  389
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA D   ++  +A+ATRNQLQADV+
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGAVDDRERNAADAVATRNQLQADVS  491

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            LVKENEALR+EL +MKM+I+D+Q             SA+  RKPTFFSSMSK LGKLNPF
Sbjct  492  LVKENEALRSELKKMKMYISDLQK----NNQGTCSKSAAGNRKPTFFSSMSKTLGKLNPF  547

Query  208  KHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            +HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  548  RHGSKDTSNIDDSLGVDVTKPRRRRFSIS  576



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 178/209 (85%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +LSISKFNGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVCSVMDP
Sbjct  372  GEIATFGDLSISKFNGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQLQADVT  389
            LKLS+EARVHASQNKRLPVQIVLHALY+DQLK+RSGA D  +   P A+ATRNQLQADV+
Sbjct  432  LKLSHEARVHASQNKRLPVQIVLHALYFDQLKLRSGAADDTNNNMPEAMATRNQLQADVS  491

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            LVKENE LRTELL+MKM+IAD+Q       +S +G+S   ++K TFFSS+SK LGK NPF
Sbjct  492  LVKENEVLRTELLKMKMYIADIQK----TTTSTQGTSKGGLKKTTFFSSVSKTLGKFNPF  547

Query  208  KHGSKDTSNL-DDGEVDITKPRRRRFSIS  125
            KHGSKDTSN+ DD  +D+TKPRRRRFSIS
Sbjct  548  KHGSKDTSNIVDDAALDLTKPRRRRFSIS  576



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 7/207 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDP
Sbjct  327  GEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDP  386

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV
Sbjct  387  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLV  443

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKLNPF+H
Sbjct  444  RENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKLNPFRH  500

Query  202  GSKDTSNLDD-GEVDITKPRRRRFSIS  125
            GSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  501  GSKDTSNIDDETAVDVTKPRRRRFSIS  527



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 181/208 (87%), Gaps = 5/208 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ EL+ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  370  GEIATYPELTISKFNGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  429

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV
Sbjct  430  LKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLV  486

Query  382  KENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
             ENEALR+EL +MK++I++MQ NKGSS  S    ++ S  RK TFFSSMSK LGKLNPFK
Sbjct  487  SENEALRSELKKMKLYISEMQKNKGSSAKSISAAAATSGPRKHTFFSSMSKTLGKLNPFK  546

Query  205  HGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            HGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  547  HGSKDTSHIDDNLAVDITKPRRRRFSVS  574



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 179/209 (86%), Gaps = 6/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ EL+ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDE+EREKVCSVMDP
Sbjct  370  GEIATYPELTISKFNGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEMEREKVCSVMDP  429

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPVQIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV
Sbjct  430  LKLSYEARLHASQNKRLPVQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLV  486

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV--RKPTFFSSMSKKLGKLNPF  209
             ENEALR+EL +MK++I+DMQ    S   S+  ++A+    RK TFFSSMSK LGKLNPF
Sbjct  487  SENEALRSELTKMKLYISDMQKDKGSSAKSISAAAATTSGPRKHTFFSSMSKTLGKLNPF  546

Query  208  KHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            KHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  547  KHGSKDTSHIDDNIAVDITKPRRRRFSVS  575



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 179/209 (86%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +LSISKFNGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVCSVMDP
Sbjct  372  GEIATFGDLSISKFNGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQLQADVT  389
            LKLS+EARVHASQNKRLPVQIVLHALY+DQLKIRSGA D  +   P A+ATRNQLQADV+
Sbjct  432  LKLSHEARVHASQNKRLPVQIVLHALYFDQLKIRSGAADDSNNNMPEAMATRNQLQADVS  491

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            LVKENE LRTELL+MKM+IAD+Q       +S +G+S  +++K TFFSS+SK LGK NPF
Sbjct  492  LVKENEVLRTELLKMKMYIADIQK----TTNSSQGTSKGSLKKTTFFSSVSKTLGKFNPF  547

Query  208  KHGSKDTSNL-DDGEVDITKPRRRRFSIS  125
            KHGSKDTS++ DD  +D+TKPRRRRFSIS
Sbjct  548  KHGSKDTSSIVDDAALDLTKPRRRRFSIS  576



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 7/207 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDP
Sbjct  372  GEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLV  488

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKLNPF+H
Sbjct  489  RENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKLNPFRH  545

Query  202  GSKDTSNLDD-GEVDITKPRRRRFSIS  125
            GSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  546  GSKDTSNIDDETAVDVTKPRRRRFSIS  572



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 7/208 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ E+ ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  373  GEIATYGEVGISKFNGIAILVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADVTL  386
            LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  +  +    ++ T+NQLQ DV+L
Sbjct  433  LKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVVESSTPETPVSNTKNQLQTDVSL  492

Query  385  VKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            ++ENEALR+EL +MK++I+DMQ       S+   S+ S  RKPTFFSSMSK LGKLNPFK
Sbjct  493  IRENEALRSELTKMKLYISDMQK-----NSNQGSSTKSGSRKPTFFSSMSKTLGKLNPFK  547

Query  205  HGSKDTSNLDDGE-VDITKPRRRRFSIS  125
            HGSKDTS+LDDG  +DITKPRRRRFSIS
Sbjct  548  HGSKDTSHLDDGAGIDITKPRRRRFSIS  575



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 3/206 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA ++EL+ISKFNGIANLV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  372  GEIAAYLELTISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D      A   R+QLQADV+LV
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVADDHDAKEAATARSQLQADVSLV  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENEALR EL +MK++I D+Q   + Q ++    +  + ++PTFFSS+SK LGKLNPFKH
Sbjct  492  RENEALRAELTKMKLYITDIQK--NGQTTATSSRAVGSTKRPTFFSSVSKTLGKLNPFKH  549

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS+++D  VDI+KPRRRRFSIS
Sbjct  550  GSKDTSHIED-VVDISKPRRRRFSIS  574



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  378  GEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADV  392
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV
Sbjct  438  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADV  497

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNP
Sbjct  498  SLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNP  554

Query  211  FKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  555  FRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  368  GEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  427

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADV  392
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV
Sbjct  428  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADV  487

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNP
Sbjct  488  SLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNP  544

Query  211  FKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  545  FRHGSKDTSNIDDG-IDITKPRRRRFSIS  572



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  378  GEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADV  392
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV
Sbjct  438  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADV  497

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNP
Sbjct  498  SLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNP  554

Query  211  FKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  555  FRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 174/209 (83%), Gaps = 9/209 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ EL ISKFNGIA LV KG+R VDDDLYRAIDIYLK+HP LDEIEREKVCSVMDP
Sbjct  347  GEIATYSELGISKFNGIAMLVPKGSRGVDDDLYRAIDIYLKSHPHLDEIEREKVCSVMDP  406

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--TRNQLQADVT  389
            LKLSYEAR+HASQNKRLPVQIVLH LY+DQLK+RSG  D +STP A+A  T++QLQ DV+
Sbjct  407  LKLSYEARLHASQNKRLPVQIVLHCLYFDQLKLRSGVAD-RSTPEAMAPNTKSQLQTDVS  465

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            L++ENEALR+EL++MK++I DMQ       S    S+    RK TFFSSMSK LGKLNPF
Sbjct  466  LIRENEALRSELMKMKLYITDMQK-----SSQGTTSARGGPRKTTFFSSMSKTLGKLNPF  520

Query  208  KHGSKDTSNLDDGE-VDITKPRRRRFSIS  125
            KHGSKDTS++DD   VDITKPRRRRFSIS
Sbjct  521  KHGSKDTSHIDDSAGVDITKPRRRRFSIS  549



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 171/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT VELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCVELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+++Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSRVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I DMQ    +   ++  G      +K TFFSS+SKKLGKLNPFK
Sbjct  491  RENEELRTELLKMKMYITDMQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  551  QGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 180/213 (85%), Gaps = 10/213 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ EL+ISKFNGI+ LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  370  GEIATYPELTISKFNGISTLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  429

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV
Sbjct  430  LKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLV  486

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV------RKPTFFSSMSKKLGK  221
             ENEALR+EL +MK++I++MQ    S   S+  ++A+A       RK TFFSSMSK LGK
Sbjct  487  SENEALRSELKKMKLYISEMQKNKGSSAKSISAAAAAAAAATSGPRKHTFFSSMSKTLGK  546

Query  220  LNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            LNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  547  LNPFKHGSKDTSHIDDNLAVDITKPRRRRFSVS  579



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 179/210 (85%), Gaps = 7/210 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ +L+ISKFNGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDP
Sbjct  389  GEIATYPDLTISKFNGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDP  448

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG +D    P+A+ATR+QLQ+DV+LV
Sbjct  449  LKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVDD---QPDAVATRSQLQSDVSLV  505

Query  382  KENEALRTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +ENEALR+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNP
Sbjct  506  RENEALRSELMKMKLYISDMQKNQGSSTKGIAAAAAPTTTGSRKHSFFSSMSKTLGKLNP  565

Query  211  FKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            FKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  566  FKHGSKDTLHINDNIGVDITKPRRRRFSIS  595



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   299 bits (766),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA +  LSISKFNGIANLV K AR+ DDDLYRAIDIYLKAHP LDEIEREKVCS MDP
Sbjct  381  GEIANYASLSISKFNGIANLVPKDARRTDDDLYRAIDIYLKAHPNLDEIEREKVCSSMDP  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQ+VLHALYYDQLK+RSGA D    P+AIATR Q++AD +L 
Sbjct  441  LKLSYEARVHASQNKRLPVQMVLHALYYDQLKLRSGAND-GPLPDAIATRGQVKADASLA  499

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEAL++EL++MKM+I+DMQ   ++   +   +      K TFFSSMSK LGKLNPFKH
Sbjct  500  KENEALKSELMKMKMYISDMQKNKATTSRTSTATGMP---KRTFFSSMSKTLGKLNPFKH  556

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS+LDD EVD+TKPRRRRFSIS
Sbjct  557  GSKDTSHLDD-EVDLTKPRRRRFSIS  581



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 179/210 (85%), Gaps = 5/210 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  373  GEIATCTELSISKFNGIAVLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDA  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG E+ ++  +A +TRNQ+QADV+L 
Sbjct  433  LKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGEEENETQIDAASTRNQVQADVSLA  492

Query  382  KENEALRTELLQMKMFIADMQN----kgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
            KENE LRTELL+MKM+I+D++      G+S  ++  G      RKPTFFSS+SKKLGKLN
Sbjct  493  KENEVLRTELLKMKMYISDIKKSGGGAGASAATTSSGKGGGGPRKPTFFSSVSKKLGKLN  552

Query  214  PFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            PFK+GSKDTSN+DD  VD+TKPRRRRFSIS
Sbjct  553  PFKNGSKDTSNIDDC-VDVTKPRRRRFSIS  581



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 171/212 (81%), Gaps = 6/212 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA  V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIAPCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++     +A+ TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENDMMQDAVTTRSQVQQDVSLA  491

Query  382  KENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGK  221
            +ENE+LRTELL+MKM+I D+Q             ++  G      RK TFFSS+SKKLGK
Sbjct  492  RENESLRTELLRMKMYITDLQKSGPAAKGSLGSATTSSGKGGGGPRKGTFFSSVSKKLGK  551

Query  220  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            LNPFK GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  552  LNPFKQGSKDTSNIMDEGVDITKPRRRRFSIS  583



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 178/210 (85%), Gaps = 7/210 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA++ +L+ISKFNGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDP
Sbjct  372  GEIASYPDLTISKFNGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  D    P+A+ATR+QLQ+DV+LV
Sbjct  432  LKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVND---QPDAVATRSQLQSDVSLV  488

Query  382  KENEALRTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +ENEALR+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNP
Sbjct  489  RENEALRSELMKMKLYISDMQKNQGSSTKGIAATAAPTTTGSRKHSFFSSMSKTLGKLNP  548

Query  211  FKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            FKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  549  FKHGSKDTFHINDNIGVDITKPRRRRFSIS  578



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 176/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDP
Sbjct  462  GEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDP  521

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADV  392
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV
Sbjct  522  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADV  581

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNP
Sbjct  582  SLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNP  638

Query  211  FKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  639  FRHGSKDTSNIDDG-IDITKPRRRRFSIS  666



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT VEL I KFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCVELGIPKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A+ TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAVTTRSQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK
Sbjct  491  RENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  551  QGSKDTSNIMDEGVDITKPRRRRFSIS  577



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 174/213 (82%), Gaps = 7/213 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLA  491

Query  382  KENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGK  221
            +ENE+LRTELL+MKM+I+D+Q             ++  G      RK TFFSS+SKKLGK
Sbjct  492  RENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGK  551

Query  220  LNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  125
            LNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  552  LNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 174/213 (82%), Gaps = 7/213 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLA  491

Query  382  KENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGK  221
            +ENE+LRTELL+MKM+I+D+Q             ++  G      RK TFFSS+SKKLGK
Sbjct  492  RENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGK  551

Query  220  LNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  125
            LNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  552  LNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT VELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCVELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGX-DENDVQDAITTRSQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MK +I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK
Sbjct  491  RENEELRTELLKMKXYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  551  XGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 173/206 (84%), Gaps = 7/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT+ E+SI+KFNGIA +V KGARKVDDDLYRAIDIYLK+HP LDEIEREK CS +DP
Sbjct  372  GEIATYSEVSITKFNGIATIVPKGARKVDDDLYRAIDIYLKSHPNLDEIEREKACSALDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLS EAR+HASQNKRLPVQIVLHALYYDQLK+RSG ED K  P+A+ TR+QLQAD +L+
Sbjct  432  LKLSPEARLHASQNKRLPVQIVLHALYYDQLKLRSGTEDHKG-PDAVTTRHQLQADSSLI  490

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENE LR+EL++MKM+I+D+Q       +    S+    ++ TFFSSMSK LGKLNPF+H
Sbjct  491  KENEDLRSELMKMKMYISDLQK-----TNHGTTSAKGGPKRHTFFSSMSKTLGKLNPFRH  545

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTSN++D  VDITKPR+RRFSIS
Sbjct  546  GSKDTSNIEDA-VDITKPRKRRFSIS  570



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVCSVMD 
Sbjct  372  GEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I D+   G ++  ++         +K  FFSSMSKKLG+LNPFK
Sbjct  491  RENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSSMSKKLGRLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  551  QGSKDTSNIMDEDVDITKPRRRRFSIS  577



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 176/214 (82%), Gaps = 13/214 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + +LSISKFNGIA L+ K ARK+DDDLYRA+DIYLKAHPQLDEIEREKVCSVMDP
Sbjct  308  SEIAAYGDLSISKFNGIATLIPKSARKIDDDLYRAVDIYLKAHPQLDEIEREKVCSVMDP  367

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTL  386
            LKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTL
Sbjct  368  LKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTL  422

Query  385  VKENEALRTELLQMKMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSSMSKKL  227
            V+ENE LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+SK L
Sbjct  423  VRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVSKTL  482

Query  226  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            GKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  483  GKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  516



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVCSVMD 
Sbjct  372  GEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG E+     +A  TR Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVEE-NDVQDATMTRRQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I D+Q  G +   ++         +K TFFSS+SKKLG+LNPFK
Sbjct  491  RENEELRTELLKMKMYITDLQKTGPAGVATTSSCKGGGGPKKATFFSSVSKKLGRLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDT N+ D +VD+TKPRRRRFSIS
Sbjct  551  QGSKDTMNIVDEDVDLTKPRRRRFSIS  577



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 168/207 (81%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD 
Sbjct  372  GEIATCXELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNK  PVQIVLHALYYDQLK+RSG  +     +AI TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKTTPVQIVLHALYYDQLKLRSGXXE-NDVQDAITTRSQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK
Sbjct  491  RENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  551  XGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 174/216 (81%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP---TFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   +  G+S   SS+    K    TFFSS+SKKL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSNKKSKNTFFSSVSKKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFKHGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  558  GKLNPFKHGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ KG+RK DDDLYRA+DIYLK HP LDEIE+EKVCSV+DP
Sbjct  376  AEIAAYGELSISKFNGIAILIPKGSRKSDDDLYRAVDIYLKVHPNLDEIEKEKVCSVLDP  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHAS+NKRLP+QIVLHALYYDQL IRSG  + K    A+A + QLQADV+LV
Sbjct  436  LKLSYEARVHASKNKRLPLQIVLHALYYDQLHIRSGTAEEK-VALAVAEKKQLQADVSLV  494

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL++MKMFI+DMQ       SS    +    +KPTFFSSMSKKL KLNPFK+
Sbjct  495  RENEELRSELMKMKMFISDMQK-HGHGTSSSGRENIGLAKKPTFFSSMSKKLSKLNPFKN  553

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  554  GSKDTSHIDDAPVDLTKPRRRRFSIS  579



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 166/207 (80%), Gaps = 5/207 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ ELSISKFNGIANLV K ARKVDDDLYRA+DI+LK+HP LDEIEREKVCS +DP
Sbjct  373  AEIATYGELSISKFNGIANLVPKSARKVDDDLYRAVDIFLKSHPNLDEIEREKVCSSIDP  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +  P  +A R QLQ DV+L 
Sbjct  433  LKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEE-RDAPEGLAIRGQLQTDVSLA  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTEL +MKM+I+DMQ        +   S  S     TFFSS+SK LGKLNPF+ 
Sbjct  492  KENEALRTELTKMKMYISDMQKNQGGGVGASSSSKKSKH---TFFSSVSKTLGKLNPFRQ  548

Query  202  GSKDTSNLDD-GEVDITKPRRRRFSIS  125
            GSKDT NLDD G VDITKPRRRRFSIS
Sbjct  549  GSKDTLNLDDAGGVDITKPRRRRFSIS  575



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 167/207 (81%), Gaps = 6/207 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ ELSI KFNG ANLV K ARKVDDDLYRA+DIYLKAHP LDEIEREK CS MDP
Sbjct  371  AEIATYGELSIPKFNGFANLVPKAARKVDDDLYRAVDIYLKAHPNLDEIEREKACSSMDP  430

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEAR+HASQNKRLPV IVLHALYYD LK+RSG ED +  P A+  R QLQ DV+L 
Sbjct  431  LKLSYEARLHASQNKRLPVNIVLHALYYDNLKLRSGKED-RDVPEAMEIRGQLQKDVSLE  489

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTEL++MKM+++DMQ    S G+S     +    K TFFSS+SK LGKLNPF+H
Sbjct  490  KENEALRTELMKMKMYVSDMQKNQGSVGASSLSKKS----KYTFFSSVSKTLGKLNPFRH  545

Query  202  GSKDTSNLDDGE-VDITKPRRRRFSIS  125
            G+KDTSN+DD   VDITKPRRRRFSIS
Sbjct  546  GAKDTSNIDDDSGVDITKPRRRRFSIS  572



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 178/210 (85%), Gaps = 9/210 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA H +L+ISKFNGIA LV K ARKVDDD+YRA+DIYLKAHP+LDEIEREKVCSVMDP
Sbjct  369  AEIAAHGDLNISKFNGIAILVPKSARKVDDDIYRAVDIYLKAHPKLDEIEREKVCSVMDP  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTL  386
            LKLSYEAR+HASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +N+L  DV+L
Sbjct  429  LKLSYEARLHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNELHMDVSL  483

Query  385  VKENEALRTELLQMKMFIADMQNkgssqgssv---kgssasaVRKPTFFSSMSKKLGKLN  215
            V+ENE LRTELL+MKM+I+DMQNK  +   S      +S+ + +K TFFSS+SK LG+LN
Sbjct  484  VRENEELRTELLKMKMYISDMQNKNVNNAESTHGNGTTSSGSTKKATFFSSVSKTLGRLN  543

Query  214  PFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            PF++GSKDT++L+DG VD++KPRRRRFS+S
Sbjct  544  PFRNGSKDTTHLEDGNVDLSKPRRRRFSMS  573



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLK+HP LDEIE+EKVCSVMD 
Sbjct  372  GEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKSHPNLDEIEKEKVCSVMDA  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L 
Sbjct  432  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLA  490

Query  382  KENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  206
            +ENE LRTELL+MKM+I D+   G ++  ++         +K  FFS +SKKLG+LNPFK
Sbjct  491  RENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSYVSKKLGRLNPFK  550

Query  205  HGSKDTSNLDDGEVDITKPRRRRFSIS  125
             GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  551  QGSKDTSNIVDEDVDITKPRRRRFSIS  577



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             +IA + +LSISKFNGIA LV K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVCSVMDP
Sbjct  369  SKIAAYGDLSISKFNGIAILVPKNARKVDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDP  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+    P     +NQLQ DV+LV
Sbjct  429  LKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERDVEPE----KNQLQMDVSLV  484

Query  382  KENEALRTELLQMKMFIADMQNkgs---sqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +ENE LRTEL++MKM+I+D+QNK +   +       +S++  +K TFFSS+SK LGKLNP
Sbjct  485  RENEELRTELMKMKMYISDLQNKNTNNDANPQVHGTTSSATPKKATFFSSVSKTLGKLNP  544

Query  211  FKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F++GSKDT++L+D  VD+TKPRRRRFS+S
Sbjct  545  FRNGSKDTTHLEDASVDLTKPRRRRFSMS  573



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 175/218 (80%), Gaps = 12/218 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQ  401
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQ
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEHEERAVVVNLPEALKTRSQLQ  497

Query  400  ADVTLVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSK  233
            AD TL KENEALR+EL++MKM+++DMQ      G+S  +S    S +   K TFFSS+SK
Sbjct  498  ADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNKKSKHTFFSSVSK  557

Query  232  KLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            KLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  558  KLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ KGARK DDDLYRA+DIYLK HP LDEIE+EKVCSV+D 
Sbjct  376  AEIAAYAELSISKFNGIAILIPKGARKSDDDLYRAVDIYLKVHPNLDEIEKEKVCSVLDT  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHAS+NKRLP+QIVLHALYYDQL+IRSG    K    A A + QLQADV+LV
Sbjct  436  LKLSYEARVHASKNKRLPLQIVLHALYYDQLQIRSGTAADKQAVVAAAEKKQLQADVSLV  495

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL++MKMFI+D+Q       SS    +    +KPTFFSSMSKKL KLNPFK+
Sbjct  496  RENEELRSELMKMKMFISDLQK-NVHGTSSSGRENIGPTKKPTFFSSMSKKLSKLNPFKN  554

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS++DD  VD+TKPR+RRFSIS
Sbjct  555  GSKDTSHIDDAPVDLTKPRKRRFSIS  580



>gb|ACJ85866.1| unknown [Medicago truncatula]
Length=376

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD 
Sbjct  176  AEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDA  235

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV
Sbjct  236  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLV  291

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LRTEL++MKM+++D+Q      G++        V+  TFFSS+SKKLGKLNPFK+
Sbjct  292  RENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKNSTFFSSVSKKLGKLNPFKN  350

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  351  GSKDTSHIEDVGVDLTKPRRRRFSIS  376



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 167/207 (81%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +LSISKF  IANL+ K A+K DDDLYR++DIYLKAHP LDEIEREKVCSVMDP
Sbjct  368  GEIATDADLSISKFTSIANLIPKAAKKFDDDLYRSVDIYLKAHPNLDEIEREKVCSVMDP  427

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG ED K+  +A  TRNQ+QAD++L+
Sbjct  428  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGKEDAKNF-DASFTRNQVQADISLI  486

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENE+L++EL +MK ++  +Q        S          K TFFSSMSKKLG+LNPF+H
Sbjct  487  KENESLKSELAKMKSYVDGLQKGKGIATKSS---------KKTFFSSMSKKLGRLNPFRH  537

Query  202  GSKDTSNLDDGE-VDITKPRRRRFSIS  125
            GSKDT N++DG  VDITKPR+RRFSIS
Sbjct  538  GSKDTLNVEDGNAVDITKPRKRRFSIS  564



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 172/220 (78%), Gaps = 14/220 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA++ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIASYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQAD  395
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVMVPEALATRGQVKAD  497

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkg--------ssasaVRKPTFFSSM  239
             +L KENEALR+EL++MKM+++D+Q    S G              ++    KPTFFSS+
Sbjct  498  TSLAKENEALRSELMKMKMYVSDLQKNKQSGGGGAGASSSNSSSLVNSKKSNKPTFFSSV  557

Query  238  SKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  558  SKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  597



>gb|ACJ85743.1| unknown [Medicago truncatula]
Length=257

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  58   AEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDP  117

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV
Sbjct  118  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLV  176

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
             ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+
Sbjct  177  GENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKN  231

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  232  GAKDTAHLEDGPVDLTKPRRRRFSIS  257



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 12/218 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQ  401
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQ
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQ  497

Query  400  ADVTLVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSK  233
            AD TL KENEALR+EL++MK++++DMQ      G+S  +S    S +   K TFFSS+SK
Sbjct  498  ADTTLAKENEALRSELMKMKLYVSDMQKNKNGAGTSSSNSTSLVSNNKKSKHTFFSSVSK  557

Query  232  KLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            KLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  558  KLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>gb|AAB63086.1| unknown protein [Arabidopsis thaliana]
Length=415

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  200  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  259

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  260  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  319

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  320  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKL  379

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  380  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  415



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + EL ISKFNGI+ L+  GARK DDDLYRA+DIYLKAHP LDEIE+EKVCSVMDP
Sbjct  376  AEIAAYGELPISKFNGISILIPGGARKSDDDLYRAVDIYLKAHPNLDEIEKEKVCSVMDP  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHAS+NKRLP+QIVLHALYYDQL +RSGA + K    A   + QLQADV+LV
Sbjct  436  LKLSYEARVHASKNKRLPLQIVLHALYYDQLHLRSGAAEDKEAGAAAVEKKQLQADVSLV  495

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL++MKM+I DMQ  G+   SS K +SA A R PTF SSMSKKL KLNPFK+
Sbjct  496  RENEELRSELMKMKMYITDMQKNGNGTSSSGKETSAPAKR-PTFLSSMSKKLSKLNPFKN  554

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  555  GSKDTSHIDDAPVDLTKPRRRRFSIS  580



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD 
Sbjct  336  AEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDA  395

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV
Sbjct  396  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLV  451

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LRTEL++MKM+++D+Q      G++        V+K TFFSS+SKKLGKLNPFK+
Sbjct  452  RENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKLNPFKN  510

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  511  GSKDTSHIEDVGVDLTKPRRRRFSIS  536



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKNKHTFFSSVSKKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  558  GKLNPFKNGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 174/219 (79%), Gaps = 13/219 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQ  401
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQ
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQ  497

Query  400  ADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKP--TFFSSMS  236
            AD TL KENEALR+EL++MKM+++DMQ   N   +  S+     ++  +K    FFSS+S
Sbjct  498  ADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNNKKSKHNFFSSVS  557

Query  235  KKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            KKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  558  KKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD 
Sbjct  379  AEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDA  438

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV
Sbjct  439  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLV  494

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LRTEL++MKM+++D+Q      G++        V+K TFFSS+SKKLGKLNPFK+
Sbjct  495  RENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKLNPFKN  553

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  554  GSKDTSHIEDVGVDLTKPRRRRFSIS  579



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  330  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  389

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  390  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  449

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  450  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKL  509

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  510  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  545



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  558  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  558  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  558  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 173/216 (80%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQA  398
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQA
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQA  497

Query  397  DVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKL  227
            D TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS+S+KL
Sbjct  498  DTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSRKL  557

Query  226  GKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            GKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  558  GKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA + EL IS+F  +A LV + ARKVDDDLYRAIDIYLKAHP LDEIEREKVC+ MDP
Sbjct  366  GEIAIYEELGISRFKELAKLVPETARKVDDDLYRAIDIYLKAHPDLDEIEREKVCAAMDP  425

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSG       PNA +TR Q QAD  LV
Sbjct  426  LKLSYEARVHASQNKRLPVQIVLHALYYDQLQLRSGGGGDYEKPNAASTRFQAQADTDLV  485

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENE LRTELL+MKM++ ++Q        +   +S+ A +KPTFFSSMSK LGKLNPF+ 
Sbjct  486  KENEKLRTELLKMKMYVQEIQE-----SKNQGTTSSKAAKKPTFFSSMSKTLGKLNPFRI  540

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKDT  +DD   D+ KPRRRRFSIS
Sbjct  541  GSKDTLQIDDAASDVRKPRRRRFSIS  566



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 168/206 (82%), Gaps = 8/206 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRAIDIYLK H  LDE+E+EKVCSVMD 
Sbjct  376  AEIASYGELTISKFNGIAILIPKGARKLDDDLYRAIDIYLKVHTNLDELEKEKVCSVMDA  435

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALY+DQLK+RSGA   +   +  A RNQLQ DVTLV
Sbjct  436  LKLSYEARVHASQNKRLPVQIVLHALYFDQLKLRSGAVVER---DVTAERNQLQTDVTLV  492

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL++MKM++ D++            SS+  V+K TFFSS+SKKLGKLNPFK+
Sbjct  493  RENEELRSELMRMKMYVTDLKK-----NVDGTTSSSREVKKSTFFSSVSKKLGKLNPFKN  547

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            G+KDTS ++DG VD+ KPRRRRFSIS
Sbjct  548  GAKDTSTIEDGPVDLIKPRRRRFSIS  573



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  314  AEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDP  373

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV
Sbjct  374  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLV  432

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+
Sbjct  433  RENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKN  487

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  488  GAKDTAHLEDGPVDLTKPRRRRFSIS  513



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  327  AEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDP  386

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV
Sbjct  387  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLV  445

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+
Sbjct  446  RENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKN  500

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  501  GAKDTAHLEDGPVDLTKPRRRRFSIS  526



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 174/219 (79%), Gaps = 13/219 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQAD  395
            LKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ + T    P A+ATR Q++AD
Sbjct  438  LKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEKQGTVVIVPEALATRGQVKAD  497

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMS  236
             +L KENEALR+EL++MKM+++D+Q    S G +   +S++ V        K  FFSS+S
Sbjct  498  TSLAKENEALRSELMKMKMYVSDLQKNKQSGGGASSSNSSALVSSSNKKNIKQNFFSSVS  557

Query  235  KKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            KKLGK NPF+HGSKDTS++D+    VDITKPRRRRFSIS
Sbjct  558  KKLGKFNPFRHGSKDTSHIDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (83%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  369  AEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDP  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV
Sbjct  429  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLV  487

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+
Sbjct  488  RENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKN  542

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  543  GAKDTAHLEDGPVDLTKPRRRRFSIS  568



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + EL+ISKFNGIA L+ K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVCSVMD 
Sbjct  369  AEIAAYDELTISKFNGIAILIPKHARKVDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDT  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSYEARVHASQ KRLPVQIVLHALYYDQL++RSG++D  +   A   +N+L  DV+LV
Sbjct  429  LKLSYEARVHASQKKRLPVQIVLHALYYDQLRLRSGSDDGDT---AATKKNRLNTDVSLV  485

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL +MKM+++DMQ    +       +S+ + +K  FFSS+SK LGKLNPFKH
Sbjct  486  RENEELRSELAKMKMYVSDMQQ--KNVSQVHGTTSSHSTKKTKFFSSVSKTLGKLNPFKH  543

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
             +KDT++LDDG VD+ KPRRRRFSIS
Sbjct  544  EAKDTTHLDDGPVDLIKPRRRRFSIS  569



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 6/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIA   ELSISKFN IA L+ K ARKVDDDLYRAIDIYLKAHP LDE+EREK CSVMDP
Sbjct  371  GEIAIDSELSISKFNAIATLMPKAARKVDDDLYRAIDIYLKAHPNLDEVEREKACSVMDP  430

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ ADV+L+
Sbjct  431  LKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLADVSLI  489

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            +ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LGKLNPF+ 
Sbjct  490  RENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKLNPFRQ  545

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
            GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  546  GSKDASNIDD-LVDITKPRRRRFSIS  570



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  368  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  427

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQAD  395
            LKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD
Sbjct  428  LKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKAD  487

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGK  221
             +L KENEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGK
Sbjct  488  ASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGK  547

Query  220  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            LNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  548  LNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  581



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  378  AEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQAD  395
            LKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD
Sbjct  438  LKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKAD  497

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGK  221
             +L KENEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGK
Sbjct  498  ASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGK  557

Query  220  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            LNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  558  LNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  591



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 164/209 (78%), Gaps = 5/209 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDP
Sbjct  359  AEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDP  418

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L 
Sbjct  419  LKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLA  477

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+H
Sbjct  478  KENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRH  537

Query  202  GSKDTSNLD---DGEVDITKPRRRRFSIS  125
            GSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  538  GSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 164/209 (78%), Gaps = 5/209 (2%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDP
Sbjct  369  AEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDP  428

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            LKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L 
Sbjct  429  LKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLA  487

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+H
Sbjct  488  KENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRH  547

Query  202  GSKDTSNLD---DGEVDITKPRRRRFSIS  125
            GSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  548  GSKDTSNIDEDLDG-VDITKPRRRRFSIS  575



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 166/213 (78%), Gaps = 13/213 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDP
Sbjct  359  AEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDP  418

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQAD  395
            LKLS + R+HASQNKRLPV IVLHALYYDQLK+RS  ED + T    P A+ TR     D
Sbjct  419  LKLSCDPRLHASQNKRLPVNIVLHALYYDQLKLRSEVEDKEGTPVIVPEALGTR-----D  473

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
             +L KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLN
Sbjct  474  SSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLN  533

Query  214  PFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  125
            PF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  534  PFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 166/211 (79%), Gaps = 7/211 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVCSVMDP
Sbjct  332  GEIATDEELSVSKFAGIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVCSVMDP  391

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ-LQAD  395
            LKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++ L+AD
Sbjct  392  LKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKAD  450

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
            V+L++ENE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ LGKLN
Sbjct  451  VSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLN  509

Query  214  PFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            PFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  510  PFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  540



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 166/211 (79%), Gaps = 7/211 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVCSVMDP
Sbjct  373  GEIATDEELSVSKFAGIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVCSVMDP  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ-LQAD  395
            LKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++ L+AD
Sbjct  433  LKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKAD  491

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
            V+L++ENE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ LGKLN
Sbjct  492  VSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLN  550

Query  214  PFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            PFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  551  PFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  581



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 162/213 (76%), Gaps = 13/213 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLK-------AHPQLDEIEREK  584
            GEIA   ELSISKFN IA L+ K ARKVDDDLYRAIDIYLK       AHP LDE+EREK
Sbjct  371  GEIAIDSELSISKFNAIATLMPKAARKVDDDLYRAIDIYLKWAEPNLQAHPNLDEVEREK  430

Query  583  VCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQL  404
             CSVMDPLKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+
Sbjct  431  ACSVMDPLKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQV  489

Query  403  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  224
             ADV+L++ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LG
Sbjct  490  LADVSLIRENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLG  545

Query  223  KLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KLNPF+ GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  546  KLNPFRQGSKDASNIDD-LVDITKPRRRRFSIS  577



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 173/213 (81%), Gaps = 7/213 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDP
Sbjct  368  AEIATYGELTISKFNAIANLVQKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDP  427

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQAD  395
            LKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD
Sbjct  428  LKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVVPEAVATRGQVKAD  487

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkg-ssasaVRKPTFFSSMSKKLGKL  218
             +L KENEALR+EL++MKM+++D+Q  G++  SS     S     K TFFSS+SKKLGKL
Sbjct  488  ASLAKENEALRSELMKMKMYVSDLQKSGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKL  547

Query  217  NPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  125
            NPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  548  NPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  580



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 161/210 (77%), Gaps = 6/210 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            G+IA+  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  SV+DP
Sbjct  331  GKIASDEELSVSKFTGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKASSVIDP  390

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADV  392
            LKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV
Sbjct  391  LKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADV  450

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +L++ENEALR+EL +MKM++++M       G        +  +K  FFSS+S+ LGKLNP
Sbjct  451  SLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNP  508

Query  211  FKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            FK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  509  FKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  538



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 161/210 (77%), Gaps = 6/210 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            G+IA+  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  SV+DP
Sbjct  375  GKIASDEELSVSKFTGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKASSVIDP  434

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADV  392
            LKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV
Sbjct  435  LKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADV  494

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +L++ENEALR+EL +MKM++++M       G        +  +K  FFSS+S+ LGKLNP
Sbjct  495  SLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNP  552

Query  211  FKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            FK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  553  FKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  582



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 5/168 (3%)
 Frame = -2

Query  625  LKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED  446
            + +HP LDEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D
Sbjct  344  MASHPNLDEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGAD  403

Query  445  PKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  266
             ++ P+A+ TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   
Sbjct  404  DRNQPDAVTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSIGT  459

Query  265  RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  460  RKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  507



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 153/206 (74%), Gaps = 7/206 (3%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            G++A   ELSI+KFNGIAN V K ARK+DD LYRA+DIYLKAHP LDEI+R KVCSVMDP
Sbjct  372  GKVANCDELSIAKFNGIANSVPKAARKLDDHLYRAVDIYLKAHPYLDEIKRLKVCSVMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
            L+LS++ARVHASQN RLPVQIVLHAL+YDQLK+  G  D     +A   RN LQ DV+LV
Sbjct  432  LRLSHQARVHASQNNRLPVQIVLHALHYDQLKLTRGIYDDHLLLDAPRARNYLQIDVSLV  491

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  203
            KENEALRTELL+M+M + DMQ               S V+K TFFSS+SK LG LNPFKH
Sbjct  492  KENEALRTELLRMRMCMRDMQR-------IQGTPYRSRVKKHTFFSSLSKTLGILNPFKH  544

Query  202  GSKDTSNLDDGEVDITKPRRRRFSIS  125
              KDTSN+DD  VD T  RR RFSIS
Sbjct  545  ARKDTSNVDDEMVDSTTLRRGRFSIS  570



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 159/210 (76%), Gaps = 10/210 (5%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +L++ KF  IA  + K AR+ DDDLYRA+DIYLKAHP L EIEREK+CSVMDP
Sbjct  374  GEIATDKDLTVHKFASIAGALPKSARRFDDDLYRAVDIYLKAHPGLHEIEREKLCSVMDP  433

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA--EDPKSTPNA-IATRNQLQADV  392
            LKL+Y+AR+HASQN RLP+QIVL ALYYDQLK+RSGA  E+  + PN+  A R    AD 
Sbjct  434  LKLTYDARLHASQNNRLPLQIVLQALYYDQLKLRSGAEPENAVTPPNSAAAARAGAMADA  493

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +L++ENEALR+EL +MK+ ++++Q       S       +  ++PTFFSS SK L KLNP
Sbjct  494  SLMRENEALRSELTRMKLCLSELQR------SQGTSGLKAGPKRPTFFSSFSKTLEKLNP  547

Query  211  FKHGSKDTSNLDDG-EVDITKPRRRRFSIS  125
            F+HGSKDT+++DDG  VD+TKPRRRRFSI 
Sbjct  548  FRHGSKDTASIDDGVGVDLTKPRRRRFSIG  577



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 29/193 (15%)
 Frame = -2

Query  694  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  515
            IA L+ K ARK+DDDLYRA+DIYLKAHP+LDEIEREKVCSVMDPLKLSYEARVHASQNKR
Sbjct  146  IATLIPKSARKIDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDPLKLSYEARVHASQNKR  205

Query  514  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVK--ENEALRTELLQM  344
            LPVQIVLHALYYDQL++RSGAE+       +AT +NQLQ DVTL K   N+A        
Sbjct  206  LPVQIVLHALYYDQLRLRSGAEE-----REVATEKNQLQMDVTLNKNTNNDA--------  252

Query  343  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  164
                                +S++  +K TFFSS+SK LGKLNPF++GSKDT++L+D  V
Sbjct  253  -------------NPQGHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSKDTTHLEDASV  299

Query  163  DITKPRRRRFSIS  125
            D+TKPRRRRFS+S
Sbjct  300  DLTKPRRRRFSMS  312



>gb|EMS47631.1| Root phototropism protein 2 [Triticum urartu]
Length=386

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 146/216 (68%), Gaps = 11/216 (5%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD L
Sbjct  171  EIATDESLPISKFVGVAGAVPKDARATHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTL  230

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQAD  395
            KLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS       ED  +   A + R Q +AD
Sbjct  231  KLSYTARIHASQNKRLPLQAVLSALYYDQLKLRSAGVGHDDEDSDARSEAGSARMQAKAD  290

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
              L +ENEALR+EL +M+  ++    +    GS    ++    +K +FF SMS+ L +LN
Sbjct  291  AALARENEALRSELARMRAHLSSGVQQSKGSGSRTAATATVPGKKASFFGSMSRTLSRLN  350

Query  214  PFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  125
            PF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  351  PFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  386



>ref|XP_004978520.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=604

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L+ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  396  AEIATEESLAISKFVGVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVCSVMDP  455

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVT  389
            LKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +
Sbjct  456  LKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADAS  515

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            L +ENEALR+EL +M+ +++ MQ            S + A +K +F  S+S+ L +LNPF
Sbjct  516  LARENEALRSELARMRAYLSGMQP-----SRGSGSSPSPAAKKTSFLGSVSRTLSRLNPF  570

Query  208  KHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  125
            K G +KDT+++ DG     E+ + +P+RRRFSIS
Sbjct  571  KGGWAKDTASVADGRDGRKEMHVVRPKRRRFSIS  604



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 153/216 (71%), Gaps = 19/216 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
            GEIAT  +L++ KF GIA ++ K AR+ DDDLYRA+DIYLKAH  L EIE+EK CSVMDP
Sbjct  377  GEIATDKDLTVHKFAGIAGVLPKSARRFDDDLYRAVDIYLKAHTGLHEIEKEKACSVMDP  436

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA---EDPKSTPNAIATRNQLQADV  392
            LKLS+EAR+HA++N RLP+QI+LHALY+DQLK+RSGA   +    + +A A R    AD 
Sbjct  437  LKLSHEARLHAARNNRLPLQIILHALYFDQLKLRSGAAAKDAVAPSNSAAAARAGAMADA  496

Query  391  TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  212
            +L++ENEALR+EL +M++ ++++Q                  ++PTF SS SK LGKLNP
Sbjct  497  SLMRENEALRSELTRMQLCLSELQG---------GSGLKGRPKRPTFLSSFSKTLGKLNP  547

Query  211  FKHGSKDTSNLDDGEVDIT-------KPRRRRFSIS  125
            F+HGS D S++D+G V +        KPRRRRFSIS
Sbjct  548  FRHGSMDASSIDNGGVGVLGEALTKPKPRRRRFSIS  583



>ref|XP_004977394.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=560

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L+ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  352  AEIATEESLAISKFVGVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVCSVMDP  411

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVT  389
            LKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +
Sbjct  412  LKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADAS  471

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  209
            L +ENEALR+EL +M+ +++ +Q            S + A +K +F  S+S+ L +LNPF
Sbjct  472  LARENEALRSELARMRAYLSGVQP-----SKGSGSSPSPAAKKTSFLGSVSRTLSRLNPF  526

Query  208  KHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  125
            K G +KDT+++ DG     ++ + +P+RRR SIS
Sbjct  527  KGGWAKDTASVADGRDGRKDMHVVRPKRRRSSIS  560



>ref|XP_008669932.1| PREDICTED: root phototropism protein 2-like [Zea mays]
 tpg|DAA39312.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=577

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 149/222 (67%), Gaps = 17/222 (8%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+A+H  L ISKF G+A  V + AR   D LYRA+DIYLK HP LDEIEREKVCSVMDPL
Sbjct  356  EMASHESLPISKFVGVAGAVPRDARPSHDCLYRAVDIYLKTHPGLDEIEREKVCSVMDPL  415

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKSTPNAIA-TRNQLQA  398
            +LSY+AR+HASQNKRLP+Q VL  LYYDQLKIRS     G E+   T +A    R Q +A
Sbjct  416  RLSYQARMHASQNKRLPLQAVLSVLYYDQLKIRSADGSGGTEEGWETQSAAGKARAQARA  475

Query  397  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKPTFFSSMS  236
            DV+L +ENEALR EL +M+ +++ MQ      GS    S      + +  +K +F  S+S
Sbjct  476  DVSLARENEALRLELARMRAYVSGMQQSSKGSGSRPSSSSLVPGPATATGKKASFLGSVS  535

Query  235  KKLGKLNPFKHG-SKDTSNLDDG----EVDITKPRRRRFSIS  125
            + L +LNPFK G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  536  RTLSRLNPFKGGWAKDTTSIADGRDRTSMHVVKPKRRRFSIG  577



>dbj|BAJ91259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 147/216 (68%), Gaps = 15/216 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L IS+F G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD L
Sbjct  357  EIATDESLPISRFVGVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTL  416

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQAD  395
            KLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD
Sbjct  417  KLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKAD  476

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
              L +EN+ALR+EL +M+  +    + G  Q       +A+  +K +FF SMS+ L +LN
Sbjct  477  AALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLN  532

Query  214  PFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  125
            PF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  533  PFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  568



>dbj|BAJ92463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 147/216 (68%), Gaps = 15/216 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L IS+F G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD L
Sbjct  357  EIATDESLPISRFVGVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTL  416

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQAD  395
            KLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD
Sbjct  417  KLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKAD  476

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
              L +EN+ALR+EL +M+  +    + G  Q       +A+  +K +FF SMS+ L +LN
Sbjct  477  AALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLN  532

Query  214  PFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  125
            PF+ G   S+DTS++ D   G +++ KP+RRR SIS
Sbjct  533  PFRAGGGWSRDTSSIGDSRGGAMNVVKPKRRRSSIS  568



>ref|XP_002450159.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
 gb|EES09147.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
Length=587

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 150/226 (66%), Gaps = 23/226 (10%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+AT   L ISKF G+A  V K AR   D LYRA+D+YLK HP LDEIEREKVCSVMDPL
Sbjct  364  EMATEESLGISKFVGVAGAVPKDARASHDCLYRAVDMYLKTHPGLDEIEREKVCSVMDPL  423

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE------------DPKSTPNAIAT  416
            +LSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS               +P+S   A   
Sbjct  424  RLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSADGGGGDGAEGGAGWEPQSA--AGKA  481

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs----sasaVRKPTFF  248
            R Q +AD +L +ENEALR+EL +M+ +++ MQ      GS    +    +++A +K +F 
Sbjct  482  RAQARADASLARENEALRSELARMRAYVSGMQQHSKGSGSRSSSASLVPASAAGKKASFL  541

Query  247  SSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSIS  125
             S+S+ L +LNPFK G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  542  GSVSRTLSRLNPFKGGWAKDTASIADGRDRSAMHVVKPKRRRFSIG  587



>gb|KHN24717.1| Root phototropism protein 2 [Glycine soja]
Length=152

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 13/157 (8%)
 Frame = -2

Query  571  MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQAD  395
            MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+       +AT +NQLQ D
Sbjct  1    MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEE-----REVATEKNQLQMD  55

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSSMS  236
            VTLV+ENE LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+S
Sbjct  56   VTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVS  115

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            K LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  116  KTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  152



>ref|XP_006663162.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=506

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 147/221 (67%), Gaps = 16/221 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP LDEIEREKVCSVMDPL
Sbjct  286  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALDEIEREKVCSVMDPL  345

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI----------ATRN  410
            KLSY+ R+HASQNKRLP+Q VL ALYYDQLK+RSG         +           + R 
Sbjct  346  KLSYQGRLHASQNKRLPLQAVLSALYYDQLKLRSGNGGGVGGDESGGWDAYGGMMRSARM  405

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT----FFSS  242
            Q +A+ +L +ENE LR+EL +M+ +++ M  + S  G S   ++AS+ +K T       S
Sbjct  406  QAKAEASLARENEELRSELARMRAYMSGMGVQQSKGGGSSSRTTASSGKKGTTSLWLLGS  465

Query  241  MSKKLGKLNPFKHG--SKDTSNLDDGEVDITKPRRRRFSIS  125
            +S+ L +LNPFK G  +KDTS++ D ++   KP+RRRFS+S
Sbjct  466  VSRTLSRLNPFKGGIWAKDTSSIGDKKIHSVKPKRRRFSVS  506



>ref|XP_003577852.1| PREDICTED: root phototropism protein 2 [Brachypodium distachyon]
Length=606

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 140/221 (63%), Gaps = 20/221 (9%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGAR---KVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  569
            EIAT   L ISKF  IA  + + +R      D +YRA+D+YLKAHP LDEIEREKVCSVM
Sbjct  390  EIATEETLPISKFVSIAGAIPRESRPGGAAHDCVYRAVDVYLKAHPGLDEIEREKVCSVM  449

Query  568  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----EDPKSTPNAIATRNQLQ  401
            DPLKLS  AR+HASQNKRLP+Q VL ALYYDQLK+RSG     ED +S   A + R Q +
Sbjct  450  DPLKLSPAARLHASQNKRLPLQAVLSALYYDQLKLRSGQLTGDEDDRS--EAGSARMQAK  507

Query  400  ADVTLVKENEALRTELLQMKMFIADMQNkgss-----qgssvkgssasaVRKPTFFSSMS  236
            AD  L +ENEALR+EL +M+  ++   +            S   ++     K  FF SMS
Sbjct  508  ADAALARENEALRSELGRMRAHMSSSSSGSGRGQRSKGSGSRTPAAMKGKMKVGFFGSMS  567

Query  235  KKLGKLNPFKHG----SKDTSNLDDGEVDITKPRRRRFSIS  125
            + L +LNPF+ G    SKDTSN+ D    I KP+RRRFSI 
Sbjct  568  RTLSRLNPFRAGGGRWSKDTSNIADAA--IVKPKRRRFSIG  606



>gb|EEC68739.1| hypothetical protein OsI_37246 [Oryza sativa Indica Group]
Length=570

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 136/220 (62%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  362  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  421

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  A + R 
Sbjct  422  KLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGGGWDAYGNGVMRSSAAGSARK  481

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  482  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  530

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  531  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>gb|ABG22339.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
Length=539

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 136/220 (62%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  331  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  390

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R 
Sbjct  391  KLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARK  450

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  451  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  499

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  500  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  539



>gb|ABA95649.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52651.1| hypothetical protein OsJ_35014 [Oryza sativa Japonica Group]
Length=570

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 136/220 (62%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  362  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  421

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R 
Sbjct  422  KLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARK  481

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  482  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  530

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  531  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001065596.1| Os11g0118300 [Oryza sativa Japonica Group]
 gb|ABA91174.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27441.1| Os11g0118300 [Oryza sativa Japonica Group]
 dbj|BAG89308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51536.1| hypothetical protein OsJ_32738 [Oryza sativa Japonica Group]
Length=571

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 136/220 (62%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  363  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  422

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R 
Sbjct  423  KLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARK  482

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  483  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  531

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  532  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  571



>ref|NP_001066000.1| Os12g0117400 [Oryza sativa Japonica Group]
 dbj|BAF29019.1| Os12g0117400, partial [Oryza sativa Japonica Group]
Length=591

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 136/220 (62%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  383  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  442

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  A + R 
Sbjct  443  KLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARK  502

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  503  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  551

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  552  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  591



>gb|EEC67555.1| hypothetical protein OsI_34888 [Oryza sativa Indica Group]
Length=571

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 135/220 (61%), Gaps = 26/220 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPL
Sbjct  363  EIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPL  422

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRN  410
            KLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  A +   
Sbjct  423  KLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGSGWDAYGNGVMRSSAAGSAWK  482

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  230
            Q + + +L +ENEALR+EL +M+ +++ MQ +     SS                S  + 
Sbjct  483  QAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRT  531

Query  229  LGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  125
            L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  532  LSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKAKRRRFSIS  571



>gb|AFW55920.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=621

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 136/221 (62%), Gaps = 17/221 (8%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDPL
Sbjct  402  EIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVCSVMDPL  461

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQAD  395
            KLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      AD
Sbjct  462  KLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAAD  521

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
              L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +LN
Sbjct  522  AALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLN  580

Query  214  PFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  125
            PF+ G       TSN   G          +  P+RRR SIS
Sbjct  581  PFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  621



>ref|XP_008661889.1| PREDICTED: LOC100281201 isoform X1 [Zea mays]
Length=636

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 136/221 (62%), Gaps = 17/221 (8%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDPL
Sbjct  417  EIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVCSVMDPL  476

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQAD  395
            KLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      AD
Sbjct  477  KLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAAD  536

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLN  215
              L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +LN
Sbjct  537  AALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLN  595

Query  214  PFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  125
            PF+ G       TSN   G          +  P+RRR SIS
Sbjct  596  PFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  636



>ref|NP_001147592.1| LOC100281201 [Zea mays]
 gb|ACG28024.1| RPT2-like protein [Zea mays]
Length=613

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 136/222 (61%), Gaps = 17/222 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDP
Sbjct  393  AEIATEEALPISKFVGVAGAVPKDARPSHDYLYRAVDIYLKTHPELDEIQREKVCSVMDP  452

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQA  398
            LKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A      A
Sbjct  453  LKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAA  512

Query  397  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  218
            D  L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+ + +L
Sbjct  513  DAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRL  571

Query  217  NPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  125
            NPF+ G       TSN   G          +  P+RRR SIS
Sbjct  572  NPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  613



>ref|XP_002463481.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
 gb|EER90479.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
Length=264

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 18/189 (10%)
 Frame = -2

Query  640  AIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  461
            A+DIYLK HP LDEIEREKVCSVMDPL+LSY+AR+HA QNKRLP+Q +L ALYYDQLK+R
Sbjct  75   AVDIYLKTHPGLDEIEREKVCSVMDPLRLSYQARLHAPQNKRLPLQALLDALYYDQLKLR  134

Query  460  SGAEDP-------KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssq  302
            S            +S   A   R Q +AD +L +ENEALR+EL +M+ +++ MQ   +  
Sbjct  135  SADGGDGAEGGGWESQSAAGKARAQARADASLARENEALRSELARMRAYVSGMQQHSNGS  194

Query  301  gssvkgs------sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDIT  155
            GS    +      +++A +K +F  S+S+ L +LNPFK G +KD +++ DG     + + 
Sbjct  195  GSRSSLASASLVPASAAGKKASFLGSVSQTLSQLNPFKGGWAKDMASIADGRDRSAMHVV  254

Query  154  KPRRRRFSI  128
            KP+RRRFSI
Sbjct  255  KPKRRRFSI  263



>ref|XP_009374446.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=1090

 Score =   177 bits (450),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -2

Query  619   AHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK  440
             AHP LDEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQ K+RSG  D  
Sbjct  945   AHPNLDEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQPKLRSGV-DEN  1003

Query  439   STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVR  263
                +A+ TR+Q+Q DV+L +ENE LR ELL+MKM+I D+Q    +   ++  G      +
Sbjct  1004  DVQDAVTTRSQVQHDVSLARENEELRMELLKMKMYITDLQKTGSAGIATTSSGKGGGGPK  1063

Query  262   KPTFFSSMSKKLGKLNPFKHG  200
             K TFFSS+SKKLGKLNPFK G
Sbjct  1064  KATFFSSVSKKLGKLNPFKQG  1084



>ref|XP_002441790.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
 gb|AAO16688.1| RPT2-like protein [Sorghum bicolor]
 gb|EES15628.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
Length=665

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 138/266 (52%), Gaps = 61/266 (23%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP LDEI+REKVCSVMDP
Sbjct  399  AEIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPALDEIQREKVCSVMDP  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADV--  392
            LKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS A+   S  + +A T+ Q  +    
Sbjct  459  LKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAADAATSMGDVVADTQTQSSSAAGR  518

Query  391  ---------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF----  251
                      L +ENEALR EL +M+ +++     G  + SS   S +   +K TF    
Sbjct  519  ARAQAMADAALARENEALRVELARMRAYMSGTMQHGKGRESSTPASPSRTAKKATFLGTE  578

Query  250  -------------------------------------FSSMSKKLGKLNPFKHG--SKDT  188
                                                   S+S+ L +LNPFK G  +  T
Sbjct  579  LARMRAYMSGMHHSKGSGATPPASPSRTAAAKTKASLLGSVSRSLSRLNPFKGGWTTNHT  638

Query  187  SNLDDGEVD------ITKPRRRRFSI  128
             ++  G         +  P+RRR SI
Sbjct  639  GSIAAGGRPCKTMHHVVTPKRRRSSI  664



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 130/223 (58%), Gaps = 20/223 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC +MD 
Sbjct  386  AEIASDRNLSVSKFTNLAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVCRLMDC  445

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + +++  
Sbjct  446  QKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYH  505

Query  403  QAD---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TF  251
             A    ++L +ENE L+ EL++M+M + +++  G            S  + P      +F
Sbjct  506  SAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSF  565

Query  250  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
             SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  566  ISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  605



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 130/223 (58%), Gaps = 20/223 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC +MD 
Sbjct  375  AEIASDRNLSVSKFTNLAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVCRLMDC  434

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + +++  
Sbjct  435  QKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYH  494

Query  403  QAD---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TF  251
             A    ++L +ENE L+ EL++M+M + +++  G            S  + P      +F
Sbjct  495  SAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSF  554

Query  250  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
             SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  555  ISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  594



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 129/226 (57%), Gaps = 26/226 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  401  AEIASDRNLSVSRFIALAELIPEQARVTEDGMYRAIDIYLKAHPALTDMERKKVCSLMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQ  407
             KLS EA  HA+QN RLPVQIV+  LYY+Q ++R         G E P S P  +   N 
Sbjct  461  QKLSREACAHAAQNDRLPVQIVVQVLYYEQQRLRDVMGGGNLMGGESP-SLPQKL---NL  516

Query  406  LQAD--------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssa----saVR  263
              AD        V+L +ENE L+ EL++M+M +  ++       S     SA        
Sbjct  517  YSADYHSAPDEVVSLRRENEDLKIELVKMRMRLKQLEKSAEIIPSGSTPPSADKPPLPRS  576

Query  262  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KP+F +S+SKKLG+L PF     D     DG+  I   R RR SIS
Sbjct  577  KPSFINSVSKKLGRLYPFVRA--DGVKPSDGKGRIKPSRNRRHSIS  620



>ref|XP_011012052.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Populus euphratica]
Length=546

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 131/218 (60%), Gaps = 16/218 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  333  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  392

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  393  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDI  452

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+S
Sbjct  453  RPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVS  512

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG++NPF       SN        T+P + RR SIS
Sbjct  513  KKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011006800.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Populus euphratica]
Length=546

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 131/218 (60%), Gaps = 16/218 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  333  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  392

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  393  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDI  452

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+S
Sbjct  453  RPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVS  512

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG++NPF       SN        T+P + RR SIS
Sbjct  513  KKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 131/218 (60%), Gaps = 16/218 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  386  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  445

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  446  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDI  505

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+S
Sbjct  506  RPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVS  565

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG++NPF       SN        T+P + RR SIS
Sbjct  566  KKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  599



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 131/218 (60%), Gaps = 16/218 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  386  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  445

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  446  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDI  505

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S+S
Sbjct  506  RPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVS  565

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG++NPF       SN        T+P + RR SIS
Sbjct  566  KKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  599



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 130/217 (60%), Gaps = 13/217 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  387  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  446

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  447  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDI  506

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM + +++       +S   +    + + +F +S+S
Sbjct  507  RPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVS  566

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KKLG++NPF     D   L + +      + RR SIS
Sbjct  567  KKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  601



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDP
Sbjct  369  AEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDP  428

Query  562  LKLSYEARVHASQNKRLP  509
            LKLSYEARVHASQNKRLP
Sbjct  429  LKLSYEARVHASQNKRLP  446



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 135/222 (61%), Gaps = 20/222 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L+++KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD 
Sbjct  401  AEIATDRNLAVTKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+  
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHP  520

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFF  248
                  TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F 
Sbjct  521  VSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFM  580

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  581  SSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 130/217 (60%), Gaps = 13/217 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  429  AEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDC  488

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  
Sbjct  489  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDI  548

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            +  +D   +L +ENE L+ EL++MKM + +++       +S   +    + + +F +S+S
Sbjct  549  RPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVS  608

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KKLG++NPF     D   L + +      + RR SIS
Sbjct  609  KKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  643



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 124/218 (57%), Gaps = 18/218 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+I +F  +A L+ + AR ++D +YRAIDIYLKAHP L  +ER+KVCS+MD 
Sbjct  399  AEIASDHNLTIERFISLAELIPEQARVIEDGMYRAIDIYLKAHPSLSVVERKKVCSLMDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDP----KSTPNAIA  419
             +LS EA  HA+QN RLPVQ+V+  LYY+Q + R        SG E P    K+TP  I 
Sbjct  459  QRLSREACAHAAQNDRLPVQLVVQVLYYEQQRHRDVMSTGNLSGGESPALSQKATPYGIG  518

Query  418  TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSM  239
              N       L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+
Sbjct  519  YHNAPDELSRLRRENADLKLELFRMRMQLQEIEKSSGNTTSAGKPPLP----KKSFINSV  574

Query  238  SKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            SKKLG+L PF     D      G+     P+ RR SIS
Sbjct  575  SKKLGRLYPFMR--SDNEKTLSGKTRKKPPKDRRHSIS  610



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 135/226 (60%), Gaps = 28/226 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L+++KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD 
Sbjct  401  AEIATDRNLAVTKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+  
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHP  520

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFF  248
                  TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F 
Sbjct  521  VSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFM  580

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDI----TKP-RRRRFSIS  125
            SS+SKKLG+L+PF           DG +      TKP + RR SIS
Sbjct  581  SSVSKKLGRLSPFVRA--------DGVLPFPKGRTKPNKNRRHSIS  618



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 134/223 (60%), Gaps = 23/223 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCSVMD 
Sbjct  372  AEIATDRNLAVSKFITVAELIPEQSRPTEDGMYRAIDIYLKAHPVLSDMEKKKVCSVMDC  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDP------KSTPNAI-  422
             KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       S+PN + 
Sbjct  432  QKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDGNAGWDSPNFRDKVNSSPNELN  491

Query  421  ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP----  257
               N+L     L +ENE L+ E++++KM + +++       SS     ++ +  KP    
Sbjct  492  LVSNELS---ILRRENEDLKLEIVKLKMKLKEIERTSIRSASSSPVIFASPSADKPPLPR  548

Query  256  -TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
             +F +S+SKKLG+L+PF  G+  T+ L  G V   K RR   S
Sbjct  549  KSFINSVSKKLGRLSPFSRGNAATTLL-KGHVKPDKNRRHSIS  590



>ref|XP_008341358.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Malus domestica]
Length=568

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 133/229 (58%), Gaps = 31/229 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  348  AEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVCSMMDC  407

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L
Sbjct  408  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSL  462

Query  403  QA--------DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-  257
             +        ++T++ ++NE L+ EL++MKM + +++   +         +      KP 
Sbjct  463  YSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPP  522

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
                +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  523  LPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  568



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 128/221 (58%), Gaps = 17/221 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVCS+MD 
Sbjct  404  AEIATDRNVSVSKFIGIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVCSMMDC  463

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP--KSTPNAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       +G E     S  N  +T  
Sbjct  464  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLTGGESSVLPSKGNLYSTDI  523

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----T  254
                D    L ++NE L+ EL++MKM + +++        S   G+ +++  KP     +
Sbjct  524  HPVPDELSILRRQNEELKIELVKMKMRLKELETSTMRTSMSSPMGNISTSADKPPLPRKS  583

Query  253  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
            F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  584  FINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 133/229 (58%), Gaps = 31/229 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  406  AEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVCSMMDC  465

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L
Sbjct  466  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSL  520

Query  403  QA--------DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-  257
             +        ++T++ ++NE L+ EL++MKM + +++   +         +      KP 
Sbjct  521  YSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPP  580

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
                +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  581  LPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  626



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 130/223 (58%), Gaps = 27/223 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A    L +SKF  +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C ++D 
Sbjct  391  AEVAPDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDV  450

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------------AEDPKST  434
             KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+                  A  P   
Sbjct  451  QKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGL  510

Query  433  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  254
              AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+     
Sbjct  511  SAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----  563

Query  253  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  564  FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNS-RRRRHSIS  603



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 130/223 (58%), Gaps = 27/223 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A    L +SKF  +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C ++D 
Sbjct  403  AEVAPDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDV  462

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------------AEDPKST  434
             KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+                  A  P   
Sbjct  463  QKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGL  522

Query  433  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  254
              AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+     
Sbjct  523  SAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----  575

Query  253  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  576  FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNN-RRRRHSIS  615



>gb|AAN77296.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94554.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58548.1| hypothetical protein OsJ_09846 [Oryza sativa Japonica Group]
Length=626

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 125/233 (54%), Gaps = 32/233 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+ KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD 
Sbjct  399  AEIASDENLSVDKFTALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVCRAMDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+               
Sbjct  459  QKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTP  518

Query  415  ------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP  257
                  R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G           +KP
Sbjct  519  SFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKP  577

Query  256  T---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                      F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  578  GGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>gb|EEC74727.1| hypothetical protein OsI_10455 [Oryza sativa Indica Group]
Length=626

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 125/233 (54%), Gaps = 32/233 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+ KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD 
Sbjct  399  AEIASDENLSVDKFTALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVCRAMDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+               
Sbjct  459  QKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTP  518

Query  415  ------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP  257
                  R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G           +KP
Sbjct  519  SFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKP  577

Query  256  T---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                      F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  578  GGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 131/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD 
Sbjct  401  AEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+  
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHP  520

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFF  248
                  TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F 
Sbjct  521  VSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFM  580

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  581  SSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 131/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD 
Sbjct  411  AEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDC  470

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+  
Sbjct  471  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHP  530

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFF  248
                  TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F 
Sbjct  531  VSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFM  590

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  591  SSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  628



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 131/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD 
Sbjct  423  AEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDC  482

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+  
Sbjct  483  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHP  542

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFF  248
                  TL +ENE L+ EL+++KM + +++N       +    S++ +  KP     +F 
Sbjct  543  VSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFM  602

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  603  SSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  640



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 126/198 (64%), Gaps = 13/198 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++++F G+A L+ + +R  +D +YRAIDI+LKAHP + ++ER+KVCS+MD 
Sbjct  407  AEIASDRNLTVARFIGLAELIPEQSRITEDGMYRAIDIFLKAHPAISDMERKKVCSLMDC  466

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPK--STPNAIATRNQLQA  398
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G + P   +  N  AT N   +
Sbjct  467  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMIGGDSPTLPTKVNLYATNNHPVS  526

Query  397  D--VTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSS  242
            D   +L +ENE L+ EL++MKM + +++ + G    +S    ++ +  KP     +F +S
Sbjct  527  DEISSLKRENEDLKLELVKMKMRLKEIEKSGGGRSVTSSPALNSPSADKPPLPRKSFINS  586

Query  241  MSKKLGKLNPFKHGSKDT  188
            +SKKLG+L PF  G  D+
Sbjct  587  VSKKLGRLYPFVRGEGDS  604



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 121/219 (55%), Gaps = 22/219 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+ V+L I KF G+A ++ + AR  +D +YRAIDIYLKAHP L E  R+KVC VMD 
Sbjct  386  AEIASDVDLPIDKFTGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEAGRKKVCRVMDC  445

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA-----  398
             KLS EA  HA+QN RLPVQ V+  LY++Q ++R   + P S P   A    LQ      
Sbjct  446  QKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPKAP-SPPYRPAPTPSLQGRHART  504

Query  397  ---DVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-----FFS  245
               +V+ L +ENE L+ ELL+MKM + +          +         +K       F +
Sbjct  505  VLDEVSRLQRENEELKMELLRMKMHMREPPAALPQPSGAPPPGRRPPPKKAAGGSGGFMN  564

Query  244  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  128
            ++SKKLG+LNPF         LD    +  K RRRR SI
Sbjct  565  NVSKKLGRLNPFLR-------LDAVGTEPPKDRRRRRSI  596



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 129/221 (58%), Gaps = 17/221 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD 
Sbjct  402  AEIASDRNLSVSKFVGLAELLPERSRITEDGMYRAIDIYLKAHPALSDMERKKVCSVMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-TPNAIATRNQLQAD---  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +  TPN     NQ  A    
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGTEGETPNLALKVNQHPAGSHT  521

Query  394  -----VTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFF  248
                  +L KEN+ L+ EL++M+  + +++ +   S  +S    +  +  KP     +  
Sbjct  522  APQELSSLRKENQDLKLELVKMRTRLRELEKSSDKSYAASPLVITLPSAEKPPLPRKSLI  581

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            SS+S+KLGK+NPF     D     + +V     + RR SIS
Sbjct  582  SSVSRKLGKINPFLRA--DALFPSNAKVRSKPSKDRRHSIS  620



>gb|KJB48679.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=355

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 128/222 (58%), Gaps = 26/222 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  
Sbjct  143  EIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQ  202

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV---  392
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV   
Sbjct  203  KLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPV  262

Query  391  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFF  248
                 +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F 
Sbjct  263  SGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFM  322

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  323  NSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  355



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 136/229 (59%), Gaps = 31/229 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAH  L ++ER+KVCS+MD 
Sbjct  409  AEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHSALSDMERKKVCSMMDC  468

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + ++  L
Sbjct  469  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNPIGAES-----SVLPSKGSL  523

Query  403  QA--------DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-  257
             +        ++T++ ++NE L+ EL++MKM + +++   +        G++ ++  KP 
Sbjct  524  YSTDIHPVPDELTILRRQNEELKIELVKMKMKLKELETSTTRTTMISPMGNTPTSADKPP  583

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
                +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  584  LPRKSFMNSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  629



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 121/197 (61%), Gaps = 15/197 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L++SKF  +A L+   +R+ +D +YRAIDIYLKAHP L ++E++KVCSVMD 
Sbjct  372  AEIATDRNLAVSKFITVAELIPDQSRETEDGMYRAIDIYLKAHPILSDMEKKKVCSVMDC  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDPKSTPNAIATRNQLQ  401
             KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       ++ N+L 
Sbjct  432  QKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDSSAGWDSPNFLDKVNSSPNELS  491

Query  400  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSM  239
                L +EN+ L+ E++++KM + + +       SS     ++ +  KP     +F +S+
Sbjct  492  ---ILRRENQDLKLEIVKLKMRLKEFERTSIRSASSSPVIYASRSADKPPLPRKSFINSV  548

Query  238  SKKLGKLNPFKHGSKDT  188
            SKKLG+L+PF  G   T
Sbjct  549  SKKLGRLSPFSRGDAAT  565



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 135/226 (60%), Gaps = 24/226 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD 
Sbjct  402  AEIASDRNLSVSKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTISDLERKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATR-NQLQAD  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+     +P AI++R N   AD
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSISSGDSP-AISSRVNLYTAD  520

Query  394  --------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--aVRKP----  257
                     +L +ENE L+ EL++MKM + +++   S + +          +  KP    
Sbjct  521  SHPVSDELSSLKRENEDLKLELVKMKMRLKEIEKSSSVKSAVSSPMGIILPSSDKPPLPR  580

Query  256  -TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
             +F +S+SKKLG+L PF      + +   G    T+P + RR SIS
Sbjct  581  KSFMNSVSKKLGRLYPFVRSDGVSPSSAKGR---TRPSKDRRHSIS  623



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD 
Sbjct  399  AEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQ  401
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +   N   
Sbjct  459  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYS  514

Query  400  ADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP---  257
             D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  KP   
Sbjct  515  TDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLP  574

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +SMSKKLG+L PF
Sbjct  575  RKSFINSMSKKLGRLYPF  592



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD 
Sbjct  400  AEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDC  459

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQ  401
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +   N   
Sbjct  460  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYS  515

Query  400  ADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP---  257
             D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  KP   
Sbjct  516  TDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLP  575

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +SMSKKLG+L PF
Sbjct  576  RKSFINSMSKKLGRLYPF  593



>ref|XP_010412681.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=243

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 126/229 (55%), Gaps = 36/229 (16%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC++MD 
Sbjct  28   AEIASDRNVNLAKFIGFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVCNLMDC  87

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT           
Sbjct  88   QKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELS  147

Query  415  --RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP  257
               N+L     L +EN+ L+ EL+++KM   +++    +   +         S ++V KP
Sbjct  148  SYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKP  204

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                 +F SS+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  205  RLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  243



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 131/230 (57%), Gaps = 31/230 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIASDRNLSVSKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPVLSDMERKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKST-PNAIATRNQ  407
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P S  P+ +   N 
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLVGGESPASALPSKL---NL  518

Query  406  LQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP  257
               D+         L +ENE L+ EL++MKM + +++   + + +         S+  KP
Sbjct  519  YSTDIHPVSDELSGLRRENEDLKIELVKMKMKMKEIERSTAVKSAVNSPQSVIMSSADKP  578

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
                 +F +S+SK+LG+L PF      T +        TKP + RR SIS
Sbjct  579  PRPRKSFMNSVSKRLGRLYPFVRSDGVTPSYKGR----TKPSKDRRHSIS  624



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD 
Sbjct  382  AEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDC  441

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQ  401
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +   N   
Sbjct  442  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYS  497

Query  400  ADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP---  257
             D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  KP   
Sbjct  498  TDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLP  557

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +SMSKKLG+L PF
Sbjct  558  RKSFINSMSKKLGRLYPF  575



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 126/221 (57%), Gaps = 17/221 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVCS+MD 
Sbjct  404  AEIATDRNVSVSKFIGIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVCSMMDC  463

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP--KSTPNAIATRN  410
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E     S  N  +T  
Sbjct  464  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLIGGESSVLPSKGNLYSTDI  523

Query  409  QLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----T  254
                D    L ++NE L+ EL++MK  + +++        S   G+ +++  KP     +
Sbjct  524  HPVPDELSILRRQNEELKIELVKMKKRLKELETSTVRTSISSPMGNISTSADKPPLPRKS  583

Query  253  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
            F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  584  FINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_010905283.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Elaeis guineensis]
Length=533

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 129/218 (59%), Gaps = 19/218 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+I++F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+M+ 
Sbjct  323  AEIASDHNLTIARFISLAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVCSLMEC  382

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIAT  416
             KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP  +  
Sbjct  383  QKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGY  442

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
             N       L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+S
Sbjct  443  HNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVS  498

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  499  KKLGRLYPFMRS--DSVKPPSGK-RMTKPHKDRRHSIS  533



>gb|ACL53070.1| unknown [Zea mays]
 tpg|DAA43884.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=500

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  
Sbjct  285  EIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQ  344

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ  401
            KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +  
Sbjct  345  KLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSV  404

Query  400  AD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSM  239
             D    L +ENE L+ ELL++KM + D     Q+  +           +A     F +++
Sbjct  405  PDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNV  464

Query  238  SKKLGKLNPF  209
            SKKLG+LNPF
Sbjct  465  SKKLGRLNPF  474



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 121/217 (56%), Gaps = 17/217 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+I++F  +  LV + AR  +D +YRAIDIYLKAHP   + ER+KVCS+MD 
Sbjct  373  AEIASDPNLTIARFISLGELVSEQARVNEDGMYRAIDIYLKAHPSSTDEERKKVCSLMDC  432

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIAT  416
             KLS EA  HA+QN+RLPVQ V+  L+ +Q + R       +G E P    +STP +   
Sbjct  433  QKLSREACAHAAQNERLPVQTVVQVLFCEQQRFRDATSGSFTGGESPALSLRSTPCSTKH  492

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
            R        L +EN+ LR +LL+M+M + +++       S+ K        K +F +S+S
Sbjct  493  RGGTDELSRLQRENDDLRMQLLRMRMLLKEVEKPSGQIPSAQKPPLP----KKSFINSLS  548

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KKLG+L PF H          G      P+ RR SIS
Sbjct  549  KKLGRLYPFTHADGVKPFSSKGRTK--PPKDRRHSIS  583



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 129/218 (59%), Gaps = 19/218 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+I++F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+M+ 
Sbjct  399  AEIASDHNLTIARFISLAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVCSLMEC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIAT  416
             KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP  +  
Sbjct  459  QKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGY  518

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
             N       L +EN  L+ EL +M+M + +++    +  S+ K        K +F +S+S
Sbjct  519  HNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVS  574

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            KKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  575  KKLGRLYPFMRS--DSVKPPSGK-RMTKPHKDRRHSIS  609



>gb|KJB48678.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=501

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 128/222 (58%), Gaps = 26/222 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  
Sbjct  289  EIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQ  348

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV---  392
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV   
Sbjct  349  KLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPV  408

Query  391  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFF  248
                 +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F 
Sbjct  409  SGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFM  468

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  469  NSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  501



>tpg|DAA43883.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=597

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  
Sbjct  382  EIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQ  441

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ  401
            KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +  
Sbjct  442  KLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSV  501

Query  400  AD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSM  239
             D    L +ENE L+ ELL++KM + D     Q+  +           +A     F +++
Sbjct  502  PDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNV  561

Query  238  SKKLGKLNPF  209
            SKKLG+LNPF
Sbjct  562  SKKLGRLNPF  571



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 124/222 (56%), Gaps = 26/222 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +++ KF G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVCS+MD 
Sbjct  378  AEIASDRNVNVPKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVCSLMDC  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--  389
             KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P             T  
Sbjct  438  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPPKPTSY  496

Query  388  ------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSS  242
                  L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     +F SS
Sbjct  497  NEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSS  556

Query  241  MSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  125
            +SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  557  VSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  589



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 124/222 (56%), Gaps = 26/222 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +++ KF G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVCS+MD 
Sbjct  377  AEIASDRNVNVPKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVCSLMDC  436

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--  389
             KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P             T  
Sbjct  437  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPPKPTSY  495

Query  388  ------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSS  242
                  L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     +F SS
Sbjct  496  NEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSS  555

Query  241  MSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  125
            +SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  556  VSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  588



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 128/222 (58%), Gaps = 26/222 (12%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  
Sbjct  402  EIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQ  461

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV---  392
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N    DV   
Sbjct  462  KLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPV  521

Query  391  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFF  248
                 +L +EN+ L+ EL++MKM + +++   S++ +      +           K +F 
Sbjct  522  SGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFM  581

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  582  NSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  614



>gb|ACL52494.1| unknown [Zea mays]
Length=597

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  
Sbjct  382  EIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQ  441

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ  401
            KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+      +  
Sbjct  442  KLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSV  501

Query  400  AD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSM  239
             D    L +ENE L+ ELL++KM + D     Q   +           +A     F +++
Sbjct  502  PDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNV  561

Query  238  SKKLGKLNPF  209
            SKKLG+LNPF
Sbjct  562  SKKLGRLNPF  571



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 123/224 (55%), Gaps = 23/224 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  401  AEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  N   A+ 
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNIYSAET  520

Query  391  T-------------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP--  257
                          L +EN+ L+ EL++MKM + + +    S   +      +A + P  
Sbjct  521  AAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTQLQPNAEKPPLP  580

Query  256  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
              +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  581  KKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 132/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   L + KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD 
Sbjct  400  AEIATDRNLPVPKFTCLAELIPEQSRPTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDC  459

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   +D+  
Sbjct  460  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNGSGESSVDSKLNVYSSDLQP  519

Query  391  ------TLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKP-----TFF  248
                  TL +EN+ L+ EL+++K  + +++     S  +S   S++ +  KP     +F 
Sbjct  520  ASNELSTLRRENQDLKLELVKLKRRLKEIETTTPKSAVNSPAVSASPSADKPPLPRRSFM  579

Query  247  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            SS+SKKLG+L+PF   +   +    G    TKP + RR SIS
Sbjct  580  SSVSKKLGRLSPFVR-ADGVAPFAKGR---TKPNKNRRHSIS  617



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 133/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N  
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLY  517

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-  257
             AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP 
Sbjct  518  SADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPP  577

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  578  LPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 133/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N  
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLY  517

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-  257
             AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP 
Sbjct  518  SADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPP  577

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  578  LPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 133/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I   N  
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLY  517

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-  257
             AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +  KP 
Sbjct  518  SADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPP  577

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  578  LPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 117/196 (60%), Gaps = 21/196 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC VMD 
Sbjct  401  AEIASDRNLSVSKFISLAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVCGVMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQA  398
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P A+  +  NQ   
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPALIPSKTNQFST  520

Query  397  DV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------R  263
            D+        +L +EN+ L+ ELL+MKM + +++   +   +S                R
Sbjct  521  DIRPISDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSATSSPLVITHPSADKPPLPR  580

Query  262  KPT-FFSSMSKKLGKL  218
            KP+ F SS+SKKLGK 
Sbjct  581  KPSNFISSVSKKLGKF  596



>ref|XP_008368005.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=232

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 123/223 (55%), Gaps = 20/223 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  13   AEIATDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDC  72

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAED----PKSTPNAIATR  413
              LS EA  HA+QN RLPV  V+  LYY+Q ++R       G E      K + ++    
Sbjct  73   QXLSREACXHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVHSTDIH  132

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TF  251
                    L ++N  L+ EL++MKM + +++        S   G++  +  KP     +F
Sbjct  133  TVPDELTILRRQNAELKIELVKMKMKLKELETSTMRTAMSSPMGNTPISADKPPLPRKSF  192

Query  250  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
             + +SK+LG L+PF      T     G    TKP + RR SIS
Sbjct  193  MNLVSKRLGXLSPFVRADGVTPTGTKGR---TKPSKDRRHSIS  232



>ref|XP_009379312.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Pyrus x bretschneideri]
Length=505

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 122/220 (55%), Gaps = 16/220 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA    +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  286  AEIAIDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDC  345

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQ  407
             KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  +T   
Sbjct  346  QKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVH  405

Query  406  LQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TF  251
            +  D    L ++NE L+ EL +MKM + +++   +    S   G++  +  KP     +F
Sbjct  406  MVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSF  465

Query  250  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
             + +SK+LGKL+PF      T     G     K RR   S
Sbjct  466  MNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  505



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 126/240 (53%), Gaps = 40/240 (17%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+++ V L + KF G+A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC VMD  
Sbjct  379  EVSSDVNLPVDKFTGLAELIPERARFNEDGMYRAIDIYLKAHPSLGEGERKKVCGVMDCQ  438

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------------SGAEDP----KST  434
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R              +G E P    K T
Sbjct  439  KLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRVPPPSQAPSGAPSYAGGESPALSYKPT  498

Query  433  PNAIA-TRNQLQADVT-LVKENEALRTELLQMKMFIAD---MQNkgssqgssvkgssasa  269
            P+     R+   ++V+ L +EN+ LR EL+QMKM + D        +   ++    S+ A
Sbjct  499  PSFNGRERSAPSSEVSRLQRENDELRMELMQMKMRLRDPSGAAPAAAPPLAAGATRSSPA  558

Query  268  VRKPTF------------FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
              KP                   KKLG+LNPF         L  G+V    P+ RR SIS
Sbjct  559  SGKPPLPKKQGGASGGGGGGGFMKKLGRLNPFVR-----DPLAGGKVRTKPPKDRRHSIS  613



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (61%), Gaps = 18/184 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  ++ L+   +R  +D +YRAIDIYLKAHP L + ER+ VCSVMD 
Sbjct  382  AEIASDRNLSVSKFISLSELIPDRSRATEDGMYRAIDIYLKAHPGLSDTERKTVCSVMDC  441

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD----  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +S+P A A   +   D    
Sbjct  442  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGGESSPAAAAAAAKGSPDSEEV  501

Query  394  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKK  230
              L +EN  L+ E+L++KM + + +            ++AS VRKP     +F SS+S+K
Sbjct  502  AFLRRENRELKMEVLRLKMKLKEWET---------PAAAASVVRKPPLPKKSFMSSVSQK  552

Query  229  LGKL  218
            LGKL
Sbjct  553  LGKL  556



>ref|NP_001152299.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG46890.1| transposon protein Mutator sub-class [Zea mays]
Length=597

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 108/190 (57%), Gaps = 13/190 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  
Sbjct  382  EIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKAVCRVMDCQ  441

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ  401
            KLS EA  HA+ N RLPVQ V+  L+++Q ++R        G E P   P+      +  
Sbjct  442  KLSREACAHAAHNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSV  501

Query  400  AD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSM  239
             D    L +ENE L+ ELL++KM + D     Q   +           +A     F +++
Sbjct  502  PDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNV  561

Query  238  SKKLGKLNPF  209
            SKKLG+LNPF
Sbjct  562  SKKLGRLNPF  571



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 122/220 (55%), Gaps = 16/220 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA    +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  406  AEIAIDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDC  465

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQ  407
             KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  +T   
Sbjct  466  QKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVH  525

Query  406  LQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TF  251
            +  D    L ++NE L+ EL +MKM + +++   +    S   G++  +  KP     +F
Sbjct  526  MVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSF  585

Query  250  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
             + +SK+LGKL+PF      T     G     K RR   S
Sbjct  586  MNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  625



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 128/240 (53%), Gaps = 38/240 (16%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A    L +SKF  +A L+ + +R V+D LYRA+DI+LKAHP L E +R+++C +MDP
Sbjct  372  AEVAPDANLKVSKFIALAELLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRN  410
             +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A A R+
Sbjct  432  QRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRS  491

Query  409  QLQADV----------------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgss  278
               A                   L +EN+ L+ EL +MK+ ++D++ + S   S      
Sbjct  492  STAAANAAAAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEK  551

Query  277  asaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
              +    +         FF ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  552  RLSSPTSSAASSPGSGRFFHTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  607



>ref|XP_010412682.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 126/229 (55%), Gaps = 36/229 (16%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC++MD 
Sbjct  356  AEIASDRNVNLAKFIGFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVCNLMDC  415

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT           
Sbjct  416  QKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELS  475

Query  415  --RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP  257
               N+L     L +EN+ L+ EL+++KM   +++    +   +         S ++V KP
Sbjct  476  SYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKP  532

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                 +F SS+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  533  RLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  571



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 121/202 (60%), Gaps = 25/202 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD 
Sbjct  403  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDC  462

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D 
Sbjct  463  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDT  521

Query  391  T----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------K  260
                       L +ENE L+ EL+++KM + +++       ++V  S +          K
Sbjct  522  QFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADK  581

Query  259  P-----TFFSSMSKKLGKLNPF  209
            P     +F SS+SKKLGKL+PF
Sbjct  582  PPLPRRSFISSVSKKLGKLSPF  603



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 128/237 (54%), Gaps = 35/237 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A    L +SKF  +A ++ + +R V+D LYRA+DI+LKAHP L E +R+++C +MDP
Sbjct  372  AEVAPDANLKVSKFIALAEVLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDP  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRN  410
             +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A A R+
Sbjct  432  QRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRS  491

Query  409  QLQADV-------------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  269
               A                L +EN+ L+ EL +MK+ ++D++ + S   S        +
Sbjct  492  STAAANAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEKRLS  551

Query  268  VRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +         FF ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  552  SPTSSAASSPGSGRFFYTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  604



>gb|KEH27511.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=516

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 119/206 (58%), Gaps = 29/206 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVCS+MD 
Sbjct  288  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVCSIMDC  347

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+
Sbjct  348  QRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDI  406

Query  391  -------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------------  272
                   +L +ENE L+ E++++KM + +++             S               
Sbjct  407  QVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSH  466

Query  271  aVRKP-----TFFSSMSKKLGKLNPF  209
            +  KP     +F SS+SKKLGKL+PF
Sbjct  467  SADKPPLPRKSFISSVSKKLGKLSPF  492



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 121/202 (60%), Gaps = 25/202 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D 
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDT  520

Query  391  T----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------K  260
                       L +ENE L+ EL+++KM + +++       ++V  S +          K
Sbjct  521  QFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADK  580

Query  259  P-----TFFSSMSKKLGKLNPF  209
            P     +F SS+SKKLGKL+PF
Sbjct  581  PPLPRRSFISSVSKKLGKLSPF  602



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 128/234 (55%), Gaps = 39/234 (17%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  378  AEIASDRNVSLQKFTGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--------------PNA  425
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +              P  
Sbjct  438  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPK  497

Query  424  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----  257
            +++ N   + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    P    
Sbjct  498  LSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTA  555

Query  256  ----------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                      +F +S+SKKLGKLNPF    +  +           P+ RR SIS
Sbjct  556  SMDKPPLPRKSFINSVSKKLGKLNPFGIPPRGRTK---------PPKDRRHSIS  600



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 121/202 (60%), Gaps = 25/202 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD 
Sbjct  454  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDC  513

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D 
Sbjct  514  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDT  572

Query  391  T----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------K  260
                       L +ENE L+ EL+++KM + +++       ++V  S +          K
Sbjct  573  QFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADK  632

Query  259  P-----TFFSSMSKKLGKLNPF  209
            P     +F SS+SKKLGKL+PF
Sbjct  633  PPLPRRSFISSVSKKLGKLSPF  654



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 121/202 (60%), Gaps = 25/202 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD 
Sbjct  453  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDC  512

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D 
Sbjct  513  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDT  571

Query  391  T----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------K  260
                       L +ENE L+ EL+++KM + +++       ++V  S +          K
Sbjct  572  QFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADK  631

Query  259  P-----TFFSSMSKKLGKLNPF  209
            P     +F SS+SKKLGKL+PF
Sbjct  632  PPLPRRSFISSVSKKLGKLSPF  653



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 130/238 (55%), Gaps = 35/238 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD 
Sbjct  387  AEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDC  446

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L
Sbjct  447  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDL  506

Query  403  Q--AD--VTLVKENEALRTELLQMKM---------------------FIADMQNkgssqg  299
               +D  ++L +ENE L+ EL++MKM                     + + +Q+  SS  
Sbjct  507  HPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPR  566

Query  298  ssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            ++   +    + + +F +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  567  NTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  621



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 128/224 (57%), Gaps = 22/224 (10%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIAT   LS+ KF  +A L+ + +R  +D +YRAIDIYLKAHP L + +R+KVCS+MD  
Sbjct  378  EIATDRNLSVPKFISLAELIPEQSRTTEDGMYRAIDIYLKAHPFLSDTDRKKVCSMMDCQ  437

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQL  404
            KLS EAR HA+QN RLPVQ V   LYYDQ + R+        G+E P +  N     ++L
Sbjct  438  KLSREARAHAAQNNRLPVQSVAQVLYYDQQRRRNDMDGIGSVGSESPLTPENRNVYSSEL  497

Query  403  ---QADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa-------VRKP  257
                 +V+ L +ENE L+ E+ ++ M I + +        S    + ++       + K 
Sbjct  498  YPVSNEVSKLRRENEELKLEIAKLTMKIKESEKCKLESAVSSPLLNVTSPSADKPPLHKK  557

Query  256  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            +F +S+S+KLG+L+PF       ++  D    + + + RRFSIS
Sbjct  558  SFLNSVSRKLGRLSPFSRQDPVITHPKD---PVKQDKIRRFSIS  598



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 130/238 (55%), Gaps = 35/238 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD 
Sbjct  402  AEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L
Sbjct  462  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDL  521

Query  403  Q--AD--VTLVKENEALRTELLQMKM---------------------FIADMQNkgssqg  299
               +D  ++L +ENE L+ EL++MKM                     + + +Q+  SS  
Sbjct  522  HPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPR  581

Query  298  ssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            ++   +    + + +F +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  582  NTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  636



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 119/206 (58%), Gaps = 29/206 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS++KF  +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVCS+MD 
Sbjct  402  AEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVCSIMDC  461

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+
Sbjct  462  QRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDI  520

Query  391  -------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------------  272
                   +L +ENE L+ E++++KM + +++             S               
Sbjct  521  QVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSH  580

Query  271  aVRKP-----TFFSSMSKKLGKLNPF  209
            +  KP     +F SS+SKKLGKL+PF
Sbjct  581  SADKPPLPRKSFISSVSKKLGKLSPF  606



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 114/203 (56%), Gaps = 18/203 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A+   +++ KF GIA  + + +R  DD +YRAID+YLK HP + E+E++K+CS+M+ 
Sbjct  353  AEVASDRNINLVKFMGIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKICSLMNS  412

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QNKRLPV IV   L+ +Q  +R    D  S   A A   +     TL 
Sbjct  413  QKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLS  472

Query  382  ----------KENEALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKP  257
                      +EN+ L+ ELL++KM + +++        +       S      S +R+ 
Sbjct  473  SYNNELSKLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRK  532

Query  256  TFFSSMSKKLGKLNPFKHGSKDT  188
            +F SS+S+KLGKLNPF H  + T
Sbjct  533  SFISSVSRKLGKLNPFGHTQRRT  555



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 114/203 (56%), Gaps = 18/203 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A+   +++ KF GIA  + + +R  DD +YRAID+YLK HP + E+E++K+CS+M+ 
Sbjct  354  AEVASDRNINLVKFMGIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKICSLMNS  413

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QNKRLPV IV   L+ +Q  +R    D  S   A A   +     TL 
Sbjct  414  QKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLS  473

Query  382  ----------KENEALRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKP  257
                      +EN+ L+ ELL++KM + +++        +       S      S +R+ 
Sbjct  474  SYNNELSKLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRK  533

Query  256  TFFSSMSKKLGKLNPFKHGSKDT  188
            +F SS+S+KLGKLNPF H  + T
Sbjct  534  SFISSVSRKLGKLNPFGHTQRRT  556



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 130/233 (56%), Gaps = 36/233 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +++ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  381  AEIASDRNVTLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDPKSTPNAI-----  422
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R        S A  P     A+     
Sbjct  441  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSESSAPQPPQQATAVLPPKL  500

Query  421  -ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs-------sasaV  266
             +  ++L     L +EN+ L+ ELL+MKM + + + +   +  S   S       S +++
Sbjct  501  SSYNDELS---KLKRENQDLKLELLKMKMKLKEFEKESDKKSVSTTMSSIPGSPMSTASM  557

Query  265  RKP------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
             KP      +F +S+SKKLGKLNPF   + +             P+ RR SIS
Sbjct  558  DKPPLPPKKSFINSVSKKLGKLNPFGIPAYNARG------RTKPPKDRRHSIS  604



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 113/192 (59%), Gaps = 17/192 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS++ F  +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC VMD 
Sbjct  381  AEIASDRNLSVTNFINLAEVIPEQARITEDGMYRAIDIYLKAHPVLSDIERKKVCGVMDC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--------TRNQ  407
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++  G++   + P A+         + N 
Sbjct  441  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHDGSQLVATEPPALVPSKRDHQFSTNP  500

Query  406  LQADV-TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--------aVRKPT  254
            +  +V +L +EN+ L+ ELL+MK  + D++    +  ++      +          RK  
Sbjct  501  VSDEVSSLKRENQELKFELLKMKTRLIDIEKPNLNTSATSSPLVITHPSAGKPPLPRKSN  560

Query  253  FFSSMSKKLGKL  218
            F SS+SKKLG+ 
Sbjct  561  FMSSVSKKLGRF  572



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 125/226 (55%), Gaps = 25/226 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  398  AEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDC  457

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  +   A+ 
Sbjct  458  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAET  517

Query  391  T-------------LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-  257
                          L +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP 
Sbjct  518  AAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPP  577

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
                +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  578  LPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  620



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 125/226 (55%), Gaps = 25/226 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  399  AEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  +   A+ 
Sbjct  459  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAET  518

Query  391  T-------------LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-  257
                          L +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP 
Sbjct  519  AAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPP  578

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
                +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  579  LPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 118/201 (59%), Gaps = 20/201 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS++ F  +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC +MD 
Sbjct  381  AEIASDRNLSVTNFINLAEVIPEQARITEDGMYRAIDIYLKAHPALSDIERKKVCGIMDC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR--------NQ  407
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++ +G++   + P A+ +         N 
Sbjct  441  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHNGSQLVATEPPALVSSKRDDQFSTNP  500

Query  406  LQADV-TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa--------VRKPT  254
            +  +V +L +EN+ L+ ELL+MK  + +++   S+  +S      +          RK  
Sbjct  501  VSDEVSSLKRENQELKFELLKMKTRLIEIEKPKSNTSASSSPLVITQPSAGKPPLPRKSN  560

Query  253  FFSSMSKKLGKL---NPFKHG  200
            F SS+SKKLG+    +   HG
Sbjct  561  FMSSVSKKLGRFIRADGLTHG  581



>ref|XP_004985270.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Setaria 
italica]
Length=614

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 126/235 (54%), Gaps = 35/235 (15%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EIA+   L I KF G+A ++ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD  
Sbjct  384  EIASDANLPIDKFTGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEPERKKVCKAMDCQ  443

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------------GAEDP------KS  437
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R              G E P      K 
Sbjct  444  KLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPTHAPSGASSFYGGESPPPSLPYKP  503

Query  436  TPNAIATRNQLQA----DVT-LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssa  275
            TP+ +    +  A    +V+ L +EN+ L+ ELL++KM + D       +  +       
Sbjct  504  TPSLMGRHARGGAAPAEEVSQLQRENDELKMELLRLKMRLRDPSAPLPPTGAAPPPSGRH  563

Query  274  saVRKP----TFFSSMSKKLGKLNPF-KHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            S  +KP     F +++SKKLGKLNPF +H +         +V    P+ RR SI 
Sbjct  564  SMPKKPGAGGGFMNNVSKKLGKLNPFVRHDAMGVP-----KVRTKPPKDRRHSIG  613



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 115/196 (59%), Gaps = 21/196 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC VMD 
Sbjct  401  AEIASDRNLSVSKFISLAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVCGVMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQA  398
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P  +  +  N    
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPTLIPSKTNHFSI  520

Query  397  DV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------R  263
            D+        +L +EN+ L+ ELL+MKM + +++   +   +S                R
Sbjct  521  DIPPVSDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSAASSPLVITHPSADKPPLPR  580

Query  262  KPT-FFSSMSKKLGKL  218
            KP+ F SS+SKKLGK 
Sbjct  581  KPSNFISSVSKKLGKF  596



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 116/201 (58%), Gaps = 26/201 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  384  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  443

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIAT  416
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P  +++
Sbjct  444  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSS  503

Query  415  RNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkgssqgssvkgssas  272
             N   +   L +EN+ L+ ELL+MKM +              M +  SS  S+       
Sbjct  504  YNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPP  561

Query  271  aVRKPTFFSSMSKKLGKLNPF  209
              RK TF +S+S+KLGKLNPF
Sbjct  562  LPRK-TFINSVSRKLGKLNPF  581



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 116/201 (58%), Gaps = 26/201 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  384  AEIASDRNVSLQKFIGLAELIPEQSRITEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  443

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIAT  416
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P  +++
Sbjct  444  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSS  503

Query  415  RNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkgssqgssvkgssas  272
             N   +   L +EN+ L+ ELL+MKM +              M +  SS  S+       
Sbjct  504  YNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPP  561

Query  271  aVRKPTFFSSMSKKLGKLNPF  209
              RK TF +S+S+KLGKLNPF
Sbjct  562  LPRK-TFINSVSRKLGKLNPF  581



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 128/225 (57%), Gaps = 25/225 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD 
Sbjct  398  AEIASDRNLSVSKFISLAELIPEQSRLTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDC  457

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDP------KSTPNAIAT  416
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R     + +E P      K +P +I  
Sbjct  458  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGNLSEAPALPAPSKLSPYSINV  517

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--KP-----  257
                    TL +EN+ L+ EL++MKM + +M+   S+  +    ++A      KP     
Sbjct  518  HPVNDEVSTLRRENQDLKLELVKMKMRLKEMEKPLSASSTPSPLAAARPTSLDKPPLPRK  577

Query  256  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            +F SS+ KKLG+   F      +     G    TKP + RR SIS
Sbjct  578  SFISSVGKKLGR---FIRADGISPQSSKGR---TKPAKDRRHSIS  616



>gb|KFK34271.1| hypothetical protein AALP_AA5G123300 [Arabis alpina]
Length=551

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 124/212 (58%), Gaps = 20/212 (9%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G+A  + + +R  +D +YRAIDIYLKAHP + E+E++KVCS+MD 
Sbjct  354  AEIASDRNINLAKFIGLAECIPEQSRITEDGMYRAIDIYLKAHPNISEVEKKKVCSLMDC  413

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QN RL VQ V+  L+Y+Q  +R    D  S P A    ++L     L 
Sbjct  414  NKLSQEASAHAAQNDRLHVQTVVKVLHYEQQSLRQILRDTDS-PAAYNNDDELS---QLN  469

Query  382  KENEALRTELLQMKMFIADMQNkgssqgssv------kgssasaVRKPTFFSSMSKKLGK  221
            +EN+ L+ ELL++KM   + + + + +  S         +S    R+ +F S +S+KLGK
Sbjct  470  RENQELKLELLKVKMNFKEFEEEKTFEVMSSSDYSLVSIASVVKPRRKSFISYVSRKLGK  529

Query  220  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            LNPF        ++  G   I  P+ RR SIS
Sbjct  530  LNPF--------SMTQGR--IIPPKGRRHSIS  551



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 128/230 (56%), Gaps = 32/230 (14%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS+ KF  +A L+ + +R  +D +YRAIDIYLKAHP + + +R+KVCS+MD 
Sbjct  374  AEIATDRNLSVPKFICLAELMPEKSRTTEDGMYRAIDIYLKAHPFVSDTDRKKVCSMMDF  433

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQL  404
             KLS EAR HA+QN RLP Q V   LYY+Q ++R       S   D  STP+    RN  
Sbjct  434  QKLSREARTHAAQNNRLPAQNVAQILYYEQQRLRDNMDGTGSVGSDSPSTPD---KRNVY  490

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQ---------Nkgssqgssvkgssa  275
             +++         L +ENE L+ E++++K+ I +M+         N      SS      
Sbjct  491  SSELYPATNEVSKLRRENEELKLEIVKLKIKIKEMEKSTVLESPINSPLLNVSSPSADKP  550

Query  274  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
               RK +F +S+S+KLG+L+PF+         D  ++D    + RR+SIS
Sbjct  551  PLPRK-SFLNSVSRKLGRLSPFQRAHPVIRPKDRIQLD----KIRRYSIS  595



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 125/224 (56%), Gaps = 24/224 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+AT   L +SKF  +A L+ +  R  +D +YRAIDIYLKAHP L + E++KVCSVMD 
Sbjct  372  AEVATDRNLPVSKFITLAELIPQLYRSTEDGMYRAIDIYLKAHPILSDTEKKKVCSVMDC  431

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS-------TPNAI  422
             KLS +A  HA+QN RLPVQ V+  LYY+Q ++R       G + P +       +PN +
Sbjct  432  QKLSRDACAHAAQNDRLPVQTVVQVLYYEQQRLRDSVDGSVGWDSPNNFRDKANLSPNGL  491

Query  421  -ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  257
                N+      L +ENE L+ E++++KM + +++       SS     ++ +  KP   
Sbjct  492  NPVSNEFS---NLRRENEELKLEIVKLKMKLKEIERSSLISASSSPVIYASPSADKPPLP  548

Query  256  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  131
              +F +S+SKKLG+L+PF      T N   G V   K RR   S
Sbjct  549  RKSFMNSVSKKLGRLSPFSRAGAAT-NPVKGRVKPDKNRRHSIS  591



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 131/225 (58%), Gaps = 24/225 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++S+F  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCS+MD 
Sbjct  403  AEIASDRNLTVSRFINLAELIPEQSRITEDGMYRAIDIFLKAHPALSDMDRKKVCSLMDC  462

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G      +P      N   A +
Sbjct  463  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNIIGGDSPALPQKMNLYSAGI  522

Query  391  --------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----  257
                     L +ENE L+ EL++MKM + +++    S+ ++     +S  +  KP     
Sbjct  523  PPVSDEISNLKRENEDLKIELVKMKMRLKEIEKSAGSRSATNSPLSNSTPSADKPPLPRK  582

Query  256  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  125
            +F +S+SK+LG+L PF     D+  +  G    TKP + RR SIS
Sbjct  583  SFINSVSKRLGRLYPFVRAEGDS--IPKGR---TKPSKNRRHSIS  622



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 124/228 (54%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P     +        L 
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLS  502

Query  382  ----------KENEALRTELLQMKMFIADMQ-------NkgssqgssvkgssasaVRKP-  257
                      +EN+ L+ ELL+MKM + + +       +  +   +     S ++  KP 
Sbjct  503  SYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPP  562

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLGKLNPF      +    +G      P+ RR SIS
Sbjct  563  LPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 124/228 (54%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P     +        L 
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLS  502

Query  382  ----------KENEALRTELLQMKMFIADMQ-------NkgssqgssvkgssasaVRKP-  257
                      +EN+ L+ ELL+MKM + + +       +  +   +     S ++  KP 
Sbjct  503  SYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPP  562

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLGKLNPF      +    +G      P+ RR SIS
Sbjct  563  LPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|XP_010484509.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Camelina sativa]
Length=548

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 128/227 (56%), Gaps = 27/227 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  328  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  387

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-  389
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++ 
Sbjct  388  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSS  447

Query  388  -------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP--  257
                   L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP  
Sbjct  448  YNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPL  507

Query  256  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
               +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  508  PRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  548



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 128/227 (56%), Gaps = 27/227 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-  389
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++ 
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSS  502

Query  388  -------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP--  257
                   L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP  
Sbjct  503  YNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTTSMDKPPL  562

Query  256  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
               +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  563  PRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 128/227 (56%), Gaps = 27/227 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT-  389
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L   ++ 
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSS  502

Query  388  -------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP--  257
                   L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP  
Sbjct  503  YNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPL  562

Query  256  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
               +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  563  PRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 122/217 (56%), Gaps = 17/217 (8%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+I++F  +A+L+ + +R ++D +YRAIDIYLK+HP L ++ER K+CS+MD 
Sbjct  396  AEIASDHNLTIARFISLADLIPEQSRVIEDGMYRAIDIYLKSHPSLSDMERRKICSLMDS  455

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP----KSTPNAIAT  416
             KLS EA  H ++N RLPV IV+  LYY+Q ++R        G E P    K+T   I  
Sbjct  456  QKLSREACAHVARNDRLPVPIVVQVLYYEQQRLRDVTSGNLIGGESPALSQKATSYGIGY  515

Query  415  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMS  236
             N       L +EN+ L+ EL++++M + +++    +  ++ K        K +F  S+S
Sbjct  516  HNAPDELSRLRRENDDLKLELVRLRMQLKEIEKSSGNIAAADKPPLP----KKSFIHSIS  571

Query  235  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
             KLG L  F H   DT  L   +     P+  R SIS
Sbjct  572  NKLGHLFAFMHS--DTVKLLSDKTRRKPPKVLRHSIS  606



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 124/230 (54%), Gaps = 30/230 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF  IA L  +  R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD 
Sbjct  354  AEIASDRNLSVSKFISIAELTPEQYRMTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDC  413

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS---TPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +   S   T    A       DV
Sbjct  414  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGSSSLNDTSAIPAKPGPYSGDV  473

Query  391  TLV--------KENEALRTELLQMKMFIADMQNkgssqgssvkgssasa-----------  269
             +V        KEN+ L+ EL++MKM + +++    +   S   ++  +           
Sbjct  474  HIVTDEVSSLRKENQDLKLELVKMKMRLNEIEKPSPTAFGSPSPATTVSRPGSADKPPLP  533

Query  268  -VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
             + K +F SS+SKKLG+   F      ++    G    TKP + RR SIS
Sbjct  534  PLPKKSFISSVSKKLGR---FIRADGLSAQGSRGR---TKPAKDRRHSIS  577



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 126/234 (54%), Gaps = 39/234 (17%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF  +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  378  AEIASDRNVSLQKFTCLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  437

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--------------PNA  425
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +              P  
Sbjct  438  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPK  497

Query  424  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----  257
            +++ N   + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    P    
Sbjct  498  LSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTA  555

Query  256  ----------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                      +F +S+SKKLGKL PF    +  +           P+ RR SIS
Sbjct  556  SMDKPPLPRKSFINSVSKKLGKLXPFGIPPRGRTK---------PPKDRRHSIS  600



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 99/152 (65%), Gaps = 11/152 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD 
Sbjct  365  AEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDC  424

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +    N L
Sbjct  425  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDL  484

Query  403  Q--AD--VTLVKENEALRTELLQMKMFIADMQ  320
               +D  ++L +ENE L+ EL++MKM + +++
Sbjct  485  HPVSDELLSLRRENEDLKLELMKMKMRLKEIE  516



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 125/230 (54%), Gaps = 38/230 (17%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G A  + K +R  +D +Y AIDIYLK HP + E+E++KVC +MD 
Sbjct  356  AEIASDRNVNLAKFIGFAECIPKQSRITEDGMYLAIDIYLKTHPNISEMEKKKVCKLMDS  415

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT           
Sbjct  416  QKLSREKCAHAAQNDRLPVQTVVQVLYYEQKSLREILSDSDSPPAAAATVEDTLPPPELR  475

Query  415  --RNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-----ssqgssvkgssasaVRKP  257
               N+L     L +EN+ L+ EL+++KM   +++ +      +S        S ++V KP
Sbjct  476  TYNNELS---KLNRENQDLKLELIKVKMKFKELEKEQKDFEVTSGSDCSSSVSIASVVKP  532

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
                 +F SS+S++LGKLNPF  G K            TKP + RR SIS
Sbjct  533  RLPRKSFMSSVSRQLGKLNPF--GLKQVQ---------TKPAKGRRHSIS  571



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 111/192 (58%), Gaps = 21/192 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+SKF G+  L+ + ++  +D +YRAIDIYLKAH  L EIER+KVCS+MD 
Sbjct  401  AEIASDPNLSVSKFIGLVELIPEQSKANEDGIYRAIDIYLKAHASLIEIERKKVCSLMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------------SGAEDPKSTPNA  425
             KLS EA  HA+QN RLPVQ V+  LYY+Q  +R              S +    +    
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQSLRDAMNGNLTEKEEWLSQSHKANAHSKD  520

Query  424  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFS  245
            ++  N+L   + L +ENE L+ E+++++M + +++        + K        K +  +
Sbjct  521  LSPHNEL---LLLRRENEDLKLEMVKLRMRLKELEKLEKPPNRANKPPLP----KKSLLN  573

Query  244  SMSKKLGKLNPF  209
            SMSKKLGKL PF
Sbjct  574  SMSKKLGKLYPF  585



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 125/220 (57%), Gaps = 28/220 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A +V +  R  +D +Y+AID+YLKAHP L ++ER+KVCSVM+ 
Sbjct  381  AEIASDSNLSVSEFISVAEVVPEQLRITEDMMYKAIDMYLKAHPALSDVERKKVCSVMNC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KL+ EA  HA+QN+RLPVQIV+  LYY+Q ++R        GA DP S P      +  
Sbjct  441  QKLTREACAHAAQNERLPVQIVVQVLYYEQQRLREVMDVSLVGA-DPPSRPPKFNWFSSG  499

Query  403  QADVT-----LVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKP--  257
             + VT     L +EN+ L+ EL+++KM   +++       +S    +    +   R P  
Sbjct  500  ISPVTDEVSSLKRENQDLKFELMKLKMKCREIEKRDDKSAASTPLGITTPPSDKPRLPRK  559

Query  256  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  137
            +F +++S+KLGKL P         +    EV I  P +R+
Sbjct  560  SFITAVSRKLGKLYP---------SFGTDEVTIPSPSKRK  590



>gb|KJB43883.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=375

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 118/198 (60%), Gaps = 20/198 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD 
Sbjct  156  AEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDC  215

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----AD  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++      D
Sbjct  216  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTD  275

Query  394  V--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgss---asaVRKP---  257
            +        +L +ENE L+ EL++MKM + +++   S+  S+          +  KP   
Sbjct  276  IHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLP  335

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +S+SKKLG+L PF
Sbjct  336  RKSFMNSVSKKLGRLYPF  353



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 126/217 (58%), Gaps = 12/217 (6%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             +IA+   LS+S+F  IA ++ + +R  +D +Y+AID YLKAHP L +IER++VCSVM+ 
Sbjct  406  AKIASDNNLSVSQFISIAEVIPEKSRITEDRMYKAIDTYLKAHPALSDIERKRVCSVMNC  465

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--VT  389
             KL+ EA  HA+QN+RLPVQ V+  LY++Q ++R   +      +  +T N    D   +
Sbjct  466  QKLTREACAHAAQNERLPVQTVVQVLYFEQQRLRQVMDGSLDGADESSTDNNPVTDEVSS  525

Query  388  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------aVRKPTFFSSMSKK  230
            L +EN+ L+ EL++MK  + +++  G    +S      +        +R+ +F SS+S+ 
Sbjct  526  LKRENQDLKFELVKMKTRLNEIEKCGDISATSTPVEITTPISSDKPRLRRKSFISSVSET  585

Query  229  LGKLNPFKHGSKDTSNLDDGEVDITKP--RRRRFSIS  125
            LGKL P   G+ D   +        KP  R RR+SIS
Sbjct  586  LGKLYPISFGA-DHVIMPSASKGRYKPISRDRRYSIS  621



>gb|KJB43882.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
 gb|KJB43884.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=487

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 118/198 (60%), Gaps = 20/198 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD 
Sbjct  268  AEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDC  327

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----AD  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++      D
Sbjct  328  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTD  387

Query  394  V--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas---aVRKP---  257
            +        +L +ENE L+ EL++MKM + +++   S+  S+          +  KP   
Sbjct  388  IHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLP  447

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +S+SKKLG+L PF
Sbjct  448  RKSFMNSVSKKLGRLYPF  465



>ref|XP_006290338.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
 gb|EOA23236.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
Length=532

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 128/228 (56%), Gaps = 34/228 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G A  + K +R  +D LY+AIDIYLK HP + E+E++KVCS++D 
Sbjct  317  AEIASDRNINLAKFIGFAECIPKQSRITEDGLYQAIDIYLKTHPNISEMEKKKVCSLIDC  376

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------------SGAEDPKSTPNAIA  419
             KLS E   HA+QN RLPVQ ++  LYY+Q  +R            + A D    P+ ++
Sbjct  377  QKLSREKCAHAAQNDRLPVQTMVQVLYYEQQHLREILSESDSPAVAATARDTLPPPDELS  436

Query  418  TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV---------  266
            + N   + +   +EN+ L+ EL+++KM   +++ + + +  +     +S+V         
Sbjct  437  SYNNELSKLN--RENQDLKLELIKVKMKFKELEKEKAFEVLTSGSDCSSSVSTASVVKPR  494

Query  265  -RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
             ++ +F SS+S+KLGKLNPF         L  G+     P+ RR SIS
Sbjct  495  LQRKSFISSISRKLGKLNPF--------GLKQGQTK--PPKGRRHSIS  532



>ref|XP_010503666.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 124/229 (54%), Gaps = 36/229 (16%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   ++++KF G A  + K +R  +D +Y+AIDIYLK HP + E+E++KVCS+MD 
Sbjct  356  AEIASDRNVNLAKFIGFAECIPKQSRITEDGMYQAIDIYLKTHPNISEMEKKKVCSLMDC  415

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------  416
             KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A  T           
Sbjct  416  QKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAVTVEDTLTPPELR  475

Query  415  --RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP  257
               N L     L +EN+ L+ EL+++KM   +++ +  +   +         S ++V KP
Sbjct  476  TYNNDLS---KLNRENQDLKLELIKVKMKFKELEKEQKAFEVTSGSDCSSSVSIASVVKP  532

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                 +F SS+S++LGKLN F  G +        +V    P+ RR SIS
Sbjct  533  RLPRKSFMSSVSRQLGKLNLF--GQR--------QVQTKPPKGRRHSIS  571



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 126/229 (55%), Gaps = 29/229 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVTL  386
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +D  S                L
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTKDADSPAPPPPAVAAAVLPPKL  502

Query  385  V----------KENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP  257
                       +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP
Sbjct  503  SSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTNPNSPISTASMDKP  562

Query  256  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                 +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  563  PLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  605



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 124/228 (54%), Gaps = 28/228 (12%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF  +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD 
Sbjct  383  AEIASDRNVSLQKFISLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDC  442

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV  383
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P              L 
Sbjct  443  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPPPAAVLPPKLS  502

Query  382  ----------KENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-  257
                      +EN+ L+ ELL+MKM + + + +   + SS   S+        +++ KP 
Sbjct  503  SYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTNPSSPISTASMGKPP  562

Query  256  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
                +F +S+SKKLGKLNPF           +G      P+ RR SIS
Sbjct  563  LPRKSFINSVSKKLGKLNPFGITPY------NGRGRTKPPKDRRHSIS  604



>gb|AAV50010.1| phototropic response-like protein [Malus domestica]
Length=114

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -2

Query  448  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssas  272
            D     +AI TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G ++  ++       
Sbjct  6    DENDVQDAITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGG  65

Query  271  aVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
              +K  FFS +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  66   GPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  114



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 118/198 (60%), Gaps = 20/198 (10%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD 
Sbjct  392  AEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDC  451

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----AD  395
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++      D
Sbjct  452  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTD  511

Query  394  V--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas---aVRKP---  257
            +        +L +ENE L+ EL++MKM + +++   S+  S+          +  KP   
Sbjct  512  IHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLP  571

Query  256  --TFFSSMSKKLGKLNPF  209
              +F +S+SKKLG+L PF
Sbjct  572  RKSFMNSVSKKLGRLYPF  589



>ref|XP_001769248.1| predicted protein [Physcomitrella patens]
 gb|EDQ65960.1| predicted protein, partial [Physcomitrella patens]
Length=586

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 130/234 (56%), Gaps = 34/234 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA    L+ISKF  +A ++ + AR+VDD LYRA+D++LKAHP + E ER+ +C ++D 
Sbjct  359  AEIAPDANLTISKFMALAEVLPEHARRVDDGLYRAVDVFLKAHPAIIEAERKTLCKIIDC  418

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----AEDP--------KSTPNAI  422
             KLS +A  HA+QN+RLPVQ+V+  LY++QL++R+        DP        + T   +
Sbjct  419  QKLSQDACTHAAQNERLPVQVVVQVLYFEQLRLRNAMSTINTRDPVLRLQLSQRMTVGNV  478

Query  421  ATRNQLQADVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFS  245
            AT      +   V +EN  L+ E+ +M+M + +++   ++    +  +   +     F  
Sbjct  479  ATGQPPNENYESVRRENRDLKLEIARMRMRMTELERDQNNLKVDIVKNGGGSR----FID  534

Query  244  SMSKKLGKLNPF-KHGSKDTSNLDDGEVDI-------------TKPRRRRFSIS  125
            SMSKKL KLNPF +  S+D  N   GE+                KPRRRR S+S
Sbjct  535  SMSKKLSKLNPFQRRESRDFKN--SGELGTNSSGTPLTPDTRSAKPRRRRHSVS  586



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 115/236 (49%), Gaps = 36/236 (15%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            EI++   L + KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC VMD  
Sbjct  395  EISSDANLPVDKFVALATLIPERARFNEDGMYRAIDIYLKAHPGLGEGERKKVCGVMDCQ  454

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---------------GAEDPK-STPN  428
            KLS EA  HA+QN RLPVQ V+  LY++Q ++R+               G E P  S   
Sbjct  455  KLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRASQTPSHSQAPSYAGGGGESPALSYKP  514

Query  427  AIATRNQLQADVT-------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  269
            +   R++     +       L +EN+ LR EL+QMKM + D               ++  
Sbjct  515  SFNGRDRSAPSPSSSSEMSRLQRENDELRLELMQMKMRLRDPSAAPPVAAGRGGAPASGK  574

Query  268  VRKP--------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
               P               KKLG+LNPF   S     +   +V    P+ RR SIS
Sbjct  575  PPLPKKQGGAGGGGGGGFMKKLGRLNPFVRDS-----VGGAKVRAKPPKDRRHSIS  625



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 120/231 (52%), Gaps = 35/231 (15%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP ++++E++KVCS+MD 
Sbjct  381  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMNDVEKKKVCSLMDC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--  389
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +               A V   
Sbjct  441  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQPPPPAAAATVLPP  500

Query  388  -----------LVKENEALRTELLQMKM-------FIADMQNkgssqgssvkgssasaVR  263
                       L +EN+ L+ E+L+MKM             +  +   +     S +++ 
Sbjct  501  KLSSYNDELSKLKRENQDLKLEILKMKMKLKEFEKENEKKSSSTAMSSNHSSPISTASMD  560

Query  262  KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
            KP     +F +S+S+KLGKLNPF      T            P+ RR SIS
Sbjct  561  KPPLPRKSFMNSVSRKLGKLNPFGITPGRTK----------PPKDRRHSIS  601



>ref|XP_006650337.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Oryza 
brachyantha]
Length=624

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  400  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  459

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   + IAT 
Sbjct  460  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSGIATS  519

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +++++
Sbjct  520  GEAGGWATAVRENQVLKVGMDNMRMRLSELE  550



>gb|EEE59569.1| hypothetical protein OsJ_11863 [Oryza sativa Japonica Group]
Length=513

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  289  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  348

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   ++I T 
Sbjct  349  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTS  408

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +++++
Sbjct  409  GEAGGWATAVRENQVLKVGMDNMRMRLSELE  439



>gb|ABR25380.1| transposon protein [Oryza sativa Indica Group]
Length=279

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 92/152 (61%), Gaps = 11/152 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A  V L + KF  +A  +   AR +DD LYRAIDIYLKAHP L E E+E++C VMD 
Sbjct  50   AEVAPDVNLKLPKFRSLAAAIPDYARPIDDGLYRAIDIYLKAHPHLSESEKEELCRVMDC  109

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQADVT-  389
             KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL   ++ 
Sbjct  110  QKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMVSENLEGGSRQLIPTISG  169

Query  388  ---------LVKENEALRTELLQMKMFIADMQ  320
                       +EN+ALR  +  MK  +AD++
Sbjct  170  EQYRPGWPLASRENQALREGMDNMKQRVADLE  201



>dbj|BAF95168.1| similar to ROOT PHOTOTROPISM2 protein binding [Ipomoea nil]
Length=71

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = -2

Query  334  IADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  155
            IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT
Sbjct  2    IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  61

Query  154  KPRRRRFSIS  125
            KPRRRRFSIS
Sbjct  62   KPRRRRFSIS  71



>ref|XP_010687037.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 94/150 (63%), Gaps = 10/150 (7%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+A  + L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E ERE++C +MD  
Sbjct  412  EVAPDINLKLPKFQALAAAVPEFARPLDDGLYRAIDIYLKSHPWLSESEREQLCRLMDCQ  471

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRN  410
            KLS EA  HA+QN+RLP++I++  L+++QL++R+            E  +   + +   N
Sbjct  472  KLSLEACTHAAQNERLPLRIIVQVLFFEQLQLRNSIAGCFLVSENLEGSRQLRSGMVGSN  531

Query  409  QLQADVTLVKENEALRTELLQMKMFIADMQ  320
            +    VT V+EN+ L+  +  M+M +++++
Sbjct  532  EGGGWVTAVRENQVLKVGMDNMRMRVSELE  561



>gb|ABF97836.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  391  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  450

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   ++I T 
Sbjct  451  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTS  510

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +++++
Sbjct  511  GEAGGWATAVRENQVLKVGMDNMRMRLSELE  541



>gb|ABF97835.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEC75816.1| hypothetical protein OsI_12774 [Oryza sativa Indica Group]
Length=624

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  400  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  459

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   ++I T 
Sbjct  460  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTS  519

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +++++
Sbjct  520  GEAGGWATAVRENQVLKVGMDNMRMRLSELE  550



>ref|XP_004294000.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Fragaria 
vesca subsp. vesca]
Length=638

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 95/153 (62%), Gaps = 13/153 (8%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+A  V L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C +MD  
Sbjct  413  EVAPDVNLKLPKFQALAAAVPEYARHLDDGLYRAIDIYLKSHPWLAEADREQLCRLMDCQ  472

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------------GAEDPKSTPNAIA  419
            KLS EA  HA+QN+RLP++IV+  L+++QL++RS             G+   ++  +  +
Sbjct  473  KLSLEACTHAAQNERLPLRIVVQVLFFEQLQLRSSIAGCFLVSDNLDGSRQIRNGFSGFS  532

Query  418  TRNQLQADVTLVKENEALRTELLQMKMFIADMQ  320
              N+     T V+EN+ L+  +  M+M +++++
Sbjct  533  GSNEGGGWATTVRENQVLKVGMDSMRMRVSELE  565



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 92/151 (61%), Gaps = 16/151 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD 
Sbjct  401  AEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDC  460

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV  392
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  N   A+ 
Sbjct  461  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNIYSAET  520

Query  391  T-------------LVKENEALRTELLQMKM  338
                          L +EN+ L+ EL++MKM
Sbjct  521  AAAAAHPVSDELSILRRENQDLKLELVKMKM  551



>gb|AAT85278.1| NPH3 family protein [Oryza sativa Japonica Group]
Length=650

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  426  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  485

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   ++I T 
Sbjct  486  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTS  545

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +++++
Sbjct  546  GEAGGWATAVRENQVLKVGMDNMRMRLSELE  576



>ref|XP_003561994.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brachypodium 
distachyon]
Length=624

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             E+A+ V L   KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD 
Sbjct  400  AEVASDVNLKPPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDC  459

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   + IAT 
Sbjct  460  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLERSRPLRSGIATS  519

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M++ +A+++
Sbjct  520  GEAGGWTTAVRENQVLKVGMDNMRIRLAELE  550



>ref|XP_010679605.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=520

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+++KF G+A ++ + AR  +D +YRAIDI+LKAHP L ++E++KVCS+MD 
Sbjct  290  AEIASDRNLTVTKFIGVAEVIPEQARVTEDGMYRAIDIFLKAHPLLSDLEKKKVCSLMDC  349

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA  419
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    +   +PN+ A
Sbjct  350  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRESMNETTGSPNSSA  397



>emb|CDY57436.1| BnaAnng14510D [Brassica napus]
Length=603

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/232 (35%), Positives = 120/232 (52%), Gaps = 36/232 (16%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP ++++E++KVCS+MD 
Sbjct  382  AEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNINDVEKKKVCSLMDC  441

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT--  389
             KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +               A V   
Sbjct  442  QKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQPPPPAAAATVLPP  501

Query  388  -----------LVKENEALRTELLQMKM--------FIADMQNkgssqgssvkgssasaV  266
                       L +EN+ L+ E+L+MKM              +   S  +     S +++
Sbjct  502  KLSSYNDELSKLKRENQDLKLEILKMKMKLKEFEKENEKKSSSTAMSSSNHSSPISTASM  561

Query  265  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  125
             KP     +F +S+S+KLGKLNPF      T            P+ RR SIS
Sbjct  562  DKPPLPRKSFMNSVSRKLGKLNPFGITPGRTK----------PPKDRRHSIS  603



>ref|XP_010317168.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Solanum lycopersicum]
Length=570

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 128/228 (56%), Gaps = 25/228 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A ++ +  R  +D +Y+AID+YLKAHP L ++ER+KVCSVM+ 
Sbjct  346  AEIASDSNLSVSEFISVAEVIPEQLRITEDMMYKAIDMYLKAHPALSDVERKKVCSVMNC  405

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KL+ EA  HA+QN RLPVQIV+  LYY+Q ++R        GA DP   P   +  N  
Sbjct  406  QKLTREACAHAAQNDRLPVQIVVQVLYYEQQRLRQVMDVSLVGA-DPPLPPPRPSKFNWF  464

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas----aVRK  260
             + +        +L +EN+ L+ EL+++KM   +++       +S      +      R 
Sbjct  465  SSGISPVTDEISSLKRENQDLKFELMKLKMKCREIEKCDDKSAASTPLGITTPPSDKPRL  524

Query  259  P--TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            P  +F +++S+KLGKL P   G+ D   +        KPRR RR SIS
Sbjct  525  PRKSFITAVSRKLGKLYP-SFGA-DEVTIPSPSKRKNKPRRDRRNSIS  570



>ref|XP_004982336.1| PREDICTED: uncharacterized protein LOC101754459 [Setaria italica]
Length=1185

 Score =   118 bits (295),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 60/151 (40%), Positives = 93/151 (62%), Gaps = 10/151 (7%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C ++D 
Sbjct  399  AEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLLDC  458

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATR  413
             KLS EA  HA+QN+RLP+++V+  L+++QL +R+            E  +   + IAT 
Sbjct  459  QKLSLEACTHAAQNERLPLRVVVQVLFFEQLHLRTSIAGCLLVSDNLEGSRPLRSGIATS  518

Query  412  NQLQADVTLVKENEALRTELLQMKMFIADMQ  320
             +     T V+EN+ L+  +  M+M +A+++
Sbjct  519  GEAGGWATAVRENQVLKVGMDNMRMRLAELE  549



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 113/197 (57%), Gaps = 25/197 (13%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA    L +SKF  IA  +   AR + D LYRAIDIYLKAH  L +++++K+C ++D 
Sbjct  395  AEIAPDANLKLSKFMVIAETLPAHARTIHDGLYRAIDIYLKAHQGLTDLDKKKLCKLIDF  454

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK-----------ST  434
             KLS EA  HA+QN+RLPVQ ++  LY++QL++R+      G +DPK           + 
Sbjct  455  QKLSQEAGAHAAQNERLPVQSIVQVLYFEQLRLRNSLSCSYGEDDPKPIHQSWRISSGAL  514

Query  433  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  254
              A++ R+      +L +EN  L+ EL +++M + D++          +  + S  RK  
Sbjct  515  SAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMKRDMAKSGSRK--  566

Query  253  FFSSMSKKLGKLNPFKH  203
            F SS SKK+GKL+ F H
Sbjct  567  FMSSFSKKIGKLSLFGH  583



>ref|XP_011096666.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Sesamum 
indicum]
Length=633

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 121/214 (57%), Gaps = 18/214 (8%)
 Frame = -2

Query  739  EIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL  560
            E+A  V L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C +MD  
Sbjct  412  EVAPDVNLKLPKFQSLAAAVPEYARPLDDGLYRAIDIYLKSHPWLAESDREQLCRLMDCQ  471

Query  559  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADV----  392
            KLS EA  HA+QN+RLP+++++  L+++QL++R+         + +    QL++ +    
Sbjct  472  KLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRSGLMGPN  531

Query  391  -----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  227
                 T V+EN+ L+  +  M+M +++++          +      V+ P+ + ++SKKL
Sbjct  532  DGGWATAVRENQVLKVGMDNMRMRVSELEK--ECSNMRQEIEKLGKVKGPSTWGNVSKKL  589

Query  226  G-----KLNPFKHGSKDTSNLDDGEVDITKPRRR  140
            G     ++   + GS   S  ++G V I K + +
Sbjct  590  GFRLKSQMCSAQEGS--VSKQNNGNVKIEKAKEK  621



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS+SKF GIA L+ + +R  +D +YRA+DIYLKAHP L ++E++KVCSVMD 
Sbjct  405  AEIATDRNLSVSKFIGIAELIPEQSRITEDGMYRAVDIYLKAHPGLSDMEKKKVCSVMDC  464

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  461
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R
Sbjct  465  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLR  498



>ref|XP_011468062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=615

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS+SKF GIA L+ + +R  +D +YRA+DIYLKAHP L ++E++KVCSVMD 
Sbjct  397  AEIATDRNLSVSKFIGIAELIPEQSRITEDGMYRAVDIYLKAHPGLSDMEKKKVCSVMDC  456

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  461
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R
Sbjct  457  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLR  490



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 128/228 (56%), Gaps = 25/228 (11%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   LS+S+F  +A ++ +  R  +D +Y+AID+YLKAHP L ++ER+KVCSVM+ 
Sbjct  381  AEIASDSNLSVSEFISVAEVIPEQLRITEDMMYKAIDMYLKAHPALSDVERKKVCSVMNC  440

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQL  404
             KL+ EA  HA+QN RLPVQIV+  LYY+Q ++R        GA DP   P   +  N  
Sbjct  441  QKLTREACAHAAQNDRLPVQIVVQVLYYEQQRLRQVMDVSLVGA-DPPLPPPRPSKFNWF  499

Query  403  QADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas----aVRK  260
             + +        +L +EN+ L+ EL+++KM   +++       +S      +      R 
Sbjct  500  SSGISPVTDEISSLKRENQDLKFELMKLKMKCREIEKCDDKSAASTPLGITTPPSDKPRL  559

Query  259  P--TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  125
            P  +F +++S+KLGKL P   G+ D   +        KPRR RR SIS
Sbjct  560  PRKSFITAVSRKLGKLYP-SFGA-DEVTIPSPSKRKNKPRRDRRNSIS  605



>ref|XP_011468065.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Fragaria vesca subsp. vesca]
Length=583

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIAT   LS+SKF GIA L+ + +R  +D +YRA+DIYLKAHP L ++E++KVCSVMD 
Sbjct  365  AEIATDRNLSVSKFIGIAELIPEQSRITEDGMYRAVDIYLKAHPGLSDMEKKKVCSVMDC  424

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  461
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R
Sbjct  425  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLR  458



>ref|XP_010679597.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -2

Query  742  GEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP  563
             EIA+   L+++KF G+A ++ + AR  +D +YRAIDI+LKAHP L ++E++KVCS+MD 
Sbjct  404  AEIASDRNLTVTKFIGVAEVIPEQARVTEDGMYRAIDIFLKAHPLLSDLEKKKVCSLMDC  463

Query  562  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA  419
             KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    +   +PN+ A
Sbjct  464  QKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRESMNETTGSPNSSA  511



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210