BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030K07

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  179   1e-52   Citrus sinensis [apfelsine]
gb|KJB30572.1|  hypothetical protein B456_005G149900                    185   3e-52   Gossypium raimondii
gb|KJB30571.1|  hypothetical protein B456_005G149900                    186   1e-51   Gossypium raimondii
ref|XP_007045633.1|  MATE efflux family protein isoform 1               183   8e-51   
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    183   1e-50   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               183   1e-50   
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              182   2e-50   Gossypium arboreum [tree cotton]
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             174   2e-50   
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             181   9e-50   Citrus clementina [clementine]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   9e-50   Solanum lycopersicum
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   3e-49   Cicer arietinum [garbanzo]
ref|XP_003596992.1|  Transparent testa 12 protein                       179   3e-49   Medicago truncatula
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            179   5e-49   Glycine max [soybeans]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    179   5e-49   Gossypium raimondii
emb|CDP11780.1|  unnamed protein product                                178   6e-49   Coffea canephora [robusta coffee]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM86696.1|  unnamed protein product                                178   6e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            178   7e-49   Nelumbo nucifera [Indian lotus]
emb|CAN73203.1|  hypothetical protein VITISV_008169                     172   8e-49   Vitis vinifera
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   9e-49   Populus euphratica
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   1e-48   Solanum tuberosum [potatoes]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            175   1e-48   
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   1e-48   Solanum lycopersicum
emb|CDM86687.1|  unnamed protein product                                177   2e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            177   4e-48   
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    176   5e-48   Vitis vinifera
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            174   5e-48   Triticum urartu
emb|CBI28938.3|  unnamed protein product                                174   9e-48   Vitis vinifera
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   9e-48   
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   9e-48   Eucalyptus grandis [rose gum]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-47   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            175   1e-47   Glycine soja [wild soybean]
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            174   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-47   Nicotiana sylvestris
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    166   2e-47   Nicotiana alata [flowering tobacco]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   Cucumis melo [Oriental melon]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            174   2e-47   Vitis vinifera
emb|CDM86680.1|  unnamed protein product                                172   3e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            174   3e-47   Vitis vinifera
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   3e-47   Nelumbo nucifera [Indian lotus]
emb|CDP11781.1|  unnamed protein product                                172   3e-47   Coffea canephora [robusta coffee]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   3e-47   Nicotiana tomentosiformis
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   4e-47   Cicer arietinum [garbanzo]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    173   5e-47   Cicer arietinum [garbanzo]
emb|CDM86692.1|  unnamed protein product                                173   5e-47   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            171   6e-47   Triticum urartu
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   6e-47   Sesamum indicum [beniseed]
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   6e-47   Brachypodium distachyon [annual false brome]
emb|CBI28937.3|  unnamed protein product                                173   6e-47   Vitis vinifera
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            171   7e-47   
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            173   7e-47   Phoenix dactylifera
ref|XP_007026056.1|  MATE efflux family protein                         173   9e-47   
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            172   9e-47   Glycine soja [wild soybean]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             172   9e-47   Phaseolus vulgaris [French bean]
ref|XP_002883313.1|  mate efflux family protein                         172   1e-46   
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Oryza brachyantha
ref|NP_188806.1|  MATE efflux family protein                            172   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             170   1e-46   
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   1e-46   Brachypodium distachyon [annual false brome]
gb|AAM20595.1|  integral membrane protein, putative                     172   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          171   2e-46   
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     169   2e-46   Eucalyptus grandis [rose gum]
gb|AAR00628.1|  putative MATE family protein                            169   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    171   3e-46   Gossypium raimondii
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Camelina sativa [gold-of-pleasure]
gb|KJB57730.1|  hypothetical protein B456_009G178100                    171   3e-46   Gossypium raimondii
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Solanum lycopersicum
emb|CDM86677.1|  unnamed protein product                                171   3e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   4e-46   
dbj|BAJ34540.1|  unnamed protein product                                171   4e-46   Eutrema halophilum
emb|CDP04390.1|  unnamed protein product                                169   5e-46   Coffea canephora [robusta coffee]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   6e-46   Setaria italica
gb|ACL53378.1|  unknown                                                 169   6e-46   Zea mays [maize]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   7e-46   Populus euphratica
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              170   7e-46   Gossypium arboreum [tree cotton]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                170   8e-46   Erythranthe guttata [common monkey flower]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    170   9e-46   
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   1e-45   Nicotiana sylvestris
gb|AHI48506.1|  multidrug and toxic extrusion transporter               170   1e-45   Vaccinium corymbosum [American blueberry]
gb|KEH36840.1|  MATE efflux family protein                              169   1e-45   Medicago truncatula
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   1e-45   Populus euphratica
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            169   1e-45   Tarenaya hassleriana [spider flower]
gb|EEC75604.1|  hypothetical protein OsI_12313                          169   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   1e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001050520.1|  Os03g0570800                                       169   1e-45   
emb|CBI23253.3|  unnamed protein product                                162   1e-45   Vitis vinifera
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   2e-45   
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             169   2e-45   Phaseolus vulgaris [French bean]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             169   2e-45   Capsella rubella
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Populus euphratica
ref|XP_006389638.1|  MATE efflux family protein                         169   2e-45   
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   3e-45   
ref|XP_002518492.1|  multidrug resistance pump, putative                168   3e-45   Ricinus communis
emb|CDP17486.1|  unnamed protein product                                168   4e-45   Coffea canephora [robusta coffee]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           168   4e-45   Nicotiana tabacum [American tobacco]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   4e-45   Cucumis melo [Oriental melon]
ref|XP_003605914.1|  Transparent testa 12 protein                       168   5e-45   Medicago truncatula
emb|CBI23254.3|  unnamed protein product                                166   5e-45   Vitis vinifera
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   6e-45   Elaeis guineensis
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    166   7e-45   Populus euphratica
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   8e-45   Cucumis melo [Oriental melon]
dbj|BAH20308.1|  AT1G61890                                              162   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-44   Elaeis guineensis
emb|CAN82750.1|  hypothetical protein VITISV_014577                     165   1e-44   Vitis vinifera
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-44   
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            167   1e-44   Vitis vinifera
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          167   1e-44   Sorghum bicolor [broomcorn]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    166   1e-44   Nicotiana sylvestris
gb|EEC75610.1|  hypothetical protein OsI_12322                          166   2e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                       166   2e-44   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             166   2e-44   Eutrema salsugineum [saltwater cress]
ref|NP_001142368.1|  uncharacterized protein LOC100274540               165   3e-44   Zea mays [maize]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            166   3e-44   
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    166   3e-44   Populus euphratica
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-44   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             165   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   4e-44   Solanum tuberosum [potatoes]
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   5e-44   Zea mays [maize]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             165   5e-44   
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       165   6e-44   Cucumis sativus [cucumbers]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-44   Cicer arietinum [garbanzo]
emb|CBI23251.3|  unnamed protein product                                164   7e-44   Vitis vinifera
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   7e-44   Nicotiana tomentosiformis
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   8e-44   Solanum lycopersicum
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   9e-44   Elaeis guineensis
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   9e-44   Solanum tuberosum [potatoes]
ref|NP_564787.1|  MATE efflux family protein                            164   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Zea mays [maize]
ref|NP_001147791.1|  transparent testa 12 protein                       164   1e-43   Zea mays [maize]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Prunus mume [ume]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Elaeis guineensis
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         164   1e-43   Jatropha curcas
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Brassica rapa
emb|CDY47166.1|  BnaA01g22920D                                          164   1e-43   Brassica napus [oilseed rape]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             164   1e-43   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   1e-43   Solanum tuberosum [potatoes]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Cucumis sativus [cucumbers]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   1e-43   Populus euphratica
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            164   1e-43   Triticum urartu
emb|CDY25329.1|  BnaC01g29980D                                          164   1e-43   Brassica napus [oilseed rape]
gb|AAK82541.1|  At1g61890/F8K4_9                                        164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            164   2e-43   Vitis vinifera
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Prunus mume [ume]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-43   Vitis vinifera
gb|ACZ55931.1|  MATE transporter 2                                      163   3e-43   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                      163   3e-43   Zea mays [maize]
ref|XP_002518495.1|  multidrug resistance pump, putative                163   3e-43   Ricinus communis
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             163   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002886501.1|  mate efflux family protein                         162   4e-43   
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   5e-43   Fragaria vesca subsp. vesca
emb|CDY07257.1|  BnaC04g19140D                                          159   5e-43   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    162   7e-43   Arabis alpina [alpine rockcress]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   8e-43   Setaria italica
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   8e-43   Sesamum indicum [beniseed]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            162   8e-43   
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             162   8e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   9e-43   Malus domestica [apple tree]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   9e-43   Nicotiana sylvestris
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-42   Prunus mume [ume]
dbj|BAD95082.1|  hypothetical protein                                   155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Brassica rapa
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    161   1e-42   Arabis alpina [alpine rockcress]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   161   1e-42   Citrus sinensis [apfelsine]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Brassica rapa
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             161   1e-42   Capsella rubella
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Citrus sinensis [apfelsine]
ref|NP_001148084.1|  transparent testa 12 protein                       161   1e-42   Zea mays [maize]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             161   1e-42   Citrus clementina [clementine]
emb|CDX76391.1|  BnaA08g10090D                                          161   2e-42   
emb|CDY34833.1|  BnaA09g47590D                                          160   2e-42   Brassica napus [oilseed rape]
gb|ABF97209.1|  MATE efflux family protein, expressed                   161   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   2e-42   Brassica rapa
emb|CDY12916.1|  BnaA09g13580D                                          160   2e-42   Brassica napus [oilseed rape]
gb|EEC75606.1|  hypothetical protein OsI_12318                          160   2e-42   Oryza sativa Indica Group [Indian rice]
emb|CDY19507.1|  BnaC09g13960D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    160   3e-42   Nicotiana tomentosiformis
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Prunus mume [ume]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   4e-42   Elaeis guineensis
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             160   4e-42   Prunus persica
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Glycine max [soybeans]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            160   4e-42   Glycine soja [wild soybean]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            160   4e-42   Brassica rapa
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    160   5e-42   Arabis alpina [alpine rockcress]
gb|KGN43522.1|  Mate efflux family protein                              160   5e-42   Cucumis sativus [cucumbers]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             159   5e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   5e-42   
emb|CDY71092.1|  BnaAnng36070D                                          150   5e-42   Brassica napus [oilseed rape]
gb|ACF85024.1|  unknown                                                 152   6e-42   Zea mays [maize]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   7e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   8e-42   Prunus mume [ume]
gb|AFW68307.1|  putative MATE efflux family protein                     157   8e-42   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   8e-42   Brassica rapa
emb|CDX98711.1|  BnaA03g44960D                                          159   9e-42   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   
ref|XP_002867813.1|  mate efflux family protein                         159   1e-41   Arabidopsis lyrata subsp. lyrata
emb|CDY34637.1|  BnaC08g41960D                                          158   1e-41   Brassica napus [oilseed rape]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   1e-41   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   2e-41   
emb|CDX94061.1|  BnaC07g36950D                                          158   2e-41   
gb|ACF85423.1|  unknown                                                 158   2e-41   Zea mays [maize]
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-41   Fragaria vesca subsp. vesca
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   Populus euphratica
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             158   2e-41   
ref|NP_567640.1|  MATE efflux family protein                            157   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62936.1|  unknown                                                 157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   3e-41   Brassica rapa
emb|CDX94063.1|  BnaC07g36970D                                          157   3e-41   
dbj|BAH19969.1|  AT4G21910                                              157   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            157   4e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27434.1|  BnaC03g64740D                                          157   4e-41   Brassica napus [oilseed rape]
emb|CDY27431.1|  BnaC03g64710D                                          157   4e-41   Brassica napus [oilseed rape]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   4e-41   Brassica rapa
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   6e-41   Fragaria vesca subsp. vesca
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             156   7e-41   
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   7e-41   Pyrus x bretschneideri [bai li]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          156   7e-41   Sorghum bicolor [broomcorn]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             156   7e-41   Capsella rubella
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   9e-41   Brassica rapa
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       156   9e-41   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    156   1e-40   Arabis alpina [alpine rockcress]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             156   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Eucalyptus grandis [rose gum]
emb|CDX98713.1|  BnaA03g44980D                                          155   1e-40   
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   1e-40   Nicotiana tomentosiformis
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   1e-40   
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             154   1e-40   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          155   1e-40   Sorghum bicolor [broomcorn]
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   1e-40   Camelina sativa [gold-of-pleasure]
emb|CDX98712.1|  BnaA03g44970D                                          155   1e-40   
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   2e-40   Nicotiana tomentosiformis
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            154   2e-40   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   2e-40   Brassica rapa
ref|XP_007026057.1|  MATE efflux family protein                         155   2e-40   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   2e-40   Sesamum indicum [beniseed]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   2e-40   Populus euphratica
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Brassica rapa
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             155   3e-40   Citrus clementina [clementine]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   4e-40   Brassica rapa
emb|CDX79109.1|  BnaA01g11760D                                          154   4e-40   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   4e-40   Camelina sativa [gold-of-pleasure]
emb|CDY64933.1|  BnaCnng45550D                                          154   4e-40   Brassica napus [oilseed rape]
gb|AGT17221.1|  transparent testa 12 protein                            154   5e-40   Saccharum hybrid cultivar R570
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             154   5e-40   Capsella rubella
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   5e-40   Citrus sinensis [apfelsine]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   5e-40   Populus euphratica
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             154   6e-40   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   6e-40   Populus euphratica
ref|NP_001149176.1|  transparent testa 12 protein                       154   7e-40   Zea mays [maize]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   152   7e-40   Citrus sinensis [apfelsine]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               154   7e-40   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   7e-40   Brachypodium distachyon [annual false brome]
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            153   7e-40   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   8e-40   Brassica rapa
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             153   9e-40   Capsella rubella
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   
ref|NP_172632.1|  MATE efflux family protein                            153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-39   
emb|CAN69304.1|  hypothetical protein VITISV_021604                     156   1e-39   Vitis vinifera
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   Brassica rapa
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                153   1e-39   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             152   2e-39   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   152   2e-39   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-39   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             152   3e-39   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   3e-39   
emb|CDY39494.1|  BnaA01g24940D                                          152   3e-39   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-39   
ref|XP_002892653.1|  mate efflux family protein                         152   4e-39   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             152   4e-39   
emb|CDY33129.1|  BnaCnng07000D                                          152   4e-39   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   5e-39   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   5e-39   
emb|CDY19294.1|  BnaC01g31860D                                          151   6e-39   
gb|AAM98160.1|  unknown protein                                         150   1e-38   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    150   1e-38   
dbj|BAJ90668.1|  predicted protein                                      150   1e-38   
gb|EEE67272.1|  hypothetical protein OsJ_24453                          149   1e-38   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-38   
ref|NP_001119025.1|  mate efflux domain-containing protein              149   2e-38   
emb|CDY24252.1|  BnaC03g42250D                                          143   2e-38   
gb|EEC82143.1|  hypothetical protein OsI_26198                          149   2e-38   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     149   2e-38   
ref|NP_001059785.1|  Os07g0516600                                       149   3e-38   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    154   3e-38   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   3e-38   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   5e-38   
ref|XP_002518493.1|  multidrug resistance pump, putative                149   5e-38   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   9e-38   
ref|XP_002867814.1|  mate efflux family protein                         147   1e-37   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-37   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      147   1e-37   
gb|AGT17223.1|  MATE efflux family protein                              147   1e-37   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   3e-37   
emb|CDY33131.1|  BnaCnng07020D                                          139   4e-37   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            146   4e-37   
emb|CDY38631.1|  BnaA05g19560D                                          145   6e-37   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   7e-37   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       145   9e-37   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    145   1e-36   
emb|CDY39493.1|  BnaA01g24950D                                          145   1e-36   
emb|CDM85992.1|  unnamed protein product                                144   2e-36   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       144   2e-36   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   2e-36   
emb|CDX92916.1|  BnaA03g36380D                                          144   3e-36   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                143   3e-36   
gb|ABF97208.1|  MATE efflux family protein, expressed                   141   4e-36   
ref|NP_001050521.1|  Os03g0571700                                       141   6e-36   
gb|ADE77677.1|  unknown                                                 142   7e-36   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          141   7e-36   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   8e-36   
emb|CDY65669.1|  BnaCnng48120D                                          142   9e-36   
emb|CDP20703.1|  unnamed protein product                                141   1e-35   
gb|ABF97220.1|  MATE efflux family protein, expressed                   142   1e-35   
gb|AAS01962.1|  putative MATE efflux family protein                     142   2e-35   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             141   2e-35   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             141   2e-35   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   2e-35   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   3e-35   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    141   3e-35   
emb|CDX94064.1|  BnaC07g36980D                                          140   3e-35   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         143   4e-35   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   6e-35   
emb|CDP04391.1|  unnamed protein product                                140   6e-35   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       139   7e-35   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   8e-35   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   1e-34   
gb|EPS59093.1|  hypothetical protein M569_15717                         132   2e-34   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                139   2e-34   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   2e-34   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                138   3e-34   
ref|NP_001190793.1|  MATE efflux family protein                         138   4e-34   
gb|ABK24492.1|  unknown                                                 137   4e-34   
gb|EPS67796.1|  hypothetical protein M569_06975                         137   6e-34   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          137   8e-34   
gb|AGT17222.1|  MATE efflux family protein                              134   6e-33   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            135   1e-32   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            134   2e-32   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    127   3e-32   
ref|NP_001190792.1|  mate efflux domain-containing protein              132   3e-32   
emb|CBI28940.3|  unnamed protein product                                123   7e-32   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    130   1e-31   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    130   1e-31   
ref|NP_001065641.2|  Os11g0129000                                       124   3e-31   
emb|CDY19296.1|  BnaC01g31840D                                          124   4e-31   
gb|EEC68782.1|  hypothetical protein OsI_37323                          124   4e-31   
emb|CAA17157.1|  putative protein                                       131   9e-31   
gb|EEC68785.1|  hypothetical protein OsI_37326                          125   1e-29   
ref|NP_001066047.1|  Os12g0126000                                       125   1e-29   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            124   2e-29   
ref|NP_001176768.1|  Os12g0125800                                       121   3e-29   
gb|EEC68781.1|  hypothetical protein OsI_37322                          123   4e-29   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          122   5e-29   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   6e-29   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               122   8e-29   
ref|NP_001176328.1|  Os11g0128900                                       122   9e-29   
ref|NP_001065623.1|  Os11g0126100                                       121   2e-28   
gb|ABA91295.1|  MATE efflux family protein, expressed                   121   2e-28   
ref|NP_001141051.1|  putative MATE efflux family protein                121   2e-28   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   3e-28   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   4e-28   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   1e-27   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   2e-27   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          118   2e-27   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     115   2e-27   
gb|EEC73528.1|  hypothetical protein OsI_07920                          118   3e-27   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg             114   4e-27   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            117   4e-27   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          118   5e-27   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   5e-27   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   5e-27   
emb|CBI31189.3|  unnamed protein product                                117   6e-27   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          117   6e-27   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg             114   6e-27   
emb|CAN63841.1|  hypothetical protein VITISV_021179                     116   7e-27   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   1e-26   
dbj|BAJ90744.1|  predicted protein                                      116   1e-26   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            116   1e-26   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            117   2e-26   
gb|KCW66477.1|  hypothetical protein EUGRSUZ_F00278                     115   2e-26   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   2e-26   
gb|ACG27773.1|  transparent testa 12 protein                            115   3e-26   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   3e-26   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     115   3e-26   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-26   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            115   4e-26   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   5e-26   
gb|ABR16195.1|  unknown                                                 114   5e-26   
gb|ACF87410.1|  unknown                                                 114   6e-26   
gb|AFW55870.1|  putative MATE efflux family protein                     114   6e-26   
emb|CDY01227.1|  BnaC05g25050D                                          109   7e-26   
ref|XP_002530955.1|  multidrug resistance pump, putative                114   7e-26   
emb|CBI31190.3|  unnamed protein product                                113   8e-26   
ref|NP_001130797.1|  putative MATE efflux family protein                114   1e-25   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   1e-25   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    113   1e-25   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    112   2e-25   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          112   2e-25   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    112   2e-25   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
emb|CAN73356.1|  hypothetical protein VITISV_040100                     111   3e-25   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    112   3e-25   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              112   4e-25   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   5e-25   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                          112   5e-25   
ref|XP_007161849.1|  hypothetical protein PHAVU_001G103200g             112   5e-25   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340          111   6e-25   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   7e-25   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     110   7e-25   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   7e-25   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     111   8e-25   
dbj|BAJ95959.1|  predicted protein                                      111   1e-24   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_006349556.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_009123743.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|NP_174584.2|  MATE efflux family protein                            110   1e-24   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             110   2e-24   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            109   2e-24   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             110   2e-24   
ref|XP_007029906.1|  MATE efflux family protein                         110   3e-24   
gb|AAN64140.1|  Putative ripening regulated protein                     108   3e-24   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            109   3e-24   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    109   3e-24   
ref|XP_006375947.1|  hypothetical protein POPTR_0013s06650g             108   3e-24   
ref|XP_002891027.1|  mate efflux family protein                         109   4e-24   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                            110   4e-24   
ref|XP_003520899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
ref|XP_009353041.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    109   4e-24   
ref|XP_006307307.1|  hypothetical protein CARUB_v10008925mg             109   4e-24   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
ref|XP_010528775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
emb|CDY01224.1|  BnaC05g25080D                                          108   5e-24   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                            109   5e-24   
ref|XP_009123739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   5e-24   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_010542192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_009123740.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   5e-24   
ref|XP_002319744.1|  MATE efflux family protein                         108   6e-24   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          109   6e-24   
ref|XP_007051759.1|  MATE efflux family protein                         109   6e-24   
gb|EEC74654.1|  hypothetical protein OsI_10313                          108   6e-24   
ref|XP_010317921.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    108   6e-24   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   6e-24   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          108   6e-24   
ref|XP_008391733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   7e-24   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   7e-24   
ref|XP_006484862.1|  PREDICTED: uncharacterized protein LOC102631182    107   8e-24   
ref|XP_006604281.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   8e-24   
ref|XP_009594771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   9e-24   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130          108   9e-24   
ref|XP_006827534.1|  hypothetical protein AMTR_s00009p00209720          104   9e-24   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   9e-24   
gb|KDP39623.1|  hypothetical protein JCGZ_02643                         108   9e-24   
emb|CDY68535.1|  BnaCnng59430D                                          104   9e-24   
ref|XP_009123741.1|  PREDICTED: protein TRANSPARENT TESTA 12            108   1e-23   
ref|XP_003624779.1|  Transparent testa 12 protein                       108   1e-23   
ref|XP_006604282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   1e-23   
ref|XP_007161850.1|  hypothetical protein PHAVU_001G103300g             108   1e-23   
gb|AFK47801.1|  unknown                                                 103   1e-23   
ref|XP_006576297.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   1e-23   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g             108   1e-23   
gb|KEH25522.1|  MATE efflux family protein                              108   1e-23   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   107   1e-23   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
gb|KHN42169.1|  Protein TRANSPARENT TESTA 12                            107   1e-23   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               108   2e-23   
ref|XP_006415125.1|  hypothetical protein EUTSA_v10009778mg             107   2e-23   
emb|CDY08799.1|  BnaA06g24250D                                          103   2e-23   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   2e-23   



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  39   ALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGC  98

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++
Sbjct  99   YYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDR  158

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  159  WEDKKKPLL  167



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCY
Sbjct  268  LRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W
Sbjct  328  YFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAW  387

Query  330  DAKREPLL  307
            + K EPLL
Sbjct  388  EVKEEPLL  395



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCY
Sbjct  377  LRDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCY  436

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W
Sbjct  437  YFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAW  496

Query  330  DAKREPLL  307
            + K EPLL
Sbjct  497  EVKEEPLL  504



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHV+SY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  375  ALRHVLSYAFTGGEVVAEAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  434

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE A+KRL  
Sbjct  435  YYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLVT  494

Query  333  WDAKREPLL  307
            W+ K+EPLL
Sbjct  495  WEDKKEPLL  503



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  388  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  447

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  448  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  507

Query  327  AKREPLL  307
             K+EPLL
Sbjct  508  DKKEPLL  514



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  387  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  446

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  447  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  506

Query  327  AKREPLL  307
             K+EPLL
Sbjct  507  DKKEPLL  513



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT+GEVVA+AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCY
Sbjct  377  LRDVISYAFTEGEVVAEAVSDLCPLLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCY  436

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W
Sbjct  437  YFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAW  496

Query  330  DAKR-EPLL  307
              K+ EPLL
Sbjct  497  QVKKEEPLL  505



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  65   ALRDVISYAFTGGETVAKAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGC  124

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT+ILLWVTIRTDW KEV+ A KRL  
Sbjct  125  YYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVILLWVTIRTDWNKEVQEALKRLET  184

Query  333  WDAKREPLL  307
            W+ K EPL+
Sbjct  185  WEGKEEPLV  193



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  391  ALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGC  450

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++
Sbjct  451  YYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDR  510

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  511  WEDKKKPLL  519



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQTFVAYVN+GC
Sbjct  382  ALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQTFVAYVNIGC  441

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +
Sbjct  442  YYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVEAAQSRLKK  501

Query  333  WDAKREPLLPK  301
            WD K+E +L +
Sbjct  502  WDDKKESILEE  512



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISYVFT+GE VA AVSDLCPLL+L+++LNG+QPVLSGVAVGCGWQ FVAYVNV C
Sbjct  377  ALRDVISYVFTEGETVAAAVSDLCPLLSLSILLNGIQPVLSGVAVGCGWQAFVAYVNVAC  436

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+
Sbjct  437  YYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIILIWVTFRTDWNKEVEESAKRLNK  496

Query  333  WDAKREPLL  307
            WD K+EPLL
Sbjct  497  WDDKKEPLL  505



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISYVFT+GEVVA AVSDLCPLL+L+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  377  ALRDVISYVFTEGEVVAAAVSDLCPLLSLSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  436

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL+WVT RTDW KEV+ A KRLN+
Sbjct  437  YYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIILMWVTFRTDWNKEVKEAAKRLNK  496

Query  333  W-DAKREPLL  307
            W + K+EPLL
Sbjct  497  WEEKKKEPLL  506



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT GE VA AVSDLCPLLAL+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  375  ALRDVISYAFTGGEEVAAAVSDLCPLLALSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  434

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIILLWVT RTDW KEVE A KRL +
Sbjct  435  YYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIILLWVTFRTDWTKEVEEAAKRLTK  494

Query  333  WDAKREPLL  307
            W+ K+EPLL
Sbjct  495  WEDKKEPLL  503



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  394  RHVISYVFTEGETVAEAVSELCPFLAVTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  453

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+
Sbjct  454  VVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWE  513

Query  327  AKREPLL  307
             KRE LL
Sbjct  514  DKRETLL  520



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR V+SY FT+GEVVADAVSDL PLLALTLVLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  370  ALRRVMSYAFTEGEVVADAVSDLAPLLALTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  429

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G++LGFYF LGAKG+W GM+GGT MQTIILLWVTIRTDW KEVEVA KRL++
Sbjct  430  YYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIILLWVTIRTDWNKEVEVALKRLDK  489

Query  333  W-DAKREPLL  307
            W D K+E LL
Sbjct  490  WEDQKKEALL  499



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  ISY FTDGEVVA AVSDLCPLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  358  LRDYISYAFTDGEVVARAVSDLCPLLATTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  417

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP G++LGF F LGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE AKKRLN+W
Sbjct  418  YIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLNKW  477

Query  330  DAKREPLL  307
            + K+EPLL
Sbjct  478  EDKKEPLL  485



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  364  LRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSY  423

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVT+RTDW KEVE A+KRLN+W
Sbjct  424  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTMRTDWTKEVEEAQKRLNKW  483

Query  330  DAKREPLL  307
            D K+EPLL
Sbjct  484  DEKKEPLL  491



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FT GE VA+AVSDLCPLL++TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  383  LRHVISYAFTSGEAVANAVSDLCPLLSITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  442

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+ILLWVT RT+W KEVE A KRLN+W
Sbjct  443  YILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLILLWVTYRTNWNKEVEEATKRLNKW  502

Query  330  DAKREPLL  307
            + K EPLL
Sbjct  503  EDKPEPLL  510



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  136  LRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  195

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R  +W
Sbjct  196  YIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERXEKW  255

Query  330  DAKREPLL  307
            D K++PLL
Sbjct  256  DDKKQPLL  263



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FTDGE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  272  ALRDVISYAFTDGETVAQAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQGFVAYVNVGC  331

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T+ILLWVT RTDW KEV+ A KRL  
Sbjct  332  YYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVILLWVTCRTDWNKEVQEALKRLET  391

Query  333  WDAKREPLL  307
            W+ K+EPL+
Sbjct  392  WEGKKEPLV  400



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVN+GC
Sbjct  382  ALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNIGC  441

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL  
Sbjct  442  YYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQSRLKM  501

Query  333  WDAKREPLLPK  301
            WD K+E +L +
Sbjct  502  WDDKKESILEE  512



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  268  LRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W
Sbjct  328  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKW  387

Query  330  DAKREPLL  307
              K+EPLL
Sbjct  388  SEKKEPLL  395



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R V+SY FT GEVVA+AVSDLCPLLALTL LNG+QPVLSGVAVGCGWQTFVAYVNVGCY
Sbjct  374  FRDVLSYAFTGGEVVAEAVSDLCPLLALTLALNGIQPVLSGVAVGCGWQTFVAYVNVGCY  433

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL+W+TIRTDW KEVE A+ RLN+W
Sbjct  434  YIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVILIWITIRTDWNKEVEAAQGRLNKW  493

Query  330  DAKREPLLPK  301
              K+EP L +
Sbjct  494  GDKKEPELKE  503



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  366  LRNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSY  425

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W
Sbjct  426  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWSKEVEEAQKRLNKW  485

Query  330  DAKREPLL  307
            D K++PLL
Sbjct  486  DEKKQPLL  493



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FTDG+ V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  435  LRNHISYLFTDGKAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSY  494

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W
Sbjct  495  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKW  554

Query  330  DAKREPLL  307
            D K+EPLL
Sbjct  555  DEKKEPLL  562



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  378  LRHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  437

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+RL +W
Sbjct  438  YIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKW  497

Query  330  DAKREPLL  307
            D K++PLL
Sbjct  498  DDKKQPLL  505



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  303  LRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQKFVAYVNVGSY  362

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT+W +EVE A+KRLN+W
Sbjct  363  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTNWTEEVEEAQKRLNKW  422

Query  330  DAKREPLL  307
            D K+EPLL
Sbjct  423  DEKKEPLL  430



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  306  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  365

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  366  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  425

Query  327  AKREPLL  307
             K++PLL
Sbjct  426  DKKQPLL  432



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  365  LRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  424

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP+G +LGF FNLG KGIW GM+GGT MQT IL+WVT+RTDW KEVE A+KRLN+W
Sbjct  425  YIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAILVWVTLRTDWKKEVEEAQKRLNKW  484

Query  330  DAKREPLL  307
            D K+EPLL
Sbjct  485  DDKKEPLL  492



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  382  ALRHVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  441

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL+WVT RTDW KEVE AK RL++
Sbjct  442  YYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLILIWVTYRTDWNKEVEKAKGRLDK  501

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  502  WEDKKKPLL  510



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  388  AIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGC  447

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+
Sbjct  448  YYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNK  507

Query  333  WDAKREPLL  307
            W+ K EPL+
Sbjct  508  WENKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A+R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  388  AIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGC  447

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+
Sbjct  448  YYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNK  507

Query  333  WDAKREPLL  307
            W+ K EPL+
Sbjct  508  WENKTEPLV  516



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  58   ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  117

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++
Sbjct  118  YYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDK  177

Query  333  WDAKREPLLPK  301
            W  K++ L+ +
Sbjct  178  WSDKKQELVRE  188



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISY FT+GE VADAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  374  ALRHVISYAFTEGEYVADAVSDLCPLLAITVVLNGIQPVLSGVAVGCGWQVFVAYVNVGC  433

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIILLWV  RTDW +EVE A KRLN+
Sbjct  434  YYFVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRLNK  493

Query  333  WDAKRE  316
            W+ K +
Sbjct  494  WEDKHK  499



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  383  ALRNLISYAFTGGEVVAQAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGC  442

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +
Sbjct  443  YYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKK  502

Query  333  WDAKREPLLPK  301
            WD K+E +L +
Sbjct  503  WDDKKESILEE  513



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR+VISY FT+GEVVA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  41   SLRNVISYAFTEGEVVAKEVSELCPYLAVTLILNGIQPVLSGVAVGCGWQTFVAYVNVGC  100

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEVE AKKRL++
Sbjct  101  YYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIILLWVTFRTDWNKEVESAKKRLDK  160

Query  333  WD  328
            W+
Sbjct  161  WE  162



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  380  ALRSVISYTFTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNVGC  439

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+
Sbjct  440  YYVVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNK  499

Query  333  WDAKRE  316
            WD K+E
Sbjct  500  WDDKQE  505



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  ISY FT+GE VA AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  392  LRDYISYAFTEGETVARAVSDLCPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  451

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL+WVT RTDW KEVE AKKRLN+W
Sbjct  452  YIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLILMWVTFRTDWNKEVEEAKKRLNKW  511

Query  330  DAKR-EPLL  307
            D K+ EPLL
Sbjct  512  DGKKEEPLL  520



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  498

Query  327  AKREPLL  307
             K++PLL
Sbjct  499  DKKQPLL  505



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  268  LRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W
Sbjct  328  YIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKW  387

Query  330  -DAKREPLL  307
             D K++PLL
Sbjct  388  DDTKKQPLL  396



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWD  498

Query  327  AKREPLL  307
             K++PLL
Sbjct  499  DKKQPLL  505



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FTDGE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  384  LRHVISYAFTDGERVANAVSDLCPLLAITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  443

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT+W KEVE A KRL  W
Sbjct  444  YVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLILIWVTYRTNWNKEVEEAMKRLETW  503

Query  330  DAKREPLL  307
            D K+EPLL
Sbjct  504  DEKKEPLL  511



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR V+SY FT+GEVVADAVSDL PLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  302  ALRRVMSYAFTEGEVVADAVSDLSPLLAVTVVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  361

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIILLWVTIRTDW+KEVE A +RL++
Sbjct  362  YYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIILLWVTIRTDWIKEVEAALRRLDK  421

Query  333  WDAKRE  316
            W+  ++
Sbjct  422  WEVLKD  427



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  383  ALRNLISYAFTGGEVVAAAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGC  442

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +
Sbjct  443  YYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKK  502

Query  333  WDAKREPLLPK  301
            WD K+E +L +
Sbjct  503  WDDKKEAILEE  513



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  382  ALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGC  441

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+
Sbjct  442  YYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNK  501

Query  333  WDAKREPLLPK  301
            W+ + E L+ +
Sbjct  502  WEDRTETLIKE  512



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  380  ALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGC  439

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+
Sbjct  440  YYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNK  499

Query  333  WDAKREPLLPK  301
            W+ + E L+ +
Sbjct  500  WEDRTETLIKE  510



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GE V+DAV+DL PLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG Y
Sbjct  364  LRNHISYLFTNGEAVSDAVADLSPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSY  423

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W
Sbjct  424  YIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTDWTKEVEEAQKRLNKW  483

Query  330  DAKREPLL  307
            D K++PLL
Sbjct  484  DEKKQPLL  491



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  268  LRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W
Sbjct  328  YIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKW  387

Query  330  -DAKREPLL  307
             D K++PLL
Sbjct  388  DDTKKQPLL  396



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RH+ISY+FT GE VA AV+DLCPLLA+TL+LNGVQPVLSGVAVGCGWQ+FVA +NVGCYY
Sbjct  381  RHIISYIFTGGETVAKAVADLCPLLAVTLLLNGVQPVLSGVAVGCGWQSFVACINVGCYY  440

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGF FNLG KGIW GMIGGT+MQT+ILLWVT RTDW KEVE A+KRL++W+
Sbjct  441  MVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLILLWVTFRTDWNKEVEKARKRLDKWE  500

Query  327  AKREPLLPK  301
               EPLL +
Sbjct  501  EITEPLLKE  509



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCY
Sbjct  268  LRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W
Sbjct  328  YVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKW  387

Query  330  DAKREPLL  307
            +  +EPLL
Sbjct  388  EGSKEPLL  395



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  415  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  474

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD
Sbjct  475  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWD  534

Query  327  AKREPLL  307
             K++PLL
Sbjct  535  DKKQPLL  541



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  268  LRNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W
Sbjct  328  YIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKW  387

Query  330  -DAKREPLL  307
             D K++PLL
Sbjct  388  DDTKKQPLL  396



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  391  LRDYLSYIFTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVACY  450

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W
Sbjct  451  YIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKW  510

Query  330  DAKREPLL  307
            + K++PLL
Sbjct  511  EGKKQPLL  518



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R VISY FT+GE VA AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+
Sbjct  451  VVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWE  510

Query  327  AKREPLL  307
             K+EPLL
Sbjct  511  DKKEPLL  517



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A+R VISY FTDGE VA AVSDLCPLLAL+++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  387  AIRDVISYAFTDGEEVAAAVSDLCPLLALSIILNGIQPVLSGVAVGCGWQTFVAYVNVGC  446

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT  TDW KEVE A KRLN+
Sbjct  447  YYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFGTDWNKEVEEAAKRLNK  506

Query  333  WDAKREPLL  307
            W+ K EPL+
Sbjct  507  WEDKTEPLV  515



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R VISY FT+GEVVA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  379  FRDVISYAFTEGEVVATAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL+WVT RTDW KEVE A KRL+ W
Sbjct  439  YGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVILIWVTFRTDWNKEVEEAAKRLSIW  498

Query  330  DAKREPLL  307
            + K+EP+L
Sbjct  499  EDKKEPVL  506



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  376  ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++
Sbjct  436  YYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDK  495

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  496  WSNKKQEVVPE  506



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FTDGE V+ AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCY
Sbjct  365  FRDYISYIFTDGETVSRAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKTVAYINVGCY  424

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW
Sbjct  425  YFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLILFWITFRTDWNKEVEQAKKRLNQW  484

Query  330  DAKREPLLPKT  298
            D K++PLL  T
Sbjct  485  DDKKQPLLAST  495



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  376  ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++
Sbjct  436  YYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDK  495

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  496  WSNKKQEVVPE  506



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  267  ACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  326

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ 
Sbjct  327  YYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDI  386

Query  333  WDAKR  319
            W  K+
Sbjct  387  WSNKK  391



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCY
Sbjct  360  LRNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCY  419

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W
Sbjct  420  YVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKW  479

Query  330  DAKREPLL  307
            +  +EPLL
Sbjct  480  EGSKEPLL  487



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  376  ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++
Sbjct  436  YYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDK  495

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  496  WSNKKQEVVPE  506



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A+R+VISY FT GEVV++ VSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  330  AIRNVISYAFTGGEVVSNRVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  389

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL WVT+RTDW KEVE A++RLN+
Sbjct  390  YYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIILTWVTLRTDWSKEVETAQQRLNK  449

Query  333  WDAKREPL  310
            W  K+  L
Sbjct  450  WGDKQPAL  457



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  267  ALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  326

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++
Sbjct  327  YYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDK  386

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  387  WEDKKKPLL  395



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCY
Sbjct  268  FRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW
Sbjct  328  YFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQW  387

Query  330  DAKREPLLPKT  298
            + K++PLL  T
Sbjct  388  EDKKQPLLAGT  398



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  388  ALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  447

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++
Sbjct  448  YYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDR  507

Query  333  WDAKREPLL  307
            W+ K++PL 
Sbjct  508  WEDKKQPLF  516



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  376  ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++
Sbjct  436  YYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDK  495

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  496  WSNKKQEVVPE  506



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  369  ALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  428

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++
Sbjct  429  YYVVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDR  488

Query  333  WDAKREPLL  307
            W+ K++PL 
Sbjct  489  WEDKKQPLF  497



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  LRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T RTDW KEVE AK+RL++W
Sbjct  430  YGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRTDWNKEVEKAKERLDKW  489

Query  330  DAKREPLLPK  301
            +  +EPL  K
Sbjct  490  ENVKEPLSKK  499



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  360  FRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNVGCY  419

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W
Sbjct  420  YIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKW  479

Query  330  -DAKREPLL  307
             D K+EPLL
Sbjct  480  DDTKKEPLL  488



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  292  ALRNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  351

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++
Sbjct  352  YYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDK  411

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  412  WEDKKKPLL  420



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  375  ACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  434

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ 
Sbjct  435  YYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDI  494

Query  333  WDAKR  319
            W  K+
Sbjct  495  WSNKK  499



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ +VAYVNVGC
Sbjct  304  SLRHVISYAFTSGGTVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAYVAYVNVGC  363

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL+W T RTDW KEVE A++RL  
Sbjct  364  YYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLRT  423

Query  333  WDAKREPLL  307
            WD K+EPLL
Sbjct  424  WDDKKEPLL  432



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ +SY+FT+GEVV++AV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  364  LRNYVSYLFTEGEVVSNAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  423

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVGVP+GA+LGF F LG KGIW GMIGGTVMQT ILLWVT+RTDW KEVE A+KRLN+W
Sbjct  424  YVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAILLWVTLRTDWSKEVEEAQKRLNKW  483

Query  330  -DAKREPLL  307
             D K EPLL
Sbjct  484  EDKKTEPLL  492



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  333  LRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCY  392

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++
Sbjct  393  YVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDK  452

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  453  WDDKKQPLL  461



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGC
Sbjct  385  ARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGC  444

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++
Sbjct  445  YYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEVEKAKSRLHK  504

Query  333  WDAKREPLL  307
            W+ KR+P L
Sbjct  505  WEDKRKPSL  513



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  388  ALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  447

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++
Sbjct  448  YYVVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDR  507

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  508  WEDKKQPLL  516



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY+FT GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  388  RHVISYIFTGGETVANAVSDLCPFLAVTLLLNGLQPVLSGVAVGCGWQAYVAYVNIGCYY  447

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G +LGF FNLG KGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRL  WD
Sbjct  448  VVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLILLWVTFRTDWNKEVEKAGKRLAMWD  507

Query  327  AKREPLLPKT*KRSIHETK  271
              +EPLL     + + E K
Sbjct  508  DIKEPLLKY--HKEVEEIK  524



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  383  LRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCY  442

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++
Sbjct  443  YVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDK  502

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  503  WDDKKQPLL  511



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  370  SLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  429

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW KEVE AKKRL++
Sbjct  430  YYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKEVECAKKRLDK  489

Query  333  WDAKREPL  310
            W+  + PL
Sbjct  490  WENLKGPL  497



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  393  SLRDVISYAFTSGETVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  452

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL+W T +TDW+KEVE AKKRL++
Sbjct  453  YYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAILIWTTYQTDWIKEVEKAKKRLDK  512

Query  333  WDAKREPLLPKT  298
            WD   +PLL  +
Sbjct  513  WDDINQPLLKAS  524



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISYVFT+GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGC
Sbjct  373  ALRHVISYVFTEGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYINVGC  432

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VGVPVG VLGF FNLG KGIW GMIGGTV+QT+ILLW+T RTDW+KEV  AKKRL++
Sbjct  433  YYGVGVPVGCVLGFKFNLGVKGIWSGMIGGTVLQTLILLWITFRTDWIKEVNTAKKRLDK  492

Query  333  WD  328
            W+
Sbjct  493  WE  494



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GEVVA A SDL P LA TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSISYIFTEGEVVAKAASDLSPFLAATLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN W
Sbjct  430  YLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTW  489

Query  330  DAKREPLLPK  301
            D KR+P LP+
Sbjct  490  DDKRQPPLPE  499



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR V+SY+FT+G+ VA AVSDLCPLLALTLVLNG+QPVLSG+AVGCGWQTFVA VNVGC
Sbjct  374  ALRDVVSYLFTEGKDVAAAVSDLCPLLALTLVLNGIQPVLSGMAVGCGWQTFVAKVNVGC  433

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL WVT  TDW KEV++A KRL+Q
Sbjct  434  YYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIILAWVTFSTDWNKEVDLATKRLDQ  493

Query  333  WDAKREPL  310
            W  ++EPL
Sbjct  494  WSDRKEPL  501



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCY
Sbjct  367  FRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCY  426

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW
Sbjct  427  YFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQW  486

Query  330  DAKREPLLPKT  298
            + K++PLL  T
Sbjct  487  EDKKQPLLAGT  497



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R ++SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  376  ACRDILSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL WVT RTDW KEVE A KR+++
Sbjct  436  YYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFILAWVTFRTDWTKEVEEASKRMDK  495

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  496  WSNKKQEVVPE  506



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCY
Sbjct  367  FRDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCY  426

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW
Sbjct  427  YFVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQW  486

Query  330  DAKREPLLPKT  298
            + K++PLL  T
Sbjct  487  EDKKQPLLAGT  497



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGC
Sbjct  90   SLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGC  149

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++
Sbjct  150  YYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDK  209

Query  333  WDAKR-EPLL  307
            W+ K  EPLL
Sbjct  210  WEDKEDEPLL  219



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY+FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  308  ASRDVLSYLFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  367

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++
Sbjct  368  YYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWNKEVEEASKRMDK  427

Query  333  WDAKREPLLPK  301
            W  +++ ++P+
Sbjct  428  WSNQKQEVVPE  438



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT+GE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCY
Sbjct  388  LRDVISYAFTEGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCY  447

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL+WVT RTDW KEV  A++RLNQW
Sbjct  448  YGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLNQW  507

Query  330  DAKREPLL  307
            +  +EPLL
Sbjct  508  EDVKEPLL  515



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ VADAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  377  ACRDVLSYAFTEGKEVADAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  436

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++
Sbjct  437  YYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDK  496

Query  333  WDAKREPLLPK  301
            W  K++ ++ +
Sbjct  497  WSNKKQDVVSE  507



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ W
Sbjct  430  YLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSW  489

Query  330  DAKREPLL  307
            D KR+PLL
Sbjct  490  DEKRQPLL  497



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISYVFT GE VA+AVS+LCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  380  SLRHVISYVFTGGETVANAVSELCPLLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  439

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++
Sbjct  440  YYVVGIPFGCLIGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWKKEVEKAKSRLHK  499

Query  333  WDAKR  319
            W+ KR
Sbjct  500  WEDKR  504



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VN+GC
Sbjct  387  ACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNIGC  446

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++
Sbjct  447  YYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEEEEASKRMDK  506

Query  333  WDAKREPLLPK  301
            W  K++ ++P+
Sbjct  507  WSNKKQEVVPE  517



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR V+SY FTDGEVV+ AVS+L P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  368  LRDVLSYAFTDGEVVSKAVSELSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  427

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEVE A++RLN W
Sbjct  428  YLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLNSW  487

Query  330  DAKREPLL  307
            + K+EPLL
Sbjct  488  EDKKEPLL  495



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISY+FT+GE VADAVS+L P LA +LVLNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  382  ALRHVISYIFTEGETVADAVSELTPYLAASLVLNGIQPVLSGVAVGCGWQTFVAYVNVGC  441

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+ILLW T RTDW KEVE+A+KRL  
Sbjct  442  YYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRLAT  501

Query  333  WDAKREPLL  307
            WD +++PLL
Sbjct  502  WDDQKQPLL  510



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  370  SLRNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  429

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW K+VE AKKRL++
Sbjct  430  YYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKKVECAKKRLDK  489

Query  333  WDAKREPL  310
            W+  + PL
Sbjct  490  WENLKGPL  497



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R+VI Y FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GC
Sbjct  366  AFRNVIGYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGC  425

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+
Sbjct  426  YYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNK  485

Query  333  WDAKREPLL  307
            WD K+E  L
Sbjct  486  WDVKQESTL  494



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR VISYVFT+GE VA AVSDL PLLAL +VLNGVQPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  389  ALRDVISYVFTEGEEVAAAVSDLSPLLALAIVLNGVQPVLSGVAVGCGWQTFVAYVNVGC  448

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL+WVT RTDW  EV  + KRLN+
Sbjct  449  YYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIILMWVTFRTDWNNEVVESNKRLNK  508

Query  333  WDAKREPLL  307
            W+ K E LL
Sbjct  509  WEGKTESLL  517



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  304  SLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  363

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++
Sbjct  364  YYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDK  423

Query  333  WDAKR-EPLL  307
            W+ K  +PLL
Sbjct  424  WEDKEDQPLL  433



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            +R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  392  IRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACY  451

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL+WVT RTDW KEV  A KRLN+W
Sbjct  452  YIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLILIWVTFRTDWNKEVNEAIKRLNKW  511

Query  330  DAKREPLL  307
            + K++PLL
Sbjct  512  EDKKKPLL  519



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  276  FRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  335

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ W
Sbjct  336  YLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSW  395

Query  330  DAKREPLL  307
            D +R+PLL
Sbjct  396  DDRRQPLL  403



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R VISY+FTDGE VA AVSDLCPLLALTLVLNGVQPVL+GVAVGCGWQ FVAYVN+GCY
Sbjct  385  FRDVISYIFTDGEAVAAAVSDLCPLLALTLVLNGVQPVLTGVAVGCGWQAFVAYVNIGCY  444

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEV+ A KRL++W
Sbjct  445  YIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVILVWVTWRTDWNKEVDEAIKRLSKW  504

Query  330  DAKREPLL  307
            D   +P++
Sbjct  505  DDTAKPVV  512



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  166  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  225

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  226  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  285

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  286  ESREPLLKQ  294



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  391  LRDYLSYTFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  450

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W
Sbjct  451  YIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILIWVTFRTDWNKEVDEAIKRLNKW  510

Query  330  DAKREPLL  307
            + K++PLL
Sbjct  511  EDKKQPLL  518



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGC
Sbjct  267  SLRHVISYAFTGGATVAKEVSDLCPFLAITLILNGVQPVLSGVAVGCGWQAFVAYINVGC  326

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++
Sbjct  327  YYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDK  386

Query  333  W-DAKREPLL  307
            W D + EPLL
Sbjct  387  WEDXEDEPLL  396



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY+FT+G+ V+DAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQT+VA VN+GC
Sbjct  376  ACRDVLSYLFTEGKEVSDAVSDLCPLLAVTIVLNGIQPVLSGVAVGCGWQTYVAKVNIGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++
Sbjct  436  YYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWSKEAEEASKRMDK  495

Query  333  WDAKREPLLPK  301
            W  +++ ++P+
Sbjct  496  WSNQKQEVVPE  506



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT+GE VA AVS+L PLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  361  LRDYLSYIFTEGETVAHAVSELTPLLAITIILNGIQPVLSGVAVGCGWQAFVAYVNVACY  420

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W
Sbjct  421  YIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLNKW  480

Query  330  DAKREPLL  307
            + +++PLL
Sbjct  481  EDEKQPLL  488



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  378  SLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++
Sbjct  438  YYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDK  497

Query  333  WDAKR-EPLL  307
            W+ K  +PLL
Sbjct  498  WEDKEDQPLL  507



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  367  LRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  426

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GA+LGF F LG KGIW GMIGGT MQT ILLWVT+RTDW KEVE A+KRL++W
Sbjct  427  YIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAILLWVTLRTDWNKEVEEAQKRLHKW  486

Query  330  DAKR--EPLL  307
            + K+  EPLL
Sbjct  487  EDKKTTEPLL  496



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT+GE VA+AVSDLCP LA+TL+L+GVQP+ SGVAVGCGWQ FVAYVNVGC 
Sbjct  375  LRNVISYAFTEGETVANAVSDLCPFLAVTLILSGVQPIFSGVAVGCGWQAFVAYVNVGCN  434

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W
Sbjct  435  YAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKW  494

Query  330  DAKREPL  310
               +EPL
Sbjct  495  GNVKEPL  501



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  365  LRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  424

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W
Sbjct  425  YIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKW  484

Query  330  -DAKREPLL  307
             D K+EPLL
Sbjct  485  EDKKKEPLL  493



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  365  LRNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCY  424

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W
Sbjct  425  YIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKW  484

Query  330  -DAKREPLL  307
             D K+EPLL
Sbjct  485  EDKKKEPLL  493



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  385  ACRDVLSYAFTEGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  444

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL WVT RTDWVKEVE A KRL++
Sbjct  445  YYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVILAWVTFRTDWVKEVEEASKRLDK  504

Query  333  WDAKREPLLPK  301
            W  K+  ++P+
Sbjct  505  WSNKKLEVVPE  515



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  312  LRNYISYLFTEGEVVSNAVADLCPLLAVTLVLNGIQPVLSGVAVGCGWQQFVAYVNIGCY  371

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GAVLGF F LG KGIW GMIGGT MQT IL+WVT+RTDW KEVE A+ RL++W
Sbjct  372  YIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAILVWVTLRTDWNKEVEEAQNRLHKW  431

Query  330  DAKR--EPLL  307
            +A +  EPLL
Sbjct  432  EANKTTEPLL  441



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 4/132 (3%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnv  520
             R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNV
Sbjct  360  FRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNV  419

Query  519  gcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  340
            GCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRL
Sbjct  420  GCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRL  479

Query  339  NQW-DAKREPLL  307
            N+W D K+EPLL
Sbjct  480  NKWDDTKKEPLL  491



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  371  FRDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  430

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ W
Sbjct  431  YLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSW  490

Query  330  DAKREPLL  307
            D +R+PLL
Sbjct  491  DDRRQPLL  498



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR  ISY+FT+GE VA AVSDLCPLLA ++VLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  395  SLRDYISYIFTEGETVARAVSDLCPLLAASIVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  454

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP G +LGF F LG KGIWCG+I GTV QT+ILL VT RTDW KEVE AKKRL++
Sbjct  455  YYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLILLVVTFRTDWNKEVEEAKKRLDK  514

Query  333  WDAKREPLL  307
            W+ K EPLL
Sbjct  515  WEEKEEPLL  523



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCY
Sbjct  270  FRDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCY  329

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++W
Sbjct  330  YIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKW  389

Query  330  DAKREPLL  307
            D   +P++
Sbjct  390  DDTAKPIV  397



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ W
Sbjct  430  YLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSW  489

Query  330  DAKREPLL  307
            D K +PLL
Sbjct  490  DEKGQPLL  497



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             RHV+SY FT G+V+A+A SDL PLLA++L+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRHVMSYAFTGGQVIAEAASDLAPLLAISLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+G VLGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W
Sbjct  430  YVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMW  489

Query  330  -DAKREPLL  307
             +  ++PL 
Sbjct  490  QNNSKKPLF  498



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  357  LRNYISYIFTEGEVVSNAVADLCPLLAITLVLNGIQPVLSGVAVGCGWQEFVAYVNVGCY  416

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GA+LGF F LG KGIW GMIGGT MQT IL+W T+RTDW KEVE A+KRLN+W
Sbjct  417  YIVGVPLGAILGFVFKLGVKGIWSGMIGGTFMQTAILVWATLRTDWNKEVEEAQKRLNKW  476

Query  330  -DAK-REPLL  307
             D+K  EPLL
Sbjct  477  ADSKTTEPLL  486



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  FRDSMSYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN W
Sbjct  430  YLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTW  489

Query  330  DAKREPLLPK  301
            D KR+P L +
Sbjct  490  DDKRQPPLQE  499



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISY FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GC
Sbjct  366  ALRNVISYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGC  425

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+G +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KEVE + KRLN+
Sbjct  426  YYIVGVPLGVLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNK  485

Query  333  WDAKRE  316
            WD K+E
Sbjct  486  WDDKQE  491



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISYVFT+GE VA AVSDLCPLL+L+L+LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  374  LRDVISYVFTEGEAVAAAVSDLCPLLSLSLLLNGIQPVLSGVAVGCGWQAFVAYVNVACY  433

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL+WVT RTDW KEV+ A KRLN+W
Sbjct  434  YGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVILMWVTFRTDWNKEVQEADKRLNKW  493

Query  330  DAKREPLL  307
            + K+EPLL
Sbjct  494  EDKKEPLL  501



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  303  LRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  362

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  W
Sbjct  363  YVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETW  422

Query  330  DAKREPLL  307
            D      L
Sbjct  423  DTNNSASL  430



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR+VISY FT+GEVVA  VS LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  370  SLRNVISYAFTEGEVVAKEVSSLCPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  429

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIILLWVT  TDW KEVE A+KRL++
Sbjct  430  YYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKEVESARKRLDK  489

Query  333  WDAKREPL  310
            W+  + PL
Sbjct  490  WENLKGPL  497



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             RHV+SY FT G+V+A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  374  FRHVMSYAFTGGQVIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  433

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+G +LGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W
Sbjct  434  YVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMW  493

Query  330  --DAKRE  316
              ++K++
Sbjct  494  QNNSKKQ  500



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  391  LRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACY  450

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEV  A KRLN+W
Sbjct  451  YIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKW  510

Query  330  DAKREPLL  307
            + K++PLL
Sbjct  511  EDKKQPLL  518



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  LRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T R DW KEVE AKK L++W
Sbjct  430  YGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRADWNKEVEKAKKHLDKW  489

Query  330  DAKREPL  310
            +  +E L
Sbjct  490  ENVKETL  496



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 115/132 (87%), Gaps = 4/132 (3%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  359  LRNYISYIFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQEFVAYVNIGCY  418

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+GA+LGF F  G KGIW GMIGGT MQT ILLW T+RTDW KEVE A+KRL++W
Sbjct  419  YIVGVPLGAILGFVFKFGVKGIWSGMIGGTFMQTAILLWATLRTDWNKEVEEAQKRLHKW  478

Query  330  DAKR----EPLL  307
            + ++    EPLL
Sbjct  479  EDQKTTTTEPLL  490



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY FT GE VA AVSDLCPLLA TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  382  LRDQLSYFFTGGEAVARAVSDLCPLLAATLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  441

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+ILLWVT+RTDW KEVE AK RL++
Sbjct  442  YVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLILLWVTVRTDWNKEVENAKARLDK  501

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  502  WDDKKQPLL  510



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWG  511

Query  327  AKREPL  310
              +EPL
Sbjct  512  KVKEPL  517



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT+GE VA AVS+L PLL+LT++LNG+QPVLSGVAVGCGWQTFVAYVNV CY
Sbjct  392  LRDYLSYIFTEGETVAHAVSELAPLLSLTIILNGIQPVLSGVAVGCGWQTFVAYVNVTCY  451

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G +LGF FN GAKGIW GMIGGT+MQT+ILLWVT RTDW KEV+ A KRL++W
Sbjct  452  YLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVILLWVTFRTDWNKEVDQALKRLDKW  511

Query  330  DAKREPLL  307
            + K++ LL
Sbjct  512  EDKKQHLL  519



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT+GE VA AVS+L PLLA+ L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  377  LRNVISYAFTEGETVAKAVSELSPLLAVALLLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  436

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIILLWVT RTDW+KEVE AK RL++W
Sbjct  437  YLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIILLWVTFRTDWIKEVEKAKMRLDKW  496

Query  330  DAKREPL  310
            D  ++ L
Sbjct  497  DDDKQTL  503



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  372  FRDSISYIFTEGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  431

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++GVP+G +LGF F+LG KGIW GM+GGTV+QT+ILLWVT RTDW  EVEVAK RL+ W
Sbjct  432  YLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLSSW  491

Query  330  DAKREPLL  307
            D KR+PLL
Sbjct  492  DDKRQPLL  499



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  370  LRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  429

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF ++LGAKGIW GMIGGT+MQT IL+W T R DW KEVE AKK L++W
Sbjct  430  YGVGIPLGCLLGFKYDLGAKGIWTGMIGGTIMQTFILIWFTFRADWNKEVEKAKKHLDKW  489

Query  330  DAKREPL  310
            +  +E L
Sbjct  490  ENVKETL  496



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCY
Sbjct  385  FRDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCY  444

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++W
Sbjct  445  YIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKW  504

Query  330  DAKREPLL  307
            D   +P++
Sbjct  505  DDTAKPIV  512



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 5/134 (4%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGC
Sbjct  385  ARRHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGC  444

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE-----VEVAK  349
            YYVVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE     VE AK
Sbjct  445  YYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEMFQFQVEKAK  504

Query  348  KRLNQWDAKREPLL  307
             RL++W+ KR+P L
Sbjct  505  SRLHKWEDKRKPSL  518



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 4/132 (3%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnv  520
             R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNV
Sbjct  360  FRNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNV  419

Query  519  gcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRL  340
            GCYY+VGVP+G +LGF FN G KG+W GMIGGT +QT ILLWVTIRTDW KEVE A+KRL
Sbjct  420  GCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWVTIRTDWSKEVEEAQKRL  479

Query  339  NQW-DAKREPLL  307
            N+W D K+EPLL
Sbjct  480  NKWDDTKKEPLL  491



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRH ISY FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  364  LRHYISYAFTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  423

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W
Sbjct  424  YFVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKW  483

Query  330  DAKREPLLPK  301
            +  ++PLL  
Sbjct  484  EDNKQPLLSN  493



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  376  LRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  435

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  W
Sbjct  436  YVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETW  495

Query  330  DAKREPLL  307
            D      L
Sbjct  496  DTNNSASL  503



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R +ISY FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDIISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQAFVAYVNVGCYY  450

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+
Sbjct  451  LVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWE  510

Query  327  AKREPL  310
              +E L
Sbjct  511  EVKEQL  516



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  378  SLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEVE AK R+ +
Sbjct  438  YYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVENAKSRVEK  497

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  498  WDDKKQPLL  506



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGC
Sbjct  377  SLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGC  436

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++
Sbjct  437  YYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDK  496

Query  333  WDAKR-EPLL  307
            W+ K  EPLL
Sbjct  497  WEDKEDEPLL  506



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  381  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  440

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD
Sbjct  441  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWD  500

Query  327  AKREPLL  307
              + PLL
Sbjct  501  DGKAPLL  507



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD
Sbjct  443  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWD  502

Query  327  AKREPLL  307
              + PLL
Sbjct  503  DGKAPLL  509



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISY FT+GE VA AVS+LCPLLA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  376  ALRNVISYAFTEGETVAKAVSELCPLLAVSLVLNGIQPVLSGVAVGCGWQKFVAYVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+LGA+GIW GM+GGT MQTIILLWVT   DW  EVE A+ RL++
Sbjct  436  YYVVGIPIGCLLGFKFHLGAQGIWSGMLGGTTMQTIILLWVTFHADWNAEVEKARMRLDK  495

Query  333  WDAKREPL  310
            W+  +EPL
Sbjct  496  WEDSKEPL  503



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAKAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISY FT+GE V++AVS L P LA++++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  376  ALRNVISYAFTEGETVSNAVSALSPYLAVSIILNGIQPVLSGVAVGCGWQAFVAYVNVGC  435

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+G VLGF F+ GA+GIW GMIGGT +QT+ILLWVT RTDW KEVE  K RL++
Sbjct  436  YYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLILLWVTFRTDWKKEVENVKNRLDR  495

Query  333  WDAKREPLLPK  301
            WD K+EPLL +
Sbjct  496  WDDKKEPLLTE  506



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  199  RNVISYAFTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  258

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+
Sbjct  259  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWE  318

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  319  ESREPLLKQ  327



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPYLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  385  RDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  444

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+WVKEVE A+KRLN+W+
Sbjct  445  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWVKEVEEAQKRLNKWE  504

Query  327  AKREPLL  307
             ++ PLL
Sbjct  505  -EKSPLL  510



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  ISY+FT G VVA+AVSDL P+LA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVG Y
Sbjct  378  LRDKISYMFTGGTVVAEAVSDLAPILAISLVLNGIQPVLSGVAVGCGWQAFVAYVNVGSY  437

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y +G+P+GAVLGF F LGAKGIW GM+GGT +QTIIL+WVT+RTDW KEVE+A+ RLN+W
Sbjct  438  YFLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTIILIWVTVRTDWNKEVEIARGRLNRW  497

Query  330  DAKRE  316
            + K+E
Sbjct  498  EDKKE  502



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FT GE VA AVS LCPLLA++L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  387  RNVISYAFTGGEAVAQAVSGLCPLLAISLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  446

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP+G++LGFYF  GAKGIW G++GGT+MQTIIL+ V +RTDW KEVE A +RL+QW+
Sbjct  447  IVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQTIILIVVMVRTDWNKEVEKALERLDQWE  506

Query  327  AKREPLLPK  301
             K+EPLL +
Sbjct  507  DKKEPLLKE  515



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  ISY+FT+GEVVA A SDL P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  372  FRDSISYIFTEGEVVAKAASDLSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  431

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+ILL VT RTDW KEVE AK RL+ W
Sbjct  432  YLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLGVTWRTDWNKEVEGAKNRLSTW  491

Query  330  DAKREPLLPK  301
            D K EPLL K
Sbjct  492  DDKSEPLLQK  501



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE VA AVS L P LA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  378  SLRDVISYAFTSGETVAKAVSHLTPYLAVTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEV+ AK R+ +
Sbjct  438  YYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVEK  497

Query  333  WDAKREPLL  307
            WD K +PLL
Sbjct  498  WDDKEQPLL  506



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHV+SY FT GE +A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  379  LRHVMSYAFTSGETIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+G +LGF F L AKGIW GM+GGT MQTIILLWVT RT+W +EVE AK RLN W
Sbjct  439  YVVGIPLGVILGFNFKLEAKGIWLGMLGGTAMQTIILLWVTFRTNWEQEVEKAKSRLNMW  498

Query  330  -DAKREPLL  307
             D  ++PLL
Sbjct  499  QDQSKKPLL  507



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FT+GE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  381  SLRHVISYAFTEGETVANAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +
Sbjct  441  YYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEK  500

Query  333  WDAKRE  316
            WD ++E
Sbjct  501  WDDRQE  506



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY+FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  92   RHVISYIFTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  151

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKEVE A +RL+QW+
Sbjct  152  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE  211

Query  327  AKREPLLPK  301
                PLL +
Sbjct  212  -DTSPLLKQ  219



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISYVFT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  373  AARDYISYVFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGC  432

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  433  YYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  492

Query  333  WDAKREPL  310
            WD K+EPL
Sbjct  493  WDDKKEPL  500



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FTDGE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  378  ACRDVLSYAFTDGETVSAAVSDLCPLLAITLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ 
Sbjct  438  YYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDI  497

Query  333  WDAKREPLLPK  301
            W  K+  ++P+
Sbjct  498  WSNKKLEVVPE  508



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ C
Sbjct  371  ALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIAC  430

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++
Sbjct  431  YYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDK  490

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  491  WEDKQQPLL  499



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  381  AFRDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL W+T RTDW KEVE + KRL++
Sbjct  441  YYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWITFRTDWTKEVEESAKRLDK  500

Query  333  WDAKREPLLPK  301
            W  K+  ++P+
Sbjct  501  WSNKKPEVVPE  511



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAVTIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ C
Sbjct  371  ALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIAC  430

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++
Sbjct  431  YYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDK  490

Query  333  WDAKREPLL  307
            W+ K++PLL
Sbjct  491  WEDKQQPLL  499



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  678  ISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvg  499
            ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG
Sbjct  384  ISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVG  443

Query  498  vpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  319
            +P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  +
Sbjct  444  IPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGK  503

Query  318  EPLL  307
             PLL
Sbjct  504  APLL  507



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ C
Sbjct  371  ALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIAC  430

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++
Sbjct  431  YYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDK  490

Query  333  WDAKREPLLPK  301
            W+ K++PLL  
Sbjct  491  WEDKQQPLLKN  501



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  373  AARDYISYIFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGC  432

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  433  YYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  492

Query  333  WDAKREPL  310
            WD K+EPL
Sbjct  493  WDDKKEPL  500



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  391  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  450

Query  327  AKREPLLPK  301
              + PLL +
Sbjct  451  GSQAPLLKQ  459



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYISYIFTDGEDVATAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  453  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWE  512

Query  327  AKREPLLPK  301
             K  PLL +
Sbjct  513  DK-TPLLSE  520



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYISYIFTDGEDVAAAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  453  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWE  512

Query  327  AKREPLLPK  301
             K  PLL +
Sbjct  513  DKT-PLLSE  520



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+VISY FT GE VA+A   +CP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  374  LRNVISYAFTKGETVANAQYLICPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  433

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W
Sbjct  434  YGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKW  493

Query  330  DAKREPL  310
            +  +EPL
Sbjct  494  ENVKEPL  500



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  398  SLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  457

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +
Sbjct  458  YYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEK  517

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  518  WDDKKQPLL  526



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  398  SLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  457

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +
Sbjct  458  YYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEK  517

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  518  WDDKKQPLL  526



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            + R VISY FTDGE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  381  SFRDVISYAFTDGETVANAVSHLTPYLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW KEVE A  RL +
Sbjct  441  YYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIILLWVTFRTDWNKEVETAGNRLKK  500

Query  333  WDAKREP  313
            W+ K+ P
Sbjct  501  WEDKKLP  507



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  392  LRDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  451

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VG+P+G +LGF FNLGAKGIW GMIGGT +QT+IL+WVT RTDW KEV+ A KRLN+W
Sbjct  452  YIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVDEAIKRLNKW  511

Query  330  DAKREPLL  307
            +  ++ LL
Sbjct  512  EDNKKALL  519



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LRHVISY FTDGE VA+AVS L P LA+TL++NG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  381  SLRHVISYAFTDGETVANAVSHLTPYLAVTLIINGIQPVLSGVAVGCGWQAFVAYVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G +LGF F+ GA+GIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +
Sbjct  441  YYVVGIPLGCLLGFKFDFGAEGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEK  500

Query  333  WDAKRE  316
            WD ++E
Sbjct  501  WDDRKE  506



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  675  SYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgv  496
            SY FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+
Sbjct  381  SYAFTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGI  440

Query  495  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  316
            P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+E
Sbjct  441  PLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKE  500

Query  315  P  313
            P
Sbjct  501  P  501



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  675  SYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgv  496
            SY FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+
Sbjct  380  SYAFTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGI  439

Query  495  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  316
            P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+E
Sbjct  440  PLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKE  499

Query  315  P  313
            P
Sbjct  500  P  500



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  376  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  435

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  495

Query  327  AKREPLLPK  301
              + PLL +
Sbjct  496  DSQAPLLKQ  504



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+GE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  383  ACRDVLSYAFTEGENVSAAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGC  442

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ 
Sbjct  443  YYIIGIPLGALFGFYFKFDAKGIWTGMICGTIIQTVILAWVTFRTDWTKEVEEASKRLDV  502

Query  333  WDAKREPLLPK  301
            W  K+  ++P+
Sbjct  503  WSNKKTEVVPE  513



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV C
Sbjct  371  ALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCC  430

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+
Sbjct  431  YYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINK  490

Query  333  WD  328
            W+
Sbjct  491  WN  492



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISYVFTD  VVA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  379  RHVISYVFTDSPVVAEAVAELAPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  438

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL VT RTDW KEVE A +RL+QW+
Sbjct  439  IVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWE  498

Query  327  AKREPLLPK  301
              + PLL +
Sbjct  499  DTQAPLLKQ  507



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV C
Sbjct  371  ALRNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCC  430

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+
Sbjct  431  YYFVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINK  490

Query  333  WD  328
            W+
Sbjct  491  WN  492



>emb|CDY71092.1| BnaAnng36070D [Brassica napus]
Length=130

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  4    RDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  63

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W 
Sbjct  64   IIGIPLGALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWS  123

Query  327  AKREPLL  307
             K+  ++
Sbjct  124  NKKAEVI  130



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY
Sbjct  60   RDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQALVAYVNVGCYY  119

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+
Sbjct  120  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWE  179

Query  327  AKREPL  310
              + P+
Sbjct  180  DSKAPV  185



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R+ +SY+FT G  V++AV+DL P LA++++LNG+QPVLSGVAVGCGWQ+FVAYVNV CY
Sbjct  380  FRYELSYIFTGGTEVSEAVADLSPFLAISILLNGIQPVLSGVAVGCGWQSFVAYVNVACY  439

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGFYF LG KGIW GMIGGTV+QT+ILLWVT RTDW KEVE A  RL++W
Sbjct  440  YVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVILLWVTFRTDWQKEVEKAASRLDKW  499

Query  330  DAKREPLL  307
            +A +EPLL
Sbjct  500  EAVKEPLL  507



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRH ISYVFT+GE V++AVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  375  LRHDISYVFTEGETVSNAVSDLSPYLAISIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  434

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G +LGF F+ GA+GIW GMIGGT +QTIIL+WVT RTDW KEVE A+ RLN +
Sbjct  435  YIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTIILVWVTYRTDWNKEVEKAQSRLNTY  494

Query  330  DAKREP  313
            + K+EP
Sbjct  495  EDKKEP  500



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgc  514
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGC
Sbjct  269  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGC  328

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+
Sbjct  329  YYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNK  388

Query  333  WDAKREPLL  307
            WD  + PLL
Sbjct  389  WDDGKAPLL  397



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDM  497

Query  333  WDAKREPLL  307
            WD K+EPLL
Sbjct  498  WDDKKEPLL  506



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDM  497

Query  333  WDAKREPLL  307
            WD K+EPLL
Sbjct  498  WDDKKEPLL  506



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT+IL+WVT RT+W KEVE A KRLN+W+
Sbjct  451  IVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQTLILVWVTFRTNWNKEVEEALKRLNKWE  510

Query  327  AKREPLL  307
             K  P+L
Sbjct  511  DK-SPIL  516



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCY
Sbjct  379  FRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ W
Sbjct  439  YVVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMW  498

Query  330  DAKREPL  310
            D K+EPL
Sbjct  499  DDKKEPL  505



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R VISYVFTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
             VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL++W+
Sbjct  391  FVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWE  450

Query  327  AKREPLLPK  301
              + PLL +
Sbjct  451  DTQAPLLKQ  459



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  327  AKREPLLPK  301
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY+FTDGE VA AVS L PLL LTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  412  RDYISYIFTDGEDVAAAVSKLTPLLGLTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  471

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  472  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWE  531

Query  327  AKREPLLPK  301
             K  PLL +
Sbjct  532  DK-TPLLSE  539



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYIGYIFTSDVEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDM  497

Query  333  WDAKREPLL  307
            WD K+EPLL
Sbjct  498  WDDKKEPLL  506



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgc  514
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGC
Sbjct  381  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+
Sbjct  441  YYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNK  500

Query  333  WDAKREPLL  307
            WD  + PLL
Sbjct  501  WDDGKAPLL  509



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  405  SLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  464

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +
Sbjct  465  YYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEK  524

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  525  WDDKKQPLL  533



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R VISY FT+GEVVA AVSDL PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  59   FRDVISYAFTEGEVVAAAVSDLTPLLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCY  118

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y+VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIILLW+TIRTDW KEVE A +RLN W
Sbjct  119  YLVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIILLWITIRTDWKKEVEEAARRLNNW  178

Query  330  DAKREPL  310
            D K EPL
Sbjct  179  DVK-EPL  184



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  398  SLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  457

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +
Sbjct  458  YYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEK  517

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  518  WDDKKQPLL  526



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  408  SLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  467

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +
Sbjct  468  YYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEK  527

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  528  WDDKKQPLL  536



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FT G VV+DAVSDL P LA ++VL GVQPVLSGVAVGCGWQ FVAYVN+ CY
Sbjct  387  LRHVISYAFTSGTVVSDAVSDLSPFLAASIVLGGVQPVLSGVAVGCGWQAFVAYVNLACY  446

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G VLGF  ++GAKGIW GM+GGT MQT++LLW T RT+W KEVE A+ RL+ W
Sbjct  447  YIIGIPLGCVLGFACDMGAKGIWTGMLGGTAMQTLVLLWATFRTNWGKEVEKAQGRLDTW  506

Query  330  DAKREPLLPK  301
            DA  EPLL +
Sbjct  507  DATNEPLLKE  516



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            +LR VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  401  SLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGC  460

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +
Sbjct  461  YYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEK  520

Query  333  WDAKREPLL  307
            WD K++PLL
Sbjct  521  WDDKKQPLL  529



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  ISY FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEV  A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVVEAAKRLNKWG  511

Query  327  AKREPL  310
              +E L
Sbjct  512  EVKETL  517



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCY
Sbjct  379  FRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ W
Sbjct  439  YVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLW  498

Query  330  DAKREPL  310
            D K+EPL
Sbjct  499  DDKKEPL  505



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCY
Sbjct  379  FRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ W
Sbjct  439  YVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLW  498

Query  330  DAKREPL  310
            D K+EPL
Sbjct  499  DDKKEPL  505



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R V+SY FT+GE V+ AVSDLCP LA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGEEVSAAVSDLCPFLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            ++G+P+G + GFYF   AKGIW GMIGGT++QT+IL+WV +RTDW KEVE A KRL++W 
Sbjct  438  IIGIPIGTLFGFYFEYDAKGIWTGMIGGTLIQTVILVWVILRTDWTKEVEKASKRLDKWS  497

Query  327  AKR  319
             K+
Sbjct  498  NKK  500



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYV+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  438  YYVIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  497

Query  333  WDAKREPL  310
            WD K+  L
Sbjct  498  WDDKKNSL  505



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCY
Sbjct  381  FRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCY  440

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ W
Sbjct  441  YVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLW  500

Query  330  DAKREPL  310
            D K+EPL
Sbjct  501  DDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCY
Sbjct  381  FRDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCY  440

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ W
Sbjct  441  YVVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLW  500

Query  330  DAKREPL  310
            D K+EPL
Sbjct  501  DDKKEPL  507



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  373  AARDYISYIFTSDPEVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGC  432

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  433  YYIVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  492

Query  333  WDAKREPL  310
            WD K+EPL
Sbjct  493  WDDKKEPL  500



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDM  497

Query  333  WDAKRE  316
            WD K++
Sbjct  498  WDDKKD  503



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  378  ASRDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDM  497

Query  333  WDAKRE  316
            WD K++
Sbjct  498  WDDKKD  503



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  381  RDYVSYIFTSDIHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  440

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  441  IVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  500

Query  327  AKREP  313
             K+EP
Sbjct  501  EKKEP  505



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 4/132 (3%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  379  LRDVISYAFTSGETVAKAVSKLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCY  438

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVG+P+G VLGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW+KEV  ++ RL +W
Sbjct  439  YVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIILLWVTFRTDWIKEVGTSRDRLEKW  498

Query  330  D----AKREPLL  307
            D     +++PLL
Sbjct  499  DDSNKQQQQPLL  510



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  +SY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  373  AARDYVSYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGC  432

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT +TDW KEVE A+KRL+ 
Sbjct  433  YYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDM  492

Query  333  WDAKREPL  310
            WD K+E L
Sbjct  493  WDDKKESL  500



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+GCY
Sbjct  386  LRHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIGCY  445

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YVVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+W
Sbjct  446  YVVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKW  505

Query  330  DAKREPL  310
            D K EPL
Sbjct  506  DVK-EPL  511



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRH +SY+FT GEVV+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ  VAY+N+GCY
Sbjct  365  LRHKLSYIFTSGEVVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQATVAYINIGCY  424

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+T+RTDW KEVE A+KRL++W
Sbjct  425  YFIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKW  484

Query  330  DAKREPLL  307
            D  R+PLL
Sbjct  485  DDTRQPLL  492



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  377  RDYVSYIFTSDVDVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  436

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+PVG +LGF FN  AKGIW GMIGG++MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  437  IVGIPVGCILGFTFNFQAKGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  496

Query  327  AKREP  313
             K+EP
Sbjct  497  EKKEP  501



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R V+SY FT+GE V+ AVS+LCPLLALTL+LNG+QPVLSGVAVGCGWQTFVA VNVGC
Sbjct  375  ACRDVLSYAFTEGEKVSAAVSELCPLLALTLILNGIQPVLSGVAVGCGWQTFVAKVNVGC  434

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++
Sbjct  435  YYIVGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDK  494

Query  333  WDAKREPLLPK  301
            W   +  ++P+
Sbjct  495  WSNIKLEVVPE  505



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR VISY FT+GEVVA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQT VAY+NVGCY
Sbjct  368  LRDVISYAFTEGEVVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQTLVAYINVGCY  427

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VGVP+G++LGFYF LG KGIW GMIGGTVMQT+IL W+T RTDW KEVE A KRL++W
Sbjct  428  YAVGVPLGSLLGFYFKLGVKGIWLGMIGGTVMQTLILFWITFRTDWNKEVEEATKRLSKW  487

Query  330  DAKREPLL  307
            DA +EP+L
Sbjct  488  DASKEPIL  495



>gb|KFK33086.1| hypothetical protein AALP_AA6G328900 [Arabis alpina]
Length=535

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY+FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  375  RHVISYIFTDSVEVAEAVADLSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  434

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEVE A +RL+QW+
Sbjct  435  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVEKASRRLDQWE  494

Query  327  AKREPLLPK  301
              + PLL +
Sbjct  495  -DQAPLLKQ  502



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRHVISY FT G VVADAV++L P LA ++VLNGVQPVLSGVAVGCGWQ FVAYVNV CY
Sbjct  384  LRHVISYAFTSGTVVADAVAELSPFLAASIVLNGVQPVLSGVAVGCGWQAFVAYVNVACY  443

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G VLGF  ++G KGIW GM+GGT++QTI+LLW TIRT+W KEV  A+ RL++W
Sbjct  444  YIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTIVLLWATIRTNWGKEVGKAQSRLDKW  503

Query  330  DAKREPLLPK  301
            D  +EPLL +
Sbjct  504  DDNKEPLLRE  513



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            ALR+VISYVFT G  V+DAVS+L P LA++++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  384  ALRNVISYVFTSGTTVSDAVSELSPYLAVSIILNGIQPVLSGVAVGCGWQAFVAYVNVGC  443

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+G +LGF F+ GAKGIW GMIGGT++QT+IL+W T RT+W KEVE A+ RL+ 
Sbjct  444  YYIIGIPIGVLLGFKFDFGAKGIWSGMIGGTLIQTMILIWFTSRTNWDKEVEKARNRLDT  503

Query  333  WDAKREPL  310
            W+  +EPL
Sbjct  504  WEDNKEPL  511



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  327  ASRDYISYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGC  386

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  387  YYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  446

Query  333  WDAKRE  316
            WD K  
Sbjct  447  WDDKES  452



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  358  AFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQPVLSGVAVGCGWQTFVAYVNVGC  417

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KEVE A+ RLN+
Sbjct  418  YYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNK  477

Query  333  WDAKREPLLPK  301
            W+  + P +PK
Sbjct  478  WEDNKGP-VPK  487



>ref|XP_010476100.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010476101.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=503

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  376  RHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  435

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASRRLDQWE  495

Query  327  AKREPLLPK  301
                PLL +
Sbjct  496  -DSSPLLKQ  503



>ref|XP_009137228.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=400

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  272  ASRDYISYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGC  331

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  332  YYIVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  391

Query  333  WDAKRE  316
            WD K  
Sbjct  392  WDDKES  397



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR+V+SY FT G  VAD+V++L P LA +++LNGVQPVLSGVAVGCGWQ FVAYVNVGCY
Sbjct  268  LRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQPVLSGVAVGCGWQAFVAYVNVGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W
Sbjct  328  YLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEW  387

Query  330  DAKREPLLPK  301
              K E LL +
Sbjct  388  GDKTEQLLKE  397



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             R  +SY+FT+GE VA AVSDLCPLLA TL+LNG+QPVLSGVAVG  WQ  VAY+NVGCY
Sbjct  371  FRDYLSYIFTEGETVARAVSDLCPLLAATLILNGIQPVLSGVAVG--WQKLVAYINVGCY  428

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE A+KRLNQW
Sbjct  429  YFVGIPLGILLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQW  488

Query  330  DAKREPLL  307
            +  ++PLL
Sbjct  489  EDNKQPLL  496



>ref|XP_010493132.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=503

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  687  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  508
            RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  376  RHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  435

Query  507  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  328
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASRRLDQWE  495

Query  327  AKREPLLPK  301
                PLL +
Sbjct  496  -DSSPLLKQ  503



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGC
Sbjct  378  ASRDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGC  437

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YYVVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ 
Sbjct  438  YYVVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDM  497

Query  333  WDAKREPL  310
            WD K+  L
Sbjct  498  WDDKKNSL  505



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A RHVISY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGC
Sbjct  383  AFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNGIQPVLSGVAVGCGWQTFVAYVNVGC  442

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RTDW KEVE A+ RLN+
Sbjct  443  YYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQTVILVWVTFRTDWNKEVEAAQGRLNK  502

Query  333  WDAKREPLLPK  301
            W+  + P +PK
Sbjct  503  WEDNKGP-VPK  512



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LRH +SY+FT GE V+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ  VAY+N+GCY
Sbjct  268  LRHKLSYIFTGGEAVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQALVAYINIGCY  327

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y +GVP+GA+LGF F+ G KG+W GMIGGT++QTIILLW+T RTDW KEVE A++RL++W
Sbjct  328  YFIGVPLGALLGFKFDYGIKGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKW  387

Query  330  DAKREPLL  307
            D  ++PLL
Sbjct  388  DDAKQPLL  395



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  693  ALRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgc  514
            A R  +SY FT+G+ V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQ FVA VNVGC
Sbjct  381  ACRDFLSYAFTEGKKVSVAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQAFVAKVNVGC  440

Query  513  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  334
            YY++G+P+G + GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++
Sbjct  441  YYIIGIPLGVIFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDK  500

Query  333  WDAKREPLLPK  301
            W  K+  ++P+
Sbjct  501  WSNKKLEVVPE  511



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
            LR V+SY FT G  VADAVS+L P LA++++LNG+QPVL+GVAVGCGWQ FVAYVNVGC+
Sbjct  384  LRRVMSYAFTSGSTVADAVSELSPYLAISVLLNGIQPVLTGVAVGCGWQAFVAYVNVGCF  443

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT+IL++VT RTDW KEVE  + RL++W
Sbjct  444  YFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQTLILMYVTFRTDWTKEVEKTRNRLDRW  503

Query  330  DAKREPLL  307
            + K+EPLL
Sbjct  504  EDKKEPLL  511



>ref|XP_011100217.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Sesamum 
indicum]
Length=507

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  690  LRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcy  511
             RH +SYVFT GEVV+DAV+DL PLLA +++LNGVQPVLSG+ VGCGWQ FVAYVNVGCY
Sbjct  378  FRHQLSYVFTSGEVVSDAVADLTPLLAASIILNGVQPVLSGIFVGCGWQAFVAYVNVGCY  437

Query  510  yvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  331
            YV+GVPVGAVLGF FNLGAKGIW GM+GGT+MQT+IL+W+T+RTDW  EV+ A+ R+++W
Sbjct  438  YVIGVPVGAVLGFVFNLGAKGIWTGMLGGTLMQTLILIWITVRTDWNNEVDKARNRIDKW  497

Query  330  DAKREPLL  307
            +  +E  L
Sbjct  498  NDLKEGFL  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340