BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030J12

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  329   7e-108   Ipomoea batatas [batate]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    305   2e-98    Nicotiana sylvestris
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    305   3e-98    Nicotiana tomentosiformis
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    303   1e-97    Coffea arabica [arabica coffee]
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               303   1e-97    Nicotiana tabacum [American tobacco]
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    303   1e-97    Nicotiana tomentosiformis
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    303   1e-97    Nicotiana sylvestris
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         302   2e-97    Coffea arabica [arabica coffee]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    302   2e-97    Coffea canephora [robusta coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    301   5e-97    Coffea canephora [robusta coffee]
emb|CDP02827.1|  unnamed protein product                                302   1e-96    Coffea canephora [robusta coffee]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    295   2e-94    Platycodon grandiflorus [balloon-flower]
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    293   9e-94    Solanum tuberosum [potatoes]
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    285   2e-93    Lonicera macranthoides
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           290   2e-92    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    289   5e-92    Cynara cardunculus var. scolymus [artichoke]
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              289   6e-92    Cynara cardunculus var. scolymus [artichoke]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    287   2e-91    Lonicera japonica [Japanese honeysuckle]
ref|NP_001275483.1|  HQT                                                287   2e-91    Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               286   4e-91    Solanum tuberosum [potatoes]
gb|AEK80405.1|  HQT                                                     286   5e-91    Lonicera japonica [Japanese honeysuckle]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      285   8e-91    Cynara cardunculus var. scolymus [artichoke]
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              286   9e-91    Cynara cardunculus var. scolymus [artichoke]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    285   1e-90    Cynara cardunculus var. scolymus [artichoke]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             285   3e-90    Cynara cardunculus var. scolymus [artichoke]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    284   3e-90    Cynara cardunculus var. altilis [cultivated cardoon]
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      283   8e-90    Cynara cardunculus var. scolymus [artichoke]
gb|AGE10615.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    276   2e-89    Lonicera macranthoides
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    277   3e-89    Lonicera hypoglauca
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    260   6e-81    Nelumbo nucifera [Indian lotus]
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             255   5e-79    
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    251   1e-77    Hibiscus cannabinus [bimli-jute]
gb|KJB56501.1|  hypothetical protein B456_009G122600                    251   1e-77    Gossypium raimondii
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         251   2e-77    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    251   3e-77    Populus euphratica
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    250   3e-77    Populus euphratica
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    248   3e-77    Garcinia mangostana [mangosteen]
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    250   9e-77    Eucalyptus grandis [rose gum]
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    251   1e-76    Gossypium hirsutum [American cotton]
ref|XP_006840118.1|  hypothetical protein AMTR_s00727p00010990          243   5e-76    
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    247   7e-76    Sesamum indicum [beniseed]
emb|CBI25231.3|  unnamed protein product                                245   2e-75    Vitis vinifera
gb|ADG46003.1|  hydroxycinnamoyl transferase                            246   2e-75    Salvia miltiorrhiza [Chinese salvia]
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    245   2e-75    Salvia miltiorrhiza [Chinese salvia]
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             242   3e-75    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    245   3e-75    Theobroma cacao [chocolate]
gb|AEN02914.1|  HCT1                                                    241   3e-75    Populus nigra [black poplar]
emb|CAN82918.1|  hypothetical protein VITISV_023290                     245   3e-75    Vitis vinifera
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    245   4e-75    Vitis vinifera
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    244   5e-75    Ricinus communis
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    244   7e-75    Platycodon grandiflorus [balloon-flower]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    244   8e-75    Populus tomentosa [Chinese white poplar]
gb|AFS68800.1|  hydroxycinnamoyl transferase                            244   8e-75    Lonicera japonica [Japanese honeysuckle]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    244   1e-74    Coffea canephora [robusta coffee]
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...    238   2e-74    Leucaena leucocephala [cassie]
emb|CBI83579.1|  hydroxycinnamoyl transferase                           243   2e-74    Plectranthus scutellarioides
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    243   2e-74    Coffea canephora [robusta coffee]
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   2e-74    Citrus sinensis [apfelsine]
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   2e-74    Populus euphratica
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    243   3e-74    Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      243   3e-74    Coffea canephora [robusta coffee]
ref|XP_006368492.1|  transferase family protein                         243   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   3e-74    Fragaria vesca subsp. vesca
emb|CDO98242.1|  unnamed protein product                                243   4e-74    Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    243   4e-74    Coffea canephora [robusta coffee]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   4e-74    Populus euphratica
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           242   4e-74    Coffea arabica [arabica coffee]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    242   5e-74    Populus trichocarpa [western balsam poplar]
dbj|BAH57209.1|  AT5G48930                                              238   5e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   6e-74    Tarenaya hassleriana [spider flower]
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   6e-74    Nicotiana sylvestris
gb|KHN38057.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    237   7e-74    Glycine soja [wild soybean]
dbj|BAF49305.1|  putative acyltransferase                               241   8e-74    Clitoria ternatea
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   9e-74    Nicotiana sylvestris
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   9e-74    Nicotiana tomentosiformis
gb|AFR40372.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    233   1e-73    Populus fremontii
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   1e-73    Nicotiana tomentosiformis
gb|AFR40382.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    233   1e-73    Populus fremontii
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   1e-73    Nicotiana tomentosiformis
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             241   1e-73    Prunus persica
gb|AFR40350.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-73    Populus trichocarpa [western balsam poplar]
gb|AFR40387.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-73    Populus nigra [black poplar]
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   2e-73    Pyrus x bretschneideri [bai li]
gb|AEO00530.1|  hydroxycinnamoyl transferase                            239   2e-73    Nicotiana benthamiana
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    241   2e-73    Ipomoea batatas [batate]
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   2e-73    Sesamum indicum [beniseed]
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       241   2e-73    Prunus mume [ume]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   3e-73    
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       240   4e-73    Pyrus x bretschneideri [bai li]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    240   4e-73    Cynara cardunculus [cardoon]
gb|ABR17170.1|  unknown                                                 240   4e-73    Picea sitchensis
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    240   4e-73    Glechoma hederacea [gill-over-the-ground]
ref|XP_002894568.1|  transferase family protein                         239   5e-73    Arabidopsis lyrata subsp. lyrata
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    239   7e-73    Brassica rapa
emb|CDY44162.1|  BnaC01g22120D                                          239   8e-73    Brassica napus [oilseed rape]
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   8e-73    Camelina sativa [gold-of-pleasure]
emb|CDY22880.1|  BnaA01g18180D                                          239   8e-73    Brassica napus [oilseed rape]
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   8e-73    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    239   1e-72    Coffea arabica [arabica coffee]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     240   1e-72    Eucalyptus grandis [rose gum]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    239   1e-72    Malus domestica [apple tree]
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         238   1e-72    Jatropha curcas
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             238   1e-72    Eutrema salsugineum [saltwater cress]
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    238   2e-72    Leucaena leucocephala [cassie]
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   2e-72    Camelina sativa [gold-of-pleasure]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    238   2e-72    Lonicera japonica [Japanese honeysuckle]
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    238   2e-72    Glycine soja [wild soybean]
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   3e-72    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   3e-72    Glycine max [soybeans]
gb|AFR40375.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   3e-72    Populus fremontii
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       238   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    237   4e-72    Arabidopsis thaliana [mouse-ear cress]
gb|AFK40022.1|  unknown                                                 229   4e-72    Medicago truncatula
gb|AFR40386.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   4e-72    Populus fremontii
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    237   6e-72    Glycine max [soybeans]
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    237   6e-72    Solanum lycopersicum
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   7e-72    Glycine max [soybeans]
emb|CDY31956.1|  BnaA07g00390D                                          236   7e-72    Brassica napus [oilseed rape]
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   8e-72    Solanum tuberosum [potatoes]
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    237   8e-72    Glycine max [soybeans]
gb|EPS67512.1|  hypothetical protein M569_07262                         237   9e-72    Genlisea aurea
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             237   1e-71    Phaseolus vulgaris [French bean]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    236   1e-71    Larix kaempferi [karamatsu]
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    236   1e-71    Erythroxylum coca [coca]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   1e-71    Cicer arietinum [garbanzo]
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    236   2e-71    Pinus pinaster [cluster pine]
gb|AFR40374.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-71    Populus fremontii
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   2e-71    Brassica rapa
emb|CDY05770.1|  BnaC07g00330D                                          235   2e-71    
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   2e-71    
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    235   2e-71    Glechoma hederacea [gill-over-the-ground]
dbj|BAF49306.1|  putative acyltransferase                               235   2e-71    Clitoria ternatea
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    236   2e-71    Eucalyptus grandis [rose gum]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   4e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    235   4e-71    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             234   5e-71    Phaseolus vulgaris [French bean]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   234   5e-71    Capsicum annuum
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    234   5e-71    Cynara cardunculus var. scolymus [artichoke]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   5e-71    Camelina sativa [gold-of-pleasure]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 234   5e-71    Phaseolus vulgaris [French bean]
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   6e-71    Cucumis melo [Oriental melon]
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    234   6e-71    Glycine soja [wild soybean]
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    234   7e-71    Pinus radiata
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             234   7e-71    Capsella rubella
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   1e-70    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF85468.1|  unknown                                                 228   1e-70    Zea mays [maize]
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             233   1e-70    Capsella rubella
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   1e-70    Camelina sativa [gold-of-pleasure]
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           233   2e-70    Medicago truncatula
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 233   2e-70    Trifolium pratense [peavine clover]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    233   2e-70    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    232   2e-70    Arabis alpina [alpine rockcress]
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                231   6e-70    Trifolium pratense [peavine clover]
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   6e-70    Eucalyptus grandis [rose gum]
gb|ACF81845.1|  unknown                                                 228   8e-70    Zea mays [maize]
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             231   8e-70    Capsella rubella
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               232   9e-70    Selaginella moellendorffii
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              231   1e-69    Selaginella moellendorffii
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   2e-69    Glycine max [soybeans]
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   2e-69    Elaeis guineensis
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    231   2e-69    Morus notabilis
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    230   3e-69    Nelumbo nucifera [Indian lotus]
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          229   6e-69    Sorghum bicolor [broomcorn]
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    231   8e-69    Glycine soja [wild soybean]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   9e-69    Oryza brachyantha
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         228   1e-68    Jatropha curcas
ref|NP_001132890.1|  LOC100194386                                       228   2e-68    Zea mays [maize]
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             228   3e-68    Zea mays [maize]
ref|NP_001053225.1|  Os04g0500700                                       228   3e-68    
emb|CAE01635.3|  OSJNBa0029H02.19                                       228   4e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149788.1|  hypothetical protein PHAVU_005G0988001g            219   7e-68    Phaseolus vulgaris [French bean]
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      226   8e-68    Avena sativa [cultivated oat]
gb|KJB56505.1|  hypothetical protein B456_009G122600                    225   1e-67    Gossypium raimondii
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   1e-67    Brachypodium distachyon [annual false brome]
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      226   1e-67    Avena sativa [cultivated oat]
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   2e-67    Phoenix dactylifera
gb|EMS64908.1|  Anthranilate N-benzoyltransferase protein 1             223   3e-67    Triticum urartu
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    227   3e-67    Setaria italica
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   3e-67    Pyrus x bretschneideri [bai li]
ref|XP_001756433.1|  predicted protein                                  224   4e-67    
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   4e-67    Setaria italica
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   4e-67    Populus euphratica
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    224   5e-67    Panicum virgatum
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      224   6e-67    Avena sativa [cultivated oat]
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   8e-67    Vitis vinifera
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             223   8e-67    Cucumis sativus [cucumbers]
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   8e-67    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           223   1e-66    Medicago truncatula
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    223   1e-66    
gb|AFR40245.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   1e-66    Populus fremontii
gb|AFR40216.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   1e-66    Populus trichocarpa [western balsam poplar]
gb|AFR40214.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   1e-66    Populus trichocarpa [western balsam poplar]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    223   1e-66    Panicum virgatum
dbj|BAJ87836.1|  predicted protein                                      223   1e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK06288.1|  predicted protein                                      223   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFR40243.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   2e-66    Populus fremontii
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    223   2e-66    Morus notabilis
gb|AFR40251.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   2e-66    Populus nigra [black poplar]
gb|AFR40219.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   2e-66    Populus trichocarpa [western balsam poplar]
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           223   2e-66    Medicago truncatula
gb|AFR40264.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    215   2e-66    Populus nigra [black poplar]
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    222   2e-66    
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    222   3e-66    
gb|AFR40239.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   3e-66    Populus fremontii
ref|NP_001047408.1|  Os02g0611800                                       222   3e-66    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            222   4e-66    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    222   4e-66    Pyrus x bretschneideri [bai li]
ref|NP_001145871.1|  uncharacterized protein LOC100279386               222   4e-66    
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             222   4e-66    
gb|AFR40240.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   4e-66    Populus fremontii
gb|AFR40246.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   4e-66    Populus fremontii
gb|AFR40248.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   5e-66    Populus fremontii
gb|AFR40238.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   6e-66    Populus fremontii
gb|AFR40250.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   6e-66    Populus fremontii
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          222   6e-66    Oryza sativa Japonica Group [Japonica rice]
gb|AFR40231.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   6e-66    Populus alba [abele]
gb|AFR40229.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    213   7e-66    Populus alba [abele]
gb|AFR40230.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    213   7e-66    Populus alba [abele]
gb|AFR40241.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    213   7e-66    Populus fremontii
gb|AFR40223.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    213   1e-65    Populus trichocarpa [western balsam poplar]
gb|AFR40365.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    211   1e-65    Populus alba [abele]
gb|AFR40242.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    213   1e-65    Populus fremontii
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             220   1e-65    
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             221   1e-65    Populus trichocarpa [western balsam poplar]
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                220   2e-65    Erythranthe guttata [common monkey flower]
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    220   2e-65    Brachypodium distachyon [annual false brome]
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             220   2e-65    Zea mays [maize]
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          220   3e-65    Sorghum bicolor [broomcorn]
gb|AFR40233.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    212   3e-65    Populus alba [abele]
emb|CAR40185.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoylt...    213   4e-65    Populus x canadensis [Canadian poplar]
gb|EPS73563.1|  hypothetical protein M569_01193                         215   4e-65    Genlisea aurea
gb|AFR40236.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    211   4e-65    Populus fremontii
gb|AFR40367.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    210   5e-65    Populus alba [abele]
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             219   5e-65    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    219   7e-65    Prunus mume [ume]
gb|EPS67739.1|  hypothetical protein M569_07035                         218   8e-65    Genlisea aurea
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   1e-64    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             218   2e-64    Prunus persica
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             218   2e-64    
dbj|BAJ95750.1|  predicted protein                                      218   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93247.1|  predicted protein                                      217   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   2e-64    Nelumbo nucifera [Indian lotus]
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    216   4e-64    Prunus mume [ume]
ref|XP_007149790.1|  hypothetical protein PHAVU_005G0989001g            210   7e-64    Phaseolus vulgaris [French bean]
gb|KJB68219.1|  hypothetical protein B456_010G233000                    209   8e-64    Gossypium raimondii
gb|KJB54981.1|  hypothetical protein B456_009G057200                    216   8e-64    Gossypium raimondii
gb|KJB68227.1|  hypothetical protein B456_010G233600                    215   1e-63    Gossypium raimondii
gb|KJB68229.1|  hypothetical protein B456_010G233600                    215   1e-63    Gossypium raimondii
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    215   2e-63    Populus euphratica
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    214   4e-63    Populus euphratica
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    212   5e-63    
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    214   6e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             214   6e-63    Populus trichocarpa [western balsam poplar]
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             213   1e-62    Prunus persica
gb|KJB71596.1|  hypothetical protein B456_011G132100                    213   1e-62    Gossypium raimondii
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   1e-62    
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    213   1e-62    Gossypium arboreum [tree cotton]
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    214   2e-62    
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                213   2e-62    Erythranthe guttata [common monkey flower]
gb|KJB71577.1|  hypothetical protein B456_011G130700                    212   3e-62    Gossypium raimondii
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                212   3e-62    Erythranthe guttata [common monkey flower]
gb|AFR40371.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    202   4e-62    Populus alba [abele]
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    211   4e-62    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    211   4e-62    Gossypium arboreum [tree cotton]
gb|AFR40370.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    202   5e-62    Populus alba [abele]
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    211   6e-62    Gossypium arboreum [tree cotton]
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    211   7e-62    
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            210   1e-61    Prunus persica
gb|AFZ93419.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    204   1e-61    Triticum monococcum [einkorn wheat]
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    209   3e-61    
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    208   6e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             207   7e-61    Phaseolus vulgaris [French bean]
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    208   9e-61    
gb|KJB54947.1|  hypothetical protein B456_009G055900                    207   1e-60    Gossypium raimondii
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1             209   2e-60    
gb|KJB54946.1|  hypothetical protein B456_009G055900                    207   2e-60    Gossypium raimondii
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    205   4e-60    
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   7e-60    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                203   6e-59    
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    202   1e-58    
gb|AEA36976.1|  rosmarinic acid synthase                                202   3e-58    
gb|KJB68257.1|  hypothetical protein B456_010G234800                    199   1e-57    
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    199   1e-57    
gb|KJB68256.1|  hypothetical protein B456_010G234800                    199   2e-57    
gb|KJB68255.1|  hypothetical protein B456_010G234700                    200   2e-57    
gb|KJB68253.1|  hypothetical protein B456_010G234500                    199   2e-57    
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   3e-57    
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    203   3e-57    
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   3e-57    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             199   3e-57    
gb|ABI48360.1|  putative alcohol acyltransferase 1                      199   4e-57    
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             197   9e-57    
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             197   1e-56    
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   2e-56    
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          197   2e-56    
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   3e-56    
dbj|BAC78636.1|  hydroxyanthranilate hydroxycinnamoyltransferase 4      192   3e-56    
ref|XP_004295153.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   3e-56    
gb|ACZ52699.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    190   3e-56    
gb|ADA60182.1|  rosmarinic acid synthase                                194   2e-55    
gb|AJA31666.1|  rosmarinic acid synthase                                194   2e-55    
gb|KJB54948.1|  hypothetical protein B456_009G055900                    194   2e-55    
ref|XP_007149783.1|  hypothetical protein PHAVU_005G0986001g            186   3e-55    
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    193   4e-55    
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             192   7e-55    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    192   8e-55    
gb|EYU24588.1|  hypothetical protein MIMGU_mgv1a0237892mg               187   3e-54    
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   5e-54    
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    190   5e-54    
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    190   7e-54    
gb|AEV93472.1|  hydroxycinnamoyl transferase                            184   1e-53    
gb|AGH61997.1|  rosmarinic acid synthase                                189   1e-53    
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   2e-53    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    188   2e-53    
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   2e-53    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   3e-53    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   5e-53    
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   5e-53    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   8e-53    
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   9e-53    
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   1e-52    
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    186   1e-52    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   1e-52    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    186   2e-52    
gb|AFR40217.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    179   3e-52    
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       182   3e-52    
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    185   4e-52    
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   2e-51    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    184   2e-51    
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    183   2e-51    
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    182   3e-51    
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   4e-51    
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                182   5e-51    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   5e-51    
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   7e-51    
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    182   1e-50    
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   3e-50    
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg             179   3e-50    
gb|AGW27209.1|  rosmarinic acid synthase 4                              179   5e-50    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    180   5e-50    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   7e-50    
ref|XP_007149777.1|  hypothetical protein PHAVU_005G098300g             177   1e-49    
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-49    
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    178   2e-49    
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         178   2e-49    
ref|XP_008779303.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   3e-49    
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   4e-49    
ref|XP_010682402.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    171   5e-49    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   8e-49    
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    176   8e-49    
ref|XP_010911018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   2e-48    
ref|XP_009366067.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   2e-48    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    175   3e-48    
gb|EMS60258.1|  Anthranilate N-benzoyltransferase protein 1             175   5e-48    
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    173   1e-47    
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    173   2e-47    
gb|KJB68258.1|  hypothetical protein B456_010G234900                    171   9e-47    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         170   2e-46    
ref|XP_007216286.1|  hypothetical protein PRUPE_ppa020471mg             165   5e-46    
ref|NP_001169127.1|  hypothetical protein                               169   6e-46    
gb|AFF19202.1|  BAHD acyltransferase                                    168   1e-45    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    168   1e-45    
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   168   2e-45    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          167   2e-45    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          167   3e-45    
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    167   3e-45    
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             167   5e-45    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    166   6e-45    
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    166   1e-44    
gb|AGW27211.1|  rosmarinic acid synthase 6                              165   1e-44    
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   1e-44    
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    165   2e-44    
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    165   2e-44    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          164   6e-44    
gb|AGW27208.1|  rosmarinic acid synthase 3                              163   6e-44    
gb|AGW27207.1|  rosmarinic acid synthase 2                              160   1e-43    
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    162   4e-43    
dbj|BAJ89730.1|  predicted protein                                      161   4e-43    
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             161   5e-43    
dbj|BAJ91746.1|  predicted protein                                      161   6e-43    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    161   7e-43    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    165   7e-43    
gb|KJB71583.1|  hypothetical protein B456_011G130900                    159   1e-42    
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    160   1e-42    
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    159   6e-42    
ref|XP_002325143.2|  transferase family protein                         158   6e-42    
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    158   7e-42    
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   1e-41    
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     157   2e-41    
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    157   2e-41    
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   3e-41    
emb|CAN72449.1|  hypothetical protein VITISV_011069                     156   3e-41    
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    156   4e-41    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             156   5e-41    
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    155   6e-41    
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   7e-41    
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    155   8e-41    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    155   8e-41    
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    154   9e-41    
emb|CAM84303.1|  putative hydroxycinnamoyl CoA quinate transferase      145   1e-40    
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    155   1e-40    
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    155   1e-40    
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   3e-40    
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   3e-40    
dbj|BAH66890.1|  alcohol acyl-transferase                               145   4e-40    
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    152   4e-40    
ref|XP_003604491.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    152   5e-40    
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    153   5e-40    
emb|CBI36554.3|  unnamed protein product                                153   6e-40    
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    152   8e-40    
gb|EPS61292.1|  hydroxycinnamoyl transferase                            147   1e-39    
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    152   1e-39    
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    152   1e-39    
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             151   2e-39    
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   2e-39    
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   3e-39    
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             151   3e-39    
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    151   3e-39    
ref|XP_002960602.1|  BAHD family acyltransferase, clade IV              151   3e-39    
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    150   4e-39    
ref|XP_002969244.1|  BAHD family acyltransferase, clade IV              151   4e-39    
gb|AGW27210.1|  rosmarinic acid synthase 5                              150   5e-39    
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   5e-39    
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    150   5e-39    
gb|ACU23734.1|  unknown                                                 150   6e-39    
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   6e-39    
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   7e-39    
ref|XP_004964653.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    149   8e-39    
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    149   2e-38    
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    149   2e-38    
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     149   2e-38    
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    149   3e-38    
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    147   6e-38    
ref|XP_010093470.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    140   7e-38    
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   9e-38    
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    147   9e-38    
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    147   1e-37    
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             147   2e-37    
ref|XP_010533495.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    146   2e-37    
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             145   3e-37    
ref|XP_007011893.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    144   3e-37    
ref|XP_002866234.1|  transferase family protein                         145   3e-37    
emb|CDY62143.1|  BnaCnng39330D                                          144   4e-37    
emb|CDY56515.1|  BnaCnng30570D                                          144   5e-37    
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    145   6e-37    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    144   9e-37    
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             144   1e-36    
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760          143   1e-36    
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770          143   1e-36    
emb|CDY66506.1|  BnaAnng22360D                                          143   2e-36    
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    143   2e-36    
gb|AES90726.2|  spermidine hydroxycinnamoyl transferase                 143   2e-36    
ref|XP_004507883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    143   2e-36    
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    143   2e-36    
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               143   2e-36    
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                143   3e-36    
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    143   3e-36    
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   143   3e-36    
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    143   3e-36    
ref|XP_010110725.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    143   3e-36    
ref|XP_007206604.1|  hypothetical protein PRUPE_ppa020718mg             141   4e-36    
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    142   5e-36    
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     142   5e-36    
ref|XP_002884178.1|  transferase family protein                         142   8e-36    
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    142   9e-36    
gb|ACC68164.1|  unknown                                                 141   1e-35    
emb|CDY03367.1|  BnaC09g09810D                                          141   1e-35    
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    141   1e-35    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   1e-35    
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    140   2e-35    
ref|XP_002529384.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    140   2e-35    
ref|XP_010414994.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    140   2e-35    
dbj|BAK06725.1|  predicted protein                                      140   2e-35    
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    140   3e-35    
ref|XP_004166134.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    140   3e-35    
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   4e-35    
emb|CDY11845.1|  BnaC03g12710D                                          143   4e-35    
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    140   4e-35    
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    139   5e-35    
ref|XP_004166135.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   5e-35    
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                    139   6e-35    
ref|XP_004149124.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    139   6e-35    
ref|XP_006656713.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   6e-35    
ref|XP_010667594.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   6e-35    
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   7e-35    
ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    139   8e-35    
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   9e-35    
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    139   1e-34    
gb|EAY99938.1|  hypothetical protein OsI_21941                          138   1e-34    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    138   1e-34    
emb|CDX88644.1|  BnaA03g10050D                                          138   1e-34    
gb|EAY99940.1|  hypothetical protein OsI_21943                          138   1e-34    
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    138   1e-34    
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    138   1e-34    
ref|XP_007214780.1|  hypothetical protein PRUPE_ppa023555mg             138   1e-34    
gb|EPS69670.1|  hypothetical protein M569_05094                         138   2e-34    
ref|XP_003564188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   4e-34    



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+ARGL+DDQ TKLY+ATDGRSRLCP LPPG+LGNV+FTATP+AESGEL +
Sbjct  255  LAAHIWRCACKARGLTDDQATKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESGELQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI SAL RMDDEYLRSALD+LECQPDLSKL+RGSNYFASPNLNINSWTRLPV
Sbjct  315  EPLTNSAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPV  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H SDFGWG P+HMGPA ILYEGTVYILPSPNKDR+LSLAVCLDA+HMPLF++ LY F
Sbjct  375  HESDFGWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  431



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+AR L+DDQ TKL++ATDGRSRLCP LPPG+LGNV+FTATP+A+S ELL 
Sbjct  259  LAAHIWRCTCKARALADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPMAKSSELLQ  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI ++L +MDD YLRSALDYLE QPDLS L+RG  YFASPNLNINSWTRLPV
Sbjct  319  EPLTNSAKRIHTSLSKMDDNYLRSALDYLELQPDLSALIRGPTYFASPNLNINSWTRLPV  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
            H+SDFGWG P+HMGPA ILYEGTVYILPSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  379  HDSDFGWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+AR L DDQ TKL++ATDGRSRL P LPPG+LGNV+FTATP+A+SGE+L+
Sbjct  258  LAAHIWRCTCKARILDDDQLTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGEILS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL ++A+RI SAL RMDDEYLRSA+DYLE Q DLSKL+RG  YFASPNLNINSWTRLPV
Sbjct  318  EPLMNTAQRIHSALARMDDEYLRSAIDYLELQTDLSKLIRGPTYFASPNLNINSWTRLPV  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H+SDFGWG P+HMGPA ILYEGTVYILPSP+ D++L LAVCLDADHMPLF+K LY+F
Sbjct  378  HDSDFGWGKPIHMGPACILYEGTVYILPSPSNDKNLRLAVCLDADHMPLFEKYLYEF  434



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR  C+ARGL++DQ+TKLY+ATDGRSRL P LPPG+LGNV+FTATP+AES +L +
Sbjct  254  LAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSDLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI +AL RMD++YLRSALDYLE QPDLS LVRG  +FASPNLNINSWTRLP 
Sbjct  314  EPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPF  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+H+GPA+ILYEGTVY+LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  374  HDADFGWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+AR LSDDQ TKL++ATDGRSRLCP LPPG+LGNV+FT TP+A+S ELL 
Sbjct  259  LAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTGTPMAKSSELLQ  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI SAL +MDD YLRSALDYLE  PDLS L+RG  YFASPNLNINSWTRLPV
Sbjct  319  EPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDLSALIRGPTYFASPNLNINSWTRLPV  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
            H+SDFGWG P+HMGPA ILYEGTVYILPSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  379  HDSDFGWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+AR LSDDQ TKL++ATDGRSRLCP LPPG+LGNV+FT TP+A+S ELL 
Sbjct  259  LAAHIWRCTCKARALSDDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTGTPMAKSSELLQ  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI SAL +MDD YLRSALDYLE  PDLS L+RG  YFASPNLNINSWTRLPV
Sbjct  319  EPLTNSAKRIHSALSKMDDNYLRSALDYLELLPDLSALIRGPTYFASPNLNINSWTRLPV  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
            H+SDFGWG P+HMGPA ILYEGTVYILPSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  379  HDSDFGWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = -1

Query  653  RTRATRVAPT-RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIF  477
            +T++ +   T   LAAHIWRC C+AR L +DQ TKL++ATDGRSRL P LPPG+LGNV+F
Sbjct  247  KTKSKKEGSTYEVLAAHIWRCTCKARALDNDQLTKLHVATDGRSRLFPPLPPGYLGNVVF  306

Query  476  TATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFAS  297
            TATP+A+SGE+L+EPL ++A+RI SAL RMDDEYLRSA+DYLE Q DLSKL+RG  YFAS
Sbjct  307  TATPIAKSGEILSEPLMNTAQRIHSALARMDDEYLRSAIDYLELQTDLSKLIRGPTYFAS  366

Query  296  PNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHM  117
            PNLNINSWTRLPVH+SDFGWG P+HMGPA ILYEGTVYILPSP+ D++L LAVCLDADHM
Sbjct  367  PNLNINSWTRLPVHDSDFGWGKPIHMGPACILYEGTVYILPSPSNDKNLRLAVCLDADHM  426

Query  116  PLFQKLLYKF  87
            PLF+K LY F
Sbjct  427  PLFEKYLYDF  436



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR  C+ARGL++DQ+TKLY+ATDGRSRL P LPPG+LGNV+FTATP+AES  L +
Sbjct  254  LAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI +AL RMD++YLRSALDYLE QPDLS LVRG  +FASPNLNINSWTRLP 
Sbjct  314  EPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPF  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+H+GPA+ILYEGTVY+LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  374  HDADFGWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR  C+ARGL++DQ+TKLY+ATDGRSRL P LPPG+LGNV+FTATP+AES  L +
Sbjct  254  LAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI +AL RMD++YLRSALDYLE QPDLS LVRG  +FASPNLNINSWTRLP 
Sbjct  314  EPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPF  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+H+GPA+ILYEGTVY+LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  374  HDADFGWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR  C+ARGL++DQ+TKLY+ATDGRSRL P LPPG+LGNV+FTATP+AES  L +
Sbjct  254  LAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI +AL RMD++YLRSALDYLE QPDLS LVRG  +FASPNLNINSWTRLP 
Sbjct  314  EPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPF  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+H+GPA+ILYEGTVY+LPSP KDR+LSLAVCLDADHMPLFQ+ LY F
Sbjct  374  HDADFGWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQRFLYDF  430



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR  C+ARGL++DQ+TKLY+ATDGRSRL P LPPG+LGNV+FTATP+AES  L +
Sbjct  308  LAAHIWRTACKARGLTNDQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQS  367

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +SAKRI +AL RMD++YLRSALDYLE QPDLS LVRG  +FASPNLNINSWTRLP 
Sbjct  368  EPLTNSAKRIHNALARMDNDYLRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPF  427

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+H+GPA+ILYEGTVY+LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  428  HDADFGWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  484



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL DDQ TKLY+ATDGR RL P LPPG+LGNV+FTATPVAESGE+++
Sbjct  267  LAAHLWRCACKARGLPDDQLTKLYVATDGRFRLSPTLPPGYLGNVVFTATPVAESGEIVS  326

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL++SAK+I +AL +MDDEYLRSALDYLE QPDL  L+RG NYFA PNLNINSWTRLP+
Sbjct  327  QPLSNSAKKIHNALAKMDDEYLRSALDYLESQPDLGALIRGPNYFACPNLNINSWTRLPI  386

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGPA ILYEGT+Y++PSP+ +RS+SLA+CL+ADHMPLF+K LY+F
Sbjct  387  YDADFGWGRPIFMGPASILYEGTIYVIPSPDNNRSVSLALCLEADHMPLFEKYLYEF  443



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC  +ARGL+DDQ TKL++ATDGRSRLCP LPPG+LGNV+FTATP+A+S EL +
Sbjct  258  LAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +S KRI + L++MDD YLRSALDYLE QPDLS L+RG  YF SPNLNINSWTRLPV
Sbjct  318  EPLRNSVKRIHNELIKMDDNYLRSALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPV  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
            H  DFGWG P+HMGPA ILYEGT+YI+PSPN KDR+L LAVCLD DHMPLF+K LY+F
Sbjct  378  HECDFGWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYLYEF  435



>gb|AGE10614.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=214

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+AR LS +QT+KLYIATDGRSRLCP LPPG+LGNV+FTATP+AESG+L  
Sbjct  39   LAAHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQV  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+ S+AKRI ++L RMD+EYLRSALD+LE  PDL  LVRG NYFASPNLNINSWTRLPV
Sbjct  99   EPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDLKTLVRGPNYFASPNLNINSWTRLPV  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGPA ILYEGT+YI+PS   DRSLSLAVCLDA HM  F+K LY+
Sbjct  159  HDADFGWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYE  214



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+ARGL +DQ TKL++ATDGRSRLCP LPPG+LGNV+FTATP+A+S EL +
Sbjct  253  LAAHIWRCTCKARGLPEDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQS  312

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +S KRI + L++MDD YLRSALDYLE QPDLS L+RG  YFASPNLNINSWTRLPV
Sbjct  313  EPLTNSVKRIHNELIKMDDNYLRSALDYLELQPDLSTLIRGPAYFASPNLNINSWTRLPV  372

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
            H  DFGWG P+HMGPA ILYEGT+YI+PSPN KDR+L LAVCLDA HM LF+K LY+ 
Sbjct  373  HECDFGWGRPIHMGPACILYEGTIYIIPSPNSKDRNLRLAVCLDAGHMSLFEKYLYEL  430



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC CEARGLSDDQ TKLY+ATDGRSRL P LPPG+LGNV+FTATP+A+SGE  +
Sbjct  258  LAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFTATPIAKSGEFKS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            E LA +A+RI S L +MDD+YLRSA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP+
Sbjct  318  ESLADTARRIHSELAKMDDQYLRSAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            + SDFGWG P+ MGPA ILYEGT+YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  378  YESDFGWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL DDQ TKLY+ATDGRSRL P LPPG+LGNV+FT TPVA+SG+L T
Sbjct  273  LAAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTT  332

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L+++A  IR+ L +MD+ YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV
Sbjct  333  QSLSNAASLIRTTLTKMDNNYLRSAIDYLEVQPDLSALIRGPSYFASPNLNINTWTRLPV  392

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG PV MGPA ILYEGT+Y+LPSPN DRS+SLAVCLDAD  PLF+K LY F
Sbjct  393  HDADFGWGRPVFMGPACILYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  449



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+AR LS +QT+KLYIATDGRSRLCP LPPG+LGNV+FTATP+AESG+L  
Sbjct  263  LAAHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQV  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+ S+AKRI ++L RMD+EYLRSALD+LE  PDL  LVRG NYFASPNLNINSWTRLPV
Sbjct  323  EPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDLKTLVRGPNYFASPNLNINSWTRLPV  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGPA ILYEGT+YI+PS   DRSLSLAVCLDA HM  F+K LY+F
Sbjct  383  HDADFGWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC  +ARGL+DDQ TKL++ATDGRSRLCP LPPG+LGNV+FTATP+A+S EL +
Sbjct  258  LAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +S KRI + L++MDD YLRSALDYLE QPDLS L+RG  YF SPNLNINSWTRLPV
Sbjct  318  EPLRNSVKRIHNELIKMDDNYLRSALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPV  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLL  96
            H  DFGWG P+HMGPA ILYEGT+YI+PSPN KDR+L LAVCLD DHMPLF+K L
Sbjct  378  HECDFGWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC  +ARGL+DDQ TKL++ATDGRSRLCP LPPG+LGNV+FTATP+A+S EL +
Sbjct  258  LAAHIWRCTSKARGLADDQLTKLHVATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPL +S KRI + L++MDD YLRSALDYLE QPDLS L+RG  YF SPNLNINSWTRLPV
Sbjct  318  EPLRNSVKRIPNELIKMDDNYLRSALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPV  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN-KDRSLSLAVCLDADHMPLFQKLL  96
            H  DFGWG P+HMGPA ILYEGT+YI+PSPN KDR+L LAVCLD DHMPLF+K L
Sbjct  378  HECDFGWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+AR LS +QT+KLYIATDGRSRLCP LPPG+LGNV+FTATP+A+SG+L  
Sbjct  263  LAAHLWRCACKARDLSANQTSKLYIATDGRSRLCPPLPPGYLGNVVFTATPMADSGDLQA  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+ S+AKRI ++L RMD+EYLRSALD+LE  PDL  LVRG NYFASPNLNINSWTRLPV
Sbjct  323  EPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDLKTLVRGPNYFASPNLNINSWTRLPV  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGPA ILYEGT+YI+PS   DRSLSLAVCLDA HM  F+K LY+F
Sbjct  383  HDADFGWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   285 bits (730),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL DDQ TKLY+ATDGRSRL P LPPG+LGNV+FT TPVA+SG+L T
Sbjct  256  LAAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTT  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L+++A  IR+ L +MD+ YLRSA+DY E QPDLS L+RG +YFASPNLNIN+WTRLPV
Sbjct  316  QSLSNAASLIRTTLTKMDNNYLRSAIDYPEVQPDLSALIRGPSYFASPNLNINTWTRLPV  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG PV MGPA ILYEGT+Y+LPSPN DRS+SLAVCLDAD  PLF+K LY F
Sbjct  376  HDADFGWGRPVFMGPACILYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  432



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+ARGL DDQ +KLY+ATDGRSRL P LPPG+LGNV+FTATPVA+SG+L +
Sbjct  267  LAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTS  326

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L+++AK I + L +MDD+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV
Sbjct  327  KSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPV  386

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGPA ILYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  387  YDADFGWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGLSDDQ TKLY+ATDGRSRL P LPPG+LGNV+FTATP+A+SGE  +
Sbjct  258  LAAHLWRCACKARGLSDDQPTKLYVATDGRSRLSPPLPPGYLGNVVFTATPIAKSGEFKS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            E LA +A+RI   L +MDD+YLRSA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP+
Sbjct  318  ESLADTARRIHIELAKMDDQYLRSAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            + SDFGWG P+ MGPA ILYEGT+YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  378  YESDFGWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+ARGL DDQ +KLY+ATDGRSRL P LPPG++GNV+FTATPVA+SG+L +
Sbjct  267  LAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYVGNVVFTATPVAKSGDLTS  326

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L+++AK I + L +MDD+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV
Sbjct  327  KSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPV  386

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGPA ILYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  387  YDADFGWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC CEARGLSDDQ TKLY+ATDGRSRL P LPPG+LGNV+F ATP+A+SGE  +
Sbjct  258  LAAHLWRCACEARGLSDDQPTKLYVATDGRSRLNPPLPPGYLGNVVFKATPIAKSGEFKS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            E LA +A+RI S L +M D+YLRSA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP+
Sbjct  318  ESLADTARRIHSELAKMGDQYLRSAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            + SDFGWG P+ MGPA ILYEGT+YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  378  YESDFGWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C+ARGL DDQ +KLY+ATDGRSRL P LPPG+LGNV+FTATPVA+SG+L +
Sbjct  267  LAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTS  326

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L+++AK I + L +MDD+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV
Sbjct  327  KSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPV  386

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++D GWG P+ MGPA ILYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  387  YDADLGWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|AGE10615.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=276

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL+ DQ +KLYIATDGR+RLCP LP G+LGNV+FTATP+A SG+L+ 
Sbjct  101  LAAHLWRCACKARGLAKDQMSKLYIATDGRARLCPPLPFGYLGNVVFTATPMAVSGDLVA  160

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+  S++RI SAL +MDD YLRSALDYLE  PDL  LVRG +YFASPNLNINSW+RLPV
Sbjct  161  EPIIDSSRRIHSALTQMDDGYLRSALDYLELLPDLKALVRGPHYFASPNLNINSWSRLPV  220

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGPA ILYEGT+YI+PSP  DRSL LAVCLD  HMPLF+K LY+
Sbjct  221  YDADFGWGRPIFMGPASILYEGTIYIIPSPTNDRSLLLAVCLDVGHMPLFKKYLYE  276



>gb|AGE10604.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera hypoglauca]
Length=296

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL+ DQ +KLYIATDGR+RLC  LP G+LGNV+FTATP+A SG+L+ 
Sbjct  120  LAAHLWRCACKARGLAKDQMSKLYIATDGRARLCSPLPFGYLGNVVFTATPMAVSGDLVA  179

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+  S++RI SAL +MD+ YLRSALDYLE  PDL  LVRG +YFASPNLNINSW+RLPV
Sbjct  180  EPIIDSSRRIHSALTQMDNGYLRSALDYLELLPDLKALVRGPHYFASPNLNINSWSRLPV  239

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGPA ILYEGT+YI+PSP  DRSLSLAVCLD  HMPLF+K LY+F
Sbjct  240  YDADFGWGRPIFMGPASILYEGTIYIIPSPTNDRSLSLAVCLDVGHMPLFKKYLYEF  296



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRCVC+ARGL DDQ TKLYIATDGRSRL P LPPG+ GN IFTATP+A SG+LL+
Sbjct  259  LAGHVWRCVCKARGLPDDQDTKLYIATDGRSRLRPPLPPGYFGNGIFTATPIAVSGDLLS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +A RI  ALVRMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SW RLP+
Sbjct  319  KPLTYAAGRIHDALVRMDDEYLRSALDYLELQPDLTVLVRGAHTFRCPNIGITSWVRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  ++LPSP  D +LSLA+ L +DHM +FQK+LY F
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLAFLLPSPVNDGNLSLAISLQSDHMKVFQKILYDF  435



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +   ++ AHIWR +C+ARGLSDDQ +KLYI+TDGRSRL P LPPG+LGNV+FT T 
Sbjct  245  AVRHSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTV  304

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +  SGE+ ++PLA + +RI  ALVRMDDEYLRSALDY+E QPDL+ L RG + +ASPNLN
Sbjct  305  MGLSGEIQSKPLARTMERIHEALVRMDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLN  364

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            I SW RLPVH++DFGWG PV MGPA +  EG  YIL SP  D SLSL +CL+A HMPLF+
Sbjct  365  IVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFE  424

Query  104  KLLYKF  87
            K LY F
Sbjct  425  KCLYDF  430



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR VC+ARGL+DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L+ 
Sbjct  255  LSGHVWRSVCKARGLTDDQGTKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLML  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDDEYLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAASRIHDALVRMDDEYLRSALDFLELQPDLSALVRGAHTFKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  375  HDADFGWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMKVFEKLFY  429



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR VC+ARGL DDQ TKLYIATDGR+RL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  255  LSGHVWRSVCKARGLEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDDEYLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAASRIHDALVRMDDEYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  375  HDADFGWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  429



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRCVC+ARGL +DQ TKLYIATDGRSRL P LPPG+ GNVIFT TPVA++G+L +
Sbjct  259  LSGHVWRCVCQARGLENDQGTKLYIATDGRSRLNPTLPPGYFGNVIFTTTPVAQAGDLAS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD+EYLRSALDYLE QPDL+ LVRG++ F  PNL I SWTRLP+
Sbjct  319  KPTWYAASRIHDALARMDNEYLRSALDYLELQPDLTALVRGAHTFRCPNLGITSWTRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  Y+LPSP  D SLSLA+ L  +HM LF K LY+ 
Sbjct  379  HDADFGWGRPIFMGPGGIPYEGLAYMLPSPVNDGSLSLAIALQPEHMKLFSKYLYEI  435



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +   ++ AHIWR +C+ARGLSDDQ +KLYI+TDGRSRL P LPPG+LGNV+FT T 
Sbjct  253  AARHSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTV  312

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +  SGE+ ++PL  + +RI  AL RMDDEYLRSALDY+E QPDL+ L RG + +ASPNLN
Sbjct  313  MGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLN  372

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            I SW RLPVH++DFGWG PV MGPA +  EG  YIL SP  D SLSL +CL+A HMPLF+
Sbjct  373  IVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFE  432

Query  104  KLLYKF  87
            K LY F
Sbjct  433  KCLYDF  438



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +   ++ AHIWR +C+ARGLSDDQ +KLYI+TDGRSRL P LPPG+LGNV+FT T 
Sbjct  245  AARHSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTV  304

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +  SGE+ ++PL  + +RI  AL RMDDEYLRSALDY+E QPDL+ L RG + +ASPNLN
Sbjct  305  MGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLN  364

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            I SW RLPVH++DFGWG PV MGPA +  EG  YIL SP  D SLSL +CL+A HMPLF+
Sbjct  365  IVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFE  424

Query  104  KLLYKF  87
            K LY F
Sbjct  425  KCLYDF  430



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL+DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  191  LAGHVWRCTCKARGLADDQETKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLQS  250

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD+EYLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  251  KPTWYAASRIHGALSRMDNEYLRSALDYLELQPDLSALVRGAHTFKCPNLGITSWVRLPI  310

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPS   D S+S+A+ L ++HM LF+KLLY
Sbjct  311  HDADFGWGRPIFMGPGGIAYEGLSFILPSATIDGSMSVAIALQSEHMKLFEKLLY  365



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   250 bits (638),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C ARGLSDDQ +KLYIATDGR RL P LP G+ GNVIFTATP+A +G+L++
Sbjct  265  LAGHVWRCACRARGLSDDQDSKLYIATDGRMRLSPPLPRGYFGNVIFTATPIAVAGDLIS  324

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P++ +A++IR +L RMDD+YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  325  KPVSYAAQKIRESLARMDDDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  384

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPS   D SLS+A+ L  +HM LF+K LY F
Sbjct  385  HDADFGWGRPIFMGPGGIAYEGLSFILPSSTSDGSLSVAISLQTEHMKLFEKFLYDF  441



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR VC+ARGL DDQ TKLYIATDGR+RL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  323  LSGHVWRSVCKARGLEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLS  382

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDDEYLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  383  KPTWYAASRIHDALVRMDDEYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  442

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  443  HDADFGWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  497



>ref|XP_006840118.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
 gb|ERN01793.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
Length=281

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+AR L DDQ TK+YIATDGRSRL P LP G+ GNVIFTATP+A +G+L++
Sbjct  105  LAGHVWRCSCKARNLPDDQLTKMYIATDGRSRLRPLLPAGYFGNVIFTATPIAVAGDLMS  164

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P   +A  IR AL RMDD+YLRSALDYLE QPDL  LVRG++ F  PN+ I SW RLP+
Sbjct  165  RPAYVAAGCIRQALARMDDDYLRSALDYLEIQPDLGALVRGAHTFRCPNIGITSWARLPI  224

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  I YEG  ++LPSP+ D SLSLA+ L ADHM LF+K  Y
Sbjct  225  HDADFGWGRPVFMGPGGIAYEGLAFVLPSPSGDGSLSLAISLQADHMVLFKKYFY  279



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC ARGL +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A SG+L +
Sbjct  256  LAGHVWRSVCMARGLPEDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVSGDLTS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  376  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLY  430



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+AR L  DQ +K+YIATDGRSRL PALPPG+ GNVIFT TPVA +GEL++
Sbjct  230  LAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMS  289

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +A +I +AL RMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP+
Sbjct  290  KPLWYAASKIHNALARMDDEYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPI  349

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  I  EG  + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  350  YDADFGWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  406



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA HIWRC C ARGL +DQ+TKLYIATDGR RL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  251  LAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLES  310

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P    A +I  AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  311  KPAWYGASKIHDALARMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  370

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ADHM +F+KLLY+
Sbjct  371  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA HIWRC C ARGL +DQ+TKLYIATDGR RL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  251  LAGHIWRCACLARGLPEDQSTKLYIATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLES  310

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P    A +I  AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  311  KPAWYGASKIHDALARMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  370

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ADHM +F+KLLY+
Sbjct  371  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>ref|XP_002303858.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
 gb|EEE78837.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
Length=315

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  137  LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  196

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  197  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  256

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L A+HM LF+K +Y
Sbjct  257  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  311



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR VC+ARGL+ DQ TKLYIATDGR+RL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  255  LSGHVWRSVCKARGLAGDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  AL RMDD+YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGTIHDALARMDDDYLRSALDYLELQPDLSALVRGAHTFKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF+KL+Y
Sbjct  375  HDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLIY  429



>gb|AEN02914.1| HCT1 [Populus nigra]
Length=297

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  119  LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  178

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  179  KPTWCAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  238

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D S+S+A+ L A+HM LF+K +Y
Sbjct  239  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFIY  293



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+AR L  DQ +K+YIATDGRSRL PALPPG+ GNVIFT TPVA +GEL++
Sbjct  253  LAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMS  312

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +A +I +AL RMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP+
Sbjct  313  KPLWYAASKIHNALARMDDEYLRSALDYLEIQPDLTALVRGAHTFRCPNIGITSWTRLPI  372

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  I  EG  + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  373  YDADFGWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+AR L  DQ +K+YIATDGRSRL PALPPG+ GNVIFT TPVA +GEL++
Sbjct  253  LAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMS  312

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +A +I +AL RMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP+
Sbjct  313  KPLWYAASKIHNALARMDDEYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPI  372

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  I  EG  + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  373  YDADFGWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL+DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  255  LAGHVWRSACKARGLTDDQETKLYIATDGRSRLNPPLPPGYFGNVIFTATPIAVAGDLES  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  AL RMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDALARMDNDYLRSALDFLELQPDLSALVRGAHTFKCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPSP  D SLS+A+ L ++HM LF+K +Y+ 
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAIALQSEHMKLFEKFIYEL  431



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRCVC+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFT TP A +G+L +
Sbjct  258  LSGHVWRCVCKARGLPDDQDTKLYIATDGRSRLQPVLPPGYFGNVIFTTTPTAVAGDLTS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPTWYAASRIHDALGRMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPS   D SLS+A+ L A+HM LF K LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFVLPSTTNDGSLSIAISLQAEHMKLFSKFLY  432



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR  C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  255  LAAHVWRSTCKARELPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A H+WRCVC+ARGL +DQ TKLYIATDGR+RL P+LPPG+ GNVIFT TP+A +G+L +
Sbjct  254  MAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  314  KPAWYAASRIHDALTRMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF K LY+ 
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFAKYLYEI  430



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  263  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  323  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  383  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>gb|AFR67331.1| hydroxycinnamoyl CoA shikimate hydroxycinnamoyl transferase, 
partial [Leucaena leucocephala]
Length=274

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L++
Sbjct  98   LAGHVWRSTCKARALPDDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVAGDLMS  157

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  158  KPTWFAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  217

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPS   D SLS+A+ L  +HM +F+++LY+ 
Sbjct  218  HDADFGWGRPIFMGPGGIAYEGLSFILPSSGNDGSLSVAIALQPEHMKVFKEVLYEI  274



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C ARGL ++Q TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  251  LSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGS  310

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  311  KPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  370

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF+KLLY+
Sbjct  371  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQ  426



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  263  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  323  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  383  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGR+RL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  254  LAGHVWRSACIARGLTADQETKLYIATDGRARLRPPLPPGYFGNVIFTATPMAVTGDLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A RI  ALVRMD++YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  314  KPIWYAASRIHDALVRMDNDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PSP  D SLS+A+ L  +HM LF+KL+Y
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFIIPSPTNDGSLSVAISLQTEHMKLFEKLIY  428



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  255  LAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTCYAAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  258  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  260  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  320  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  434



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  255  LAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRCVC+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  261  LAGHVWRCVCKARDLPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQS  320

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I +ALVRMD++YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  321  KPTWYAASKIHNALVRMDNDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  380

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  381  HDADFGWGRPIFMGPGGIGYEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  435



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  258  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  258  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  255  LAGHVWRSACQARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D S+S+A+ L A+HM LF+K +Y
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFMY  429



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  
Sbjct  258  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEF  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  255  LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L A+HM LF+K +Y
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  429



>dbj|BAH57209.1| AT5G48930 [Arabidopsis thaliana]
Length=283

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  107  LAGHVWRSVGKARGLPNDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  166

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I   LVRMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  167  KPTWYAAGQIHDFLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  226

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  227  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  282



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR VC+ARGL+DDQ +KLYIATDGRSRL P LPPG+ GNVIFTATPVA +G+L +
Sbjct  222  LSGHVWRSVCKARGLADDQESKLYIATDGRSRLRPPLPPGYFGNVIFTATPVAVAGDLHS  281

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I +ALVRMD+EYLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  282  KPTWYAAGQIHNALVRMDNEYLRSALDYLEMQPDLSALVRGAHTFKCPNLGITSWVRLPI  341

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPS   D SLS+A+ L  +HM LF+K+L+
Sbjct  342  HDADFGWGRPIFMGPGGIPYEGLSFVLPSSANDGSLSVAIALQTEHMKLFEKILH  396



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL +DQ +KLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  256  LAGHVWRSTCMARGLEEDQGSKLYIATDGRSRLRPILPPGYFGNVIFTATPIAVAGDLKS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL +MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPIWYAASKIHDALAQMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  376  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>gb|KHN38057.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=279

 Score =   237 bits (604),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  103  LAGHVWRSVSKARALPDDQETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMS  162

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  163  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  222

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM LF+  LY
Sbjct  223  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  277



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L  DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G+L++
Sbjct  257  LAGHVWRSVCKARALPHDQETKLYIATDGRSRLQPSLPPGYFGNVIFTTTPIAVAGDLMS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  317  KPTWYAASRIHDALVRMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L +D M LFQ+LLY
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDASLSVAIALPSDQMKLFQELLY  431



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ +
Sbjct  259  LAGHVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A ++  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  319  KPIWYAASKLHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY F
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL +DQ +KLYIATDGR RL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  256  LAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPIWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  376  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>gb|AFR40372.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40373.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40376.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            GWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  170



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ +
Sbjct  259  LAGHVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A ++  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  319  KPIWYAASKLHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY F
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>gb|AFR40382.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWXPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFXCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            GWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIY  170



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL +DQ +KLYIATDGR RL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  263  LAGHVWRSTCMARGLEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKS  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  323  KPIWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  383  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  437



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A HIWRCVC+AR L +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  262  MAGHIWRCVCKARELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAAAGDLQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  +LVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWFAASRIHDSLVRMDDNYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  382  HDADFGWGRPIFMGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>gb|AFR40350.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40351.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40352.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40353.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40354.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40355.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40356.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40357.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40358.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40359.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40360.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40361.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40362.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40363.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40364.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=172

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            GWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  170



>gb|AFR40387.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40388.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40389.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40390.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40391.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40392.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40393.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40394.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40395.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40396.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40397.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40398.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40399.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40400.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40401.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=172

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            GWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMELFEKFIY  170



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
             + H+WRCVC+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFT TP+A +G+L +
Sbjct  262  FSGHVWRCVCKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDALVRMDDNYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  ++LPS   D SLSLA+ L ++HM  F +LLY
Sbjct  382  HDADFGWGQPIFMGPGGIAFEGLAFVLPSATNDGSLSLAISLQSEHMKSFSRLLY  436



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ +
Sbjct  193  LAGHVWRSTCMARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQS  252

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A ++  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  253  KPIWYAASKLHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  312

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  313  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  367



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C ARGL++DQ TKLYIATDGRSRL P+LP G+ GNVIFTATP+A +G+L +
Sbjct  255  LAGHVWRCACRARGLTEDQETKLYIATDGRSRLRPSLPTGYFGNVIFTATPIAVAGDLQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  315  KPVWFAASKIHGALGRMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L  +HM LF++ LY
Sbjct  375  HDADFGWGRPIFMGPGGIAYEGLSFMLPSPENDGSLSIAISLQEEHMKLFKEFLY  429



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIW C C ARGL D+Q TKL+IAT+GRSRL P LPPG+ GNVIFT TPV  SGEL +
Sbjct  257  LAAHIWVCACRARGLVDEQKTKLFIATNGRSRLRPPLPPGYFGNVIFTTTPVGVSGELQS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P++ +A +I   LVRMDDEYLRSALDYLE QPDL  LVRG+N F  PNL I SW  LP+
Sbjct  317  KPISYTAGKIHDVLVRMDDEYLRSALDYLEVQPDLMALVRGANTFNCPNLAITSWVGLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  ILYEG   +LPSP  D SLS+AV L  + M +F+KL Y
Sbjct  377  HDADFGWGRPVFMGPGSILYEGLCVVLPSPTNDGSLSVAVSLQEEPMKVFEKLFY  431



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A HIWRCVC+AR L +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  262  MAGHIWRCVCKARELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  +LVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWFAASRIHDSLVRMDDNYLRSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  382  HDADFGWGRPIFMGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L DDQ TKL+IATDGRSRL P LPPG+ GNVIFTATP+A +G++ +
Sbjct  262  LSGHVWRCACKARELPDDQDTKLFIATDGRSRLQPPLPPGYFGNVIFTATPIAXAGDIQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDALVRMDDSYLRSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  +I+PS   D SLSLA+ L  +HM  F KLLY
Sbjct  382  HDADFGWGRPIFMGPGGIAFEGLAFIIPSATNDGSLSLAISLQTEHMKSFSKLLY  436



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFT TP+A +G++ +
Sbjct  262  LSGHVWRCACKARELPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDIQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI   LVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDGLVRMDDSYLRSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  +I+PS   D SLS+A+CL  +HM  F KLLY
Sbjct  382  HDADFGWGRPIFMGPGGIAFEGLSFIIPSATNDGSLSVAICLQTEHMKSFSKLLY  436



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRCVC+ARGL DDQ TKLYIATDGR+RL P+LP G+ GNVIFT TP+A +G+L +
Sbjct  260  LSGHVWRCVCKARGLPDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  AL RMDD+YL+SALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  320  KPTWYAASKIHDALARMDDDYLKSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+ + L A+HM LF K LY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWRC C+AR L++DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++++
Sbjct  257  LSGHIWRCACKARNLTEDQGTKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  AL RMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+
Sbjct  317  KPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPS  KD SLS+A+ L  DHM  F+K+LY+ 
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLAFILPSSAKDGSLSVALGLQPDHMVRFEKMLYEL  433



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C AR L +DQ TKLYIATDGR+RL P LP G+ GNVIFTATP+A +G+L +
Sbjct  258  LAGHVWRCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTATPLAVAGDLES  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQAEHMKLFEKLLY  432



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   LVRMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGLIHDVLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  432



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAH+WR V +AR   DDQ TKLYIATDGRSRL P LPPG+LGNV+FTATP+A +G+L
Sbjct  250  ETLAAHVWRSVTKARAFPDDQVTKLYIATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDL  309

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
            L++P +  A  I   L RMDDEYLRSALDYLE QPDLS L+RG+  +  PNL I SW RL
Sbjct  310  LSKPTSYVAGLIHDVLARMDDEYLRSALDYLEMQPDLSALIRGAQTYNCPNLGITSWVRL  369

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            P++++DFGWG PV MGP++I +EG  ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  370  PIYDADFGWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAH+WR V +AR   DDQ TKLYIATDGRSRL P LPPG+LGNV+FTATP+A +G+L
Sbjct  250  ETLAAHVWRSVTKARAFPDDQVTKLYIATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDL  309

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
            L++P +  A  I   L RMDDEYLRSALDYLE QPDLS L+RG++ +  PNL I SW RL
Sbjct  310  LSKPTSYVAGLIHDVLARMDDEYLRSALDYLEMQPDLSALIRGAHTYNCPNLGITSWVRL  369

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            P++++DFGWG PV MGP++I +EG  ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  370  PIYDADFGWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+ARGL DDQ TK YIA DGRSRL P LPPG+LGNVIFTATP+  +G+LL+
Sbjct  296  LAGHVWRSVCKARGLQDDQETKFYIAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLLS  355

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  A+VRM+D YL SALDYLE QPDLS LVRG++ +  PNL I SWT+LP+
Sbjct  356  KPTWYAAGMIHDAIVRMNDNYLWSALDYLELQPDLSSLVRGAHTYKCPNLGITSWTKLPI  415

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P++MGP  I YEG  ++LPSP  D SLSLA+ L ++HM LFQK  Y
Sbjct  416  YDADFGWGRPIYMGPGAIAYEGLSFVLPSPTNDGSLSLAIALQSEHMKLFQKFFY  470



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAH+WR V +AR   DDQ TKLYIATDGRSRL P LPPG+LGNV+FTATP+A +G+L
Sbjct  250  ETLAAHVWRSVTKARAFPDDQVTKLYIATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDL  309

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
            L++P +  A  I   L RMDDEYLRSALDYLE QPDLS L+RG+  +  PNL I SW RL
Sbjct  310  LSKPTSYVAGLIHDVLARMDDEYLRSALDYLEMQPDLSALIRGAQTYNCPNLGITSWVRL  369

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            P++++DFGWG PV MGP++I +EG  ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  370  PIYDADFGWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+AR L+ DQ +K+YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  316  LAGHVWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQS  375

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMD++YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  376  KPTWYAASRIHDALVRMDNDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  435

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM +F+KLLY+
Sbjct  436  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  491



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C+ARGL  DQ TKLYIATDGR+RL P+LPPG+ GNVIFTAT +A +G+L  
Sbjct  258  LAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATLIAIAGDLEF  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+AR L+ DQ +K+YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L +
Sbjct  321  LAGHVWRSACKARDLAVDQESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQS  380

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMD++YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  381  KPTWYAASRIHDALVRMDNDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  440

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L  +HM +F+KLLY+
Sbjct  441  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  496



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
             + H+WRCVC+A    DDQ TKLYIATDGRSRL P LPPG+ GNVIFT TP+A +G+L +
Sbjct  262  FSGHVWRCVCKASEFPDDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  ALVRMDD YLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDALVRMDDNYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I +EG  ++LPS     SLSLA+CL ++HM  F +LLY
Sbjct  382  HDADFGWGQPIFMGPGGIAFEGLAFVLPSATNGGSLSLAICLQSEHMKSFSRLLY  436



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR   +ARGL  DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A++GE+ +
Sbjct  255  LAGHVWRSASKARGLVGDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAQAGEMQS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A++I  ALVRMD++YLRSALDYLE QPD S LVRG++ F  PNL I SW RLP+
Sbjct  315  KPTWFAARKIHDALVRMDNDYLRSALDYLELQPDPSALVRGAHTFRCPNLGITSWVRLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  +ILPS   D SLS+A+ L  +HM LF+KL+Y+
Sbjct  375  HDADFGWGRPIFMGPGGIPYEGLSFILPSATNDGSLSVAIALQTEHMKLFEKLIYE  430



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAIAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   LVRMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGLIHDVLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKYLYE  432



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L++
Sbjct  263  LAGHVWRSTCKARALPDDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVAGDLMS  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  323  KPTWFAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            H++DFGWG P+ MGP  I YEG  +ILPS   D SLS+A+ L  +HM +F+++LY+
Sbjct  383  HDADFGWGRPIFMGPGGIAYEGLSFILPSSGNDGSLSVAIALQPEHMKVFKEVLYE  438



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+ARGL DDQ TKLY+A DGRSRLCP LPPG+ GNVIF+ATP+  +G+LL+
Sbjct  255  LAGHVWRSVCKARGLPDDQETKLYVAIDGRSRLCPQLPPGYFGNVIFSATPLTLAGDLLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I   +VRMDD YLRSALDYLE QPDLS LVR ++ +  PNL I SW RLP+
Sbjct  315  KPTWYAAGKIHDVIVRMDDNYLRSALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPM  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ +GP  I YEG  ++LPSP  D SLSLA+ L ++HM LF+K LY
Sbjct  375  YDADFGWGRPIFVGPGAIAYEGLSFLLPSPTNDGSLSLAIALQSEHMKLFEKFLY  429



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A H+WRCVC+ARGL +DQ TKLYIATDGR+RL P+LPPG+ GNVIFT TP+A +G+L +
Sbjct  254  MAGHLWRCVCKARGLPEDQETKLYIATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  314  KPAWYAASRIHDALTRMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLF  108
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLF  423



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  260  LAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  320  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 135/185 (73%), Gaps = 0/185 (0%)
 Frame = -1

Query  641  TRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPV  462
            TR      LA H+WRC C ARGLSDDQ TKL+IATDGR RL P LP G+ GN IFT TP+
Sbjct  256  TRYTSYEILAGHVWRCACRARGLSDDQDTKLFIATDGRMRLSPPLPQGYFGNGIFTITPI  315

Query  461  AESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNI  282
            A +G+L+++P++ +A++I  +L R +D+YLRSALDYLE QPDLS L RG++ F  PNL I
Sbjct  316  AVAGDLISKPVSYAAQKIHESLARTNDDYLRSALDYLELQPDLSALARGAHTFRCPNLGI  375

Query  281  NSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQK  102
             SW RLP+H++DFGWG P++MGP  I YEG  YILPSP  D SLS+A+ L  +HM  F+K
Sbjct  376  TSWVRLPIHDTDFGWGRPIYMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEK  435

Query  101  LLYKF  87
              Y  
Sbjct  436  FFYDL  440



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  262  LAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  322  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  382  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  436



>gb|AFR40375.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40377.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40378.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40379.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40380.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40381.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40383.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40385.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=171

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -1

Query  599  RCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASS  420
            R  C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   +
Sbjct  1    RSTCKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYA  60

Query  419  AKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFG  240
            A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFG
Sbjct  61   AGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADFG  120

Query  239  WGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            WG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  WGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  169



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPNDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I   LVRMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGQIHDFLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPNDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I   LVRMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGQIHDFLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>gb|AFK40022.1| unknown [Medicago truncatula]
Length=178

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+T
Sbjct  2    LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMT  61

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  62   KPTWYAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPI  121

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM + +  LY
Sbjct  122  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSANDGSLSVAIALQHEHMKVLKDFLY  176



>gb|AFR40386.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   229 bits (583),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+   L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKXXELPDDQETKLYIATDGRSRWXPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFXCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            GWG P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIY  170



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  253  LAGHVWRSVSKARALPDDQETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMS  312

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  313  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  372

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM LF+  LY
Sbjct  373  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  427



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATPVA +G+L +
Sbjct  259  LAGHVWRSTCMARGLTQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I   L  MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  319  KPIWYAASKIHDQLAIMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  286  LAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMS  345

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  346  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  405

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  406  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  460



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   L RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGLIHDVLARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGR+RL P+LPPG+ GNVIFTATPVA +G+L +
Sbjct  259  LAGHVWRSTCMARGLTQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I   L  MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  319  KPIWYAASKIHDQLAIMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  289  LAGHVWRSVCKARALPDDQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMS  348

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  349  KPTWYAASRIHNALLRMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  408

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  409  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  463



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A H+WRC CEAR L DDQ TK+YIA DGRSRL P LPPG+ GN +FTATP+A +G+++ 
Sbjct  272  VAGHVWRCACEARSLPDDQKTKVYIAIDGRSRLRPPLPPGYFGNALFTATPIAAAGDVIG  331

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            + L  SA +I  A+ RMDDEYLRSALDYLE QPDL  LVRG++ +  PNL I SW RLP+
Sbjct  332  KSLRHSATKIHEAIARMDDEYLRSALDYLELQPDLKALVRGAHTYRCPNLGITSWARLPI  391

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H +DFGWG P+ MGP  I +EG  ++LPSP+ D SLS+A+ L  DH+ +F KL Y+ 
Sbjct  392  HEADFGWGRPIFMGPGGIAFEGLSFVLPSPDNDGSLSVAISLQKDHLNVFHKLFYQL  448



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC AR L D+Q TKLYIATDGRSRL P LPPG+ GNVIFT TPVA +G+L++
Sbjct  280  LAGHVWRSVCRARELPDEQETKLYIATDGRSRLQPPLPPGYFGNVIFTTTPVAVAGDLIS  339

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL+RMD+EYLRSALDYLE QPDL  LVRGS+ F  PNL I SW RLP+
Sbjct  340  KPTWYAASRIHDALMRMDNEYLRSALDYLEVQPDLKALVRGSHTFRCPNLGITSWVRLPI  399

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG PV MGP  I YEG  +I+PS   D ++S+A+ L  D M +FQ L Y F
Sbjct  400  HDADFGWGRPVFMGPGGIAYEGLSFIIPSSTNDGTMSVAIALPPDRMKVFQDLFYDF  456



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWRC C+AR L +DQ TKLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++++
Sbjct  257  LSGHIWRCACKARNLREDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   L RMDD+YLRSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+
Sbjct  317  KPTYYAASVIHDTLGRMDDDYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  +ILPS  KD SLS+A+ L  DHM  F+K+LY+ 
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLAFILPSSTKDGSLSVALGLQPDHMVRFEKMLYEI  433



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            AT+ +   +LAAHIWRC+C AR L  DQ T+LYIATDGRSRL P LP G+ GNVIFT T 
Sbjct  248  ATKYSTYETLAAHIWRCMCMARELDADQPTRLYIATDGRSRLRPPLPSGYFGNVIFTTTV  307

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
             + SG++ TE L  + KR+R +L RMD+EYLRSALD+L+ QPDL  LVRG   F SPNLN
Sbjct  308  TSLSGDIKTETLVQTIKRLRESLKRMDNEYLRSALDHLQVQPDLGALVRGPTTFKSPNLN  367

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            +NSW  LP H++DFGWG P+HMGPA +LYEGTVYIL +P KD  LS+ + L+ D +  F+
Sbjct  368  VNSWISLPTHDADFGWGRPLHMGPASVLYEGTVYILKTPAKDGGLSVIIRLEDDILQRFE  427

Query  104  KLLYKF  87
             LL+ F
Sbjct  428  TLLFDF  433



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  260  LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  320  KPTWYAASRIHNALSRMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM +F++LLY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  434



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWRC C+AR L++DQ TKLYIATDGR+RL P++PPG+ GNVIFT TP+A +G++++
Sbjct  257  LSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVAGDIIS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  AL RMDDEYLRSALDYLE QPDL+ LVRGS+ F  PN+ I SW+RLP+
Sbjct  317  KPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALVRGSHTFRCPNIGITSWSRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  ++LPS   D SLS+A+ L  DHM  F K+LY+ 
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLAFVLPSSANDGSLSVALGLQPDHMARFAKMLYEI  433



>gb|AFR40374.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40384.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=170

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  590  CEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKR  411
            C+AR L DDQ TKLYIATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   +A +
Sbjct  3    CKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGK  62

Query  410  IRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGT  231
            I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG 
Sbjct  63   IHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADFGWGR  122

Query  230  PVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            P+ MGP  I YEG  +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  123  PIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  168



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKARGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   L RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWYAAGLIHDVLARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  +++PSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVVPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V ++RGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  257  LAGHVWRSVGKSRGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   L RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  317  KPTWFAAGLIHDVLARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  377  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  273  LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMS  332

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  333  KPTWYAASRIHNALSRMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  392

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM +F++LLY
Sbjct  393  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  447



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC C AR L +DQ TKLYIATDGR+RL P LP G+ GNVIFT TP A +G+L +
Sbjct  254  LAGHVWRCACLARSLPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTTTPQAVAGDLDS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I  AL +MD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  314  KPVWYAASKIHDALAQMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQAEHMKLFEKLLY  428



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L +DQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  260  LAGHVWRSVCKARSLPEDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAVAGDLMS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  320  KPTWYAASRIHNALLRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 135/185 (73%), Gaps = 0/185 (0%)
 Frame = -1

Query  641  TRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPV  462
            TR +    LA H+WRC C ARGLSDDQ TK+YIATD R RL P LP G+ GN I T TP+
Sbjct  256  TRYSSYEILAGHVWRCACRARGLSDDQDTKVYIATDARMRLSPPLPQGYFGNGILTTTPI  315

Query  461  AESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNI  282
            A +G+L+++P++ +A++I  +L RM+D YLRSALDYLE QPDLS L RG++ F  PNL I
Sbjct  316  AVAGDLISKPVSYAAQKIHESLARMNDNYLRSALDYLELQPDLSALARGAHTFRCPNLGI  375

Query  281  NSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQK  102
             SW RLP+H++DFGWG P++MGP  I YEG  YILPSP  D SLS+A+ L  +H+  F+K
Sbjct  376  VSWVRLPIHDADFGWGRPIYMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHVKPFEK  435

Query  101  LLYKF  87
              Y F
Sbjct  436  FFYDF  440



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+ARGL +DQ TK YIA DGRSRL P LPPG+LGNVIFTATP+  +G+L++
Sbjct  255  LAGHVWRSVCKARGLPEDQETKFYIAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLVS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  A+VRMDD YL SALDYLE QPDLS LVRG++ +  PNL I SWT+LP+
Sbjct  315  KPTWYAAGMIHDAIVRMDDNYLWSALDYLEMQPDLSALVRGAHTYKCPNLGITSWTKLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P++MGP  I +EG  ++LPSP  D SLSLA+ L ++HM LF+K  Y 
Sbjct  375  YDADFGWGRPIYMGPGAIAFEGLSFVLPSPTNDGSLSLAINLQSEHMKLFKKFFYN  430



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLYIA DGRSRL P LPPG+ GNV+FTATP+  +G+L++
Sbjct  252  LAGHVWRAVGKARGLPDDQETKLYIAIDGRSRLRPQLPPGYFGNVVFTATPLTVAGDLVS  311

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   +VRMDDEYLRSALDYLE QPDLS LVRG++ +  PNL I SW +LP+
Sbjct  312  KPTWYAAGMIHDVIVRMDDEYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWAKLPI  371

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  I +EG  ++LPSP  D SLSLA+ L ++HM LF+K LY+ 
Sbjct  372  YDADFGWGRPLFMGPGAIAFEGLSFLLPSPTDDGSLSLAISLQSEHMKLFEKFLYEI  428



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G++ +
Sbjct  271  LSGHVWRCACKARELPEDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAMAGDIQS  330

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI   L RMD++YLRSALDYLE QP LS LVRG++ F  PNL I SW RLP+
Sbjct  331  KPTWYAASRIHDTLARMDNDYLRSALDYLELQPSLSALVRGAHTFRCPNLGITSWVRLPI  390

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I++EG  ++LPSP  D SLS+A+ L   HM  F+KLLY
Sbjct  391  HDADFGWGRPIFMGPGGIMFEGLAFMLPSPANDGSLSVAIGLQPQHMKAFEKLLY  445



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L  DQ TKLYIATDGRSRL P+ PPG+ GNVIFT TP+A +G+L++
Sbjct  257  LAGHVWRSVCKARALPHDQETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  317  KPTWYAASRIHNALLRMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  I YEG  +I+P+   D S+S+A+ L  DHM +F+  LY
Sbjct  377  HDADFGWGRPVFMGPGGIAYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL+ DQ TKLYIATDGR+RL P+LP G+ GNVIFTATPVA +G+L +
Sbjct  259  LAGHVWRSTCMARGLAQDQETKLYIATDGRARLRPSLPSGYFGNVIFTATPVAVAGDLQS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I   L  MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+
Sbjct  319  KPIWYAASKIHDQLAIMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPI  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  379  HDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  433



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRCV +ARGL DDQ TKLYIATDGR+RL P+LP G+ GNVIFT TP+A +G+L +
Sbjct  260  LSGHVWRCVRKARGLPDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  AL RMDD+YL+SALDYLE QPDL  LVRG + F  PNL I SW RLP+
Sbjct  320  KPTWYAASKIHDALARMDDDYLKSALDYLELQPDLKALVRGVHTFKCPNLGITSWARLPI  379

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+ + L A+HM LF K LY
Sbjct  380  HDADFGWGRPIFMGPGGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLY+A DGRSRL P LPPG+ GNVIFTATP+  +GELL+
Sbjct  255  LAGHVWRSVGKARGLPDDQETKLYVAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   + RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  315  KPTWYAAGLIHDVIARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  375  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L  DQ TKLYIATDGRSRL P+ PPG+ GNVIFT TP+A +G+L++
Sbjct  257  LAGHVWRSVCKARALPHDQETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+
Sbjct  317  KPTWYAASRIHNALLRMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  I YEG  +I+P+   D S+S+A+ L  DHM +F+  LY
Sbjct  377  HDADFGWGRPVFMGPGGIAYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>ref|XP_008466864.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis melo]
Length=280

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L DDQ TKLYIATDGR+RL P LP G+ GNVIFTATP+A +GEL++
Sbjct  104  LSGHVWRCTCKARELPDDQDTKLYIATDGRARLRPPLPNGYFGNVIFTATPLAVAGELMS  163

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P   +A +I  AL RMD++YLRSALDYLE QP++S LVRG++ F  PNL I SW RLP+
Sbjct  164  NPTWFAAGKIHDALTRMDNDYLRSALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPI  223

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  224  HDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  278



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P LP G+ GNVIFT TP+A +G+L++
Sbjct  262  LAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTPIAVAGDLMS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDALIRMDNEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLSLA+ L  + M +FQ+L Y
Sbjct  382  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWRC C+AR L++DQ TKLYIATDGR+RL P++PPG+ GNVIFT TP+A +G++++
Sbjct  257  LSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVTGDIIS  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I  AL RMDDEYLRSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+
Sbjct  317  KPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG P+ MGP  I YEG  ++LPS   D SLS+A+ L  DHM  F K+LY+ 
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLAFVLPSSVNDGSLSVALGLQPDHMVRFAKMLYEI  433



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score =   234 bits (596),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR V +ARGL DDQ TKLYIATDGRSR  P LPPGF GNV+F A P+   G+LL+
Sbjct  254  LAAHVWRSVGKARGLPDDQETKLYIATDGRSRFRPQLPPGFFGNVVFAAAPLTVVGDLLS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P + +A  I  A+  MDD YLRSALDYLE QPDLS LVRG+  + SPNL I SW RLP+
Sbjct  314  KPTSYAAGIIHDAIASMDDSYLRSALDYLEMQPDLSALVRGAQTYKSPNLGITSWARLPM  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+++GP  I YEG  ++LPSP  D SLSLA+ L  +HM LF+K L++
Sbjct  374  YDADFGWGRPIYVGPGAIAYEGLSFVLPSPTNDGSLSLAIALQPEHMKLFEKFLFE  429



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C ARGL  DQ TK+YIATDGR RL PALP G+ GNVIFT TP+A +GE+  
Sbjct  262  LAAHVWRCACVARGLPPDQPTKMYIATDGRQRLRPALPEGYFGNVIFTTTPIATAGEVAA  321

Query  437  EPL--ASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
            E    A +A RI++AL RMD+ YLRSALDYLE QPDL+ LVRG++ F  PN+ + SW RL
Sbjct  322  EGCGPAPAAGRIQAALARMDEPYLRSALDYLELQPDLAALVRGAHTFRCPNIGLTSWVRL  381

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            P+H++DFGWG PV MGP  I YEG  ++LPSP  D SLSLA+ L ADHM  F+KL+Y
Sbjct  382  PIHDADFGWGRPVFMGPGGIAYEGLAFLLPSPTGDGSLSLAISLRADHMLKFRKLIY  438



>gb|ACF85468.1| unknown [Zea mays]
 gb|AFW72295.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=257

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 1/189 (1%)
 Frame = -1

Query  653  RTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFT  474
            R  A R +    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GNVIFT
Sbjct  70   REGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFT  129

Query  473  ATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASP  294
            ATP+A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ F  P
Sbjct  130  ATPLANAGTV-TAGVAEGASVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCP  188

Query  293  NLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMP  114
            NL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM 
Sbjct  189  NLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHME  248

Query  113  LFQKLLYKF  87
             F+KL+Y F
Sbjct  249  KFRKLIYDF  257



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLY+A DGRSRL P LPPG+ GNVIFTATP+  +G+LL+
Sbjct  255  LAGHVWRSVGKARGLPDDQETKLYVAVDGRSRLRPQLPPGYFGNVIFTATPLTVAGDLLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   + RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  315  KPTWFAAGMIHDVIARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  375  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLY+A DGRSRL P LPPG+ GNVIFTATP+  +GELL+
Sbjct  255  LAGHVWRSVGKARGLPDDQETKLYVAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   + RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  315  KPTWYAAGLIHDVIARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  375  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+T
Sbjct  257  LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMT  316

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  317  KPTWYAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPI  376

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM +F+  LY
Sbjct  377  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSANDGSLSVAIALQHEHMKVFKDFLY  431



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  258  LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPTWYAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM +F++ LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+ARGL DDQ TKLY+A DGRSRL P LPPG+ GNVIF+ATP+  +G+LL+
Sbjct  255  LAGHVWRSVCKARGLPDDQETKLYVAIDGRSRLRPQLPPGYFGNVIFSATPLTFAGDLLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   +VRMDD+YLRSALDYLE QPDLS LVR ++ +  PNL I SW RLP+
Sbjct  315  KPTWYAAVLIHDVIVRMDDKYLRSALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPM  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ +GP  I YEG  ++LPSP  D SLSLA+ L ++HM LF+K LY+ 
Sbjct  375  YDADFGWGRPIFVGPGAIAYEGLSFLLPSPTNDGSLSLAISLQSEHMKLFEKFLYEI  431



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL DDQ TKLY+A DGRSRL P LPPG+ GNVIFTATP+  +GELL+
Sbjct  255  LAGHVWRSVGKARGLPDDQETKLYVAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLS  314

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   + RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  315  KPTWYAAGLIHDVIARMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPI  374

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  375  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L AH+W CVC+ARGLSDDQ TKLYI  DGRS+L P LPPG+LGNVIF A   A SG+L +
Sbjct  262  LTAHVWHCVCKARGLSDDQATKLYIPIDGRSKLHPPLPPGYLGNVIFIAATTALSGDLQS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP A + +RI   + RMDD+Y+RSALDY+E  PD+  L+RG++ F SPNL+INSW RLP+
Sbjct  322  EPFADTIQRINRMVKRMDDKYMRSALDYIESVPDMKTLMRGAHTFQSPNLSINSWMRLPL  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            + +DFGWG P+H+G A +++EG + I+PSP  D SLSL VCL+  HM  F+K LY F
Sbjct  382  YAADFGWGRPMHVGLANVIHEGKICIVPSPVDDGSLSLVVCLETSHMKQFEKCLYDF  438



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +ARGL ++Q TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL+
Sbjct  248  LAGHVWRSVGKARGLPENQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLS  307

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   L RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP+
Sbjct  308  KPTWYAAGLIHDVLSRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPI  367

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L  +HM LF+KLLY
Sbjct  368  YDADFGWGRPIFMGPGGIPYEGLSFVLPSPINDGSLSVAIALQTEHMKLFEKLLY  422



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L++
Sbjct  258  LAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMS  317

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL RMD++YLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  318  KPTWYAASRIHNALSRMDNDYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L  +HM +F++ LY
Sbjct  378  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = -1

Query  641  TRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPV  462
            TR      LA H+WRC C ARGLSDDQ TKL IA DGR RL P LP G+ GN IFT TP+
Sbjct  256  TRYTSYEILAGHVWRCACRARGLSDDQDTKLSIAIDGRMRLSPPLPQGYFGNGIFTITPI  315

Query  461  AESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNI  282
            A +G+L+++P+  +A+ I  +L R +D+YLRSALDYLE QPDLS L RG++ F  PNL I
Sbjct  316  AVAGDLISKPVLYAARTIHESLARANDDYLRSALDYLELQPDLSALARGAHTFRCPNLGI  375

Query  281  NSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQK  102
             SW RLP+H++DFGWG P++MGP  I YEG  YILPSP  D SLS+A+ L  +HM  F+K
Sbjct  376  TSWVRLPIHDADFGWGRPIYMGPGRIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEK  435

Query  101  LLYKF  87
              Y  
Sbjct  436  FFYDL  440



>gb|ACF81845.1| unknown [Zea mays]
 gb|AFW72296.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=319

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 1/189 (1%)
 Frame = -1

Query  653  RTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFT  474
            R  A R +    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GNVIFT
Sbjct  132  REGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFT  191

Query  473  ATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASP  294
            ATP+A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ F  P
Sbjct  192  ATPLANAGTV-TAGVAEGASVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCP  250

Query  293  NLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMP  114
            NL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM 
Sbjct  251  NLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHME  310

Query  113  LFQKLLYKF  87
             F+KL+Y F
Sbjct  311  KFRKLIYDF  319



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR V +ARGL DDQ TKLY+  DGRSRL P LP G+ GNV+FTATP+  +G+LL+
Sbjct  250  LAAHVWRSVGKARGLPDDQETKLYVPIDGRSRLRPQLPLGYFGNVLFTATPMTVAGDLLS  309

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P + +A  I  A+ RMDD+YLRSALDYLE QPDLS+LVRG++ +  PNL I SW RLP+
Sbjct  310  KPTSYAAGMIHDAIARMDDKYLRSALDYLEMQPDLSELVRGAHTYKCPNLGITSWARLPI  369

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            +++DFGWG P+ MGP  I +EG  ++LPSP+ D SLSL + L ++HM LF+K LY+
Sbjct  370  YDADFGWGRPIFMGPGAIAFEGLSFVLPSPSNDGSLSLVISLQSEHMKLFKKFLYE  425



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWR +C ARGL DDQ TKLYIATDGR+R+ P LP  + GNVIFT TP+A +G+L++
Sbjct  275  LSGHIWRSMCLARGLDDDQETKLYIATDGRARVVPPLPKHYFGNVIFTCTPMALAGDLVS  334

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             PL  +A  I +A+ RM+DEYLRSALDYLE QPDL KLVRG++ F SPNL I SW+RLPV
Sbjct  335  RPLYYAASVIHNAVSRMNDEYLRSALDYLELQPDLYKLVRGAHTFRSPNLGITSWSRLPV  394

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
            +++DFGWG PV MGPA+I +EG VY+LPS   D SLS+++ L  +HMP F++L+
Sbjct  395  YDADFGWGRPVFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  448



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIWR +C ARGL DDQ TKLYIATDGR+R+ P LP  + GNVIFT TP+A +G+L++
Sbjct  273  LSGHIWRSMCLARGLDDDQETKLYIATDGRARVVPPLPKHYFGNVIFTCTPMALAGDLVS  332

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             PL  +A  I  A+ RM+DEYLRSALDYLE QPDL KLVRG++ F SPNL I SW+RLPV
Sbjct  333  RPLYYAASVIHDAVSRMNDEYLRSALDYLELQPDLYKLVRGAHTFRSPNLGITSWSRLPV  392

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
            +++DFGWG PV MGPA+I +EG VY+LPS   D SLS+++ L  +HMP F++L+
Sbjct  393  YDADFGWGRPVFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  446



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P LP G+ GNVIFT T +A +G+L++
Sbjct  262  LAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTRIAVAGDLMS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  322  KPTWYAASRIHDALIRMDNEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D SLSLA+ L  + M +FQ+L Y
Sbjct  382  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 138/190 (73%), Gaps = 2/190 (1%)
 Frame = -1

Query  659  SKRTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVI  480
            +K  + +R +     AAH+WRC   AR L  DQ +KLYIATDGR RL P LP G+ GNVI
Sbjct  246  AKAPKGSRYSTYALFAAHVWRCASLARELPPDQLSKLYIATDGRQRLRPQLPAGYFGNVI  305

Query  479  FTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFA  300
            FTATPVAE  E++      +A RI+++L RMDDEYLRSALDYLE QPDL+ LVRG++ F 
Sbjct  306  FTATPVAEMVEVVGS--EGAAGRIQASLARMDDEYLRSALDYLEIQPDLAALVRGAHTFR  363

Query  299  SPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADH  120
             PN+ + SW RLP+H++DFGWG PV MGP  I YEG  ++LPSP+ D SLSLA+ L A+H
Sbjct  364  CPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSPDGDGSLSLAISLQAEH  423

Query  119  MPLFQKLLYK  90
            M  FQKL+Y+
Sbjct  424  MLRFQKLIYE  433



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA HIWRCVC+AR L+DDQ T++YIATDGRSRL P LPPG+ GNV+FTA P+A +G++ +
Sbjct  270  LAGHIWRCVCKARALADDQETRVYIATDGRSRLQPPLPPGYFGNVVFTAAPLATAGDIQS  329

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL RMD+ YLRSALDYLE QPDL  L RG++ F  PNL I SW RLP+
Sbjct  330  KPTRYAASRIHDALARMDNNYLRSALDYLELQPDLMALARGAHTFRCPNLGITSWVRLPI  389

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  + +EG V +L SP +D SLS+++ L  +H+  F+KL+Y
Sbjct  390  HDADFGWGRPVFMGPGKVSFEGFVIVLRSPIEDGSLSISINLQQEHLKAFEKLIY  444



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L  H+WRCVC+ARGL DDQ TKLY+A D RSRL P LP G+ GN     +P+  +G+L +
Sbjct  256  LVGHVWRCVCKARGLCDDQDTKLYMAVDLRSRLRPPLPQGYFGNGTLVTSPIGVAGDLRS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PLA +  RI   L+RM+DEYLRSA+DYLE QPDL+ LVRG++ F  PN+ I +WT+LP+
Sbjct  316  KPLAYAVGRIHDQLMRMNDEYLRSAIDYLELQPDLTALVRGADTFRCPNMGIVNWTQLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P++MGPA +L+EG  YILPSP +D S +LAV L +DHM LF+K+ Y F
Sbjct  376  YDADFGWGRPIYMGPATVLHEGMAYILPSPAQDGSATLAVSLQSDHMQLFEKIFYDF  432



>ref|XP_002452435.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
 pdb|4KE4|A Chain A, Elucidation Of The Structure And Reaction Mechanism 
Of Sorghum Bicolor Hydroxycinnamoyltransferase And Its Structural 
Relationship To Other Coa-dependent Transferases And Synthases
 pdb|4KEC|A Chain A, Sbhct-complex Form
 gb|EES05411.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
Length=448

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -1

Query  665  PFSKRTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGN  486
            P  +R  A R +    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GN
Sbjct  257  PAREREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGN  316

Query  485  VIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNY  306
            VIFTATP+A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ 
Sbjct  317  VIFTATPLANAGTV-TAGVAEGAAVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHT  375

Query  305  FASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDA  126
            F  PNL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A
Sbjct  376  FRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQA  435

Query  125  DHMPLFQKLLYKF  87
            +HM  F+KL+Y F
Sbjct  436  EHMEKFRKLIYDF  448



>gb|KHN22398.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=540

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR VC+AR L DDQ TKLYIATDGR+RL P L PG+ GNVIFT TP+A +G+L++
Sbjct  364  LAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLTPGYFGNVIFTTTPIAVAGDLMS  423

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  424  KPTWFAASRIHDALIRMDNEYLRSALDYLELQPDLKVLVRGAHTFRCPNLGITSWARLPI  483

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS   D S+S+A+ L  + M +FQ+L Y
Sbjct  484  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAIALPPEQMKVFQELFY  538



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 137/185 (74%), Gaps = 1/185 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  ARGL  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  256  APRFSTYAVLAAHVWRCVSLARGLPTEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RM+D+Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  316  LAEAGKV-TSGLADGAAVIQEALDRMNDDYCRSALDYLELQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS NKD SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFR  434

Query  104  KLLYK  90
            KL+++
Sbjct  435  KLIFE  439



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 2/195 (1%)
 Frame = -1

Query  668  SPFSKRTRA-TRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFL  492
            S F K      R +   +LAAHIWRC+C+ARGLS+DQ TKLYIATDGR RL P LP G+ 
Sbjct  244  SKFKKNENGMVRHSTYETLAAHIWRCMCKARGLSNDQATKLYIATDGRFRLRPPLPRGYF  303

Query  491  GNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGS  312
            GNV+FTAT    S E+ + PL    ++I SAL  MDDEYLRSALD+L+ QPDL+ L RG+
Sbjct  304  GNVLFTATVKTSSEEVQSNPL-KIVEKIHSALKGMDDEYLRSALDFLQMQPDLTALKRGA  362

Query  311  NYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCL  132
            + F SPNLNI SW +LP+H +DFGW  P+ MGPA +++EG  Y+LPSP  D SL L +CL
Sbjct  363  STFRSPNLNIVSWMKLPIHEADFGWSRPIFMGPASVVFEGMGYVLPSPRNDGSLRLIICL  422

Query  131  DADHMPLFQKLLYKF  87
            + DH+ LFQ   Y+ 
Sbjct  423  ETDHIQLFQAYFYEL  437



>ref|NP_001132890.1| LOC100194386 [Zea mays]
 ref|XP_008681252.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 ref|XP_008681253.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 gb|ACF81923.1| unknown [Zea mays]
 gb|ACF84236.1| unknown [Zea mays]
 gb|ACR38175.1| unknown [Zea mays]
 gb|AFW72298.1| anthranilate N-benzoyltransferase protein 1 isoform 1 [Zea mays]
 gb|AFW72299.1| anthranilate N-benzoyltransferase protein 1 isoform 2 [Zea mays]
 gb|AFW72300.1| anthranilate N-benzoyltransferase protein 1 isoform 3 [Zea mays]
 gb|AFW72301.1| anthranilate N-benzoyltransferase protein 1 isoform 4 [Zea mays]
Length=446

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 1/189 (1%)
 Frame = -1

Query  653  RTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFT  474
            R  A R +    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GNVIFT
Sbjct  259  REGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFT  318

Query  473  ATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASP  294
            ATP+A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ F  P
Sbjct  319  ATPLANAGTV-TAGVAEGASVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCP  377

Query  293  NLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMP  114
            NL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM 
Sbjct  378  NLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHME  437

Query  113  LFQKLLYKF  87
             F+KL+Y F
Sbjct  438  KFRKLIYDF  446



>gb|ACG29714.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
 gb|ACG30562.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=447

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 1/189 (1%)
 Frame = -1

Query  653  RTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFT  474
            R  A R +    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GNVIFT
Sbjct  260  REGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFT  319

Query  473  ATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASP  294
            ATP+A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ F  P
Sbjct  320  ATPLANAGTV-TAGVAEGASVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCP  378

Query  293  NLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMP  114
            NL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM 
Sbjct  379  NLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHME  438

Query  113  LFQKLLYKF  87
             F+KL+Y F
Sbjct  439  KFRKLIYDF  447



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  ARGL  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  258  APRFSTYAVLAAHVWRCVSLARGLPSEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATP  317

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RM+D Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  318  LAEAGKV-TSGLADGAAVIQEALDRMNDSYCRSALDYLELQPDLSALVRGAHTFRCPNLG  376

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS NKD SLS+A+ L A+HM  F+
Sbjct  377  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFR  436

Query  104  KLLYK  90
            KL+++
Sbjct  437  KLIFE  441



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  ARGL  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  275  APRFSTYAVLAAHVWRCVSLARGLPSEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATP  334

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RM+D Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  335  LAEAGKV-TSGLADGAAVIQEALDRMNDSYCRSALDYLELQPDLSALVRGAHTFRCPNLG  393

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS NKD SLS+A+ L A+HM  F+
Sbjct  394  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFR  453

Query  104  KLLYK  90
            KL+++
Sbjct  454  KLIFE  458



>ref|XP_007149788.1| hypothetical protein PHAVU_005G0988001g, partial [Phaseolus vulgaris]
 gb|ESW21782.1| hypothetical protein PHAVU_005G0988001g, partial [Phaseolus vulgaris]
Length=189

 Score =   219 bits (557),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC+C+ARGL +DQ T+LYI TDGRSRL P LPPG+LGNVIF+  P A +G+L++
Sbjct  13   LAAHMWRCLCKARGLPEDQETRLYIPTDGRSRLQPPLPPGYLGNVIFSTIPKALAGDLVS  72

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I +A+ RMD+EYLRSALDYL+ QPDL+ LVRG++ F  PN+ INSW + P+
Sbjct  73   KPTWYAANQIHNAIARMDNEYLRSALDYLQLQPDLNALVRGAHTFGCPNVGINSWAKFPI  132

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ M P  IL EG   I+PS   D  L LA+ L   HM LFQ+ LY
Sbjct  133  YDADFGWGRPIFMRPGWILNEGLSIIIPSSTNDGGLYLAMALPPHHMKLFQEFLY  187



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGL+ +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  256  APRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGRQRLTPTLPDGYFGNVIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL +MDDEY  SALDYLE QPDLS LVRG++ F  PNL 
Sbjct  316  LAEAGKV-TGSLADGATTIQDALEKMDDEYCHSALDYLELQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFR  434

Query  104  KLLYKF  87
            K+++ F
Sbjct  435  KMIFDF  440



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  569  DDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVR  390
            DDQ TKLYIATDGR+RL P LPPG+ GNVIFTATP+A +G+LL++P   +A RI  ALVR
Sbjct  244  DDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVR  303

Query  389  MDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
            MDDEYLRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP 
Sbjct  304  MDDEYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPG  363

Query  209  LILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I YEG  ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  364  GIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  402



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGL+ +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  258  APRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGRQRLLPPLPEGYFGNVIFTATP  317

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G+++   LA  A  I++AL RMD+EY RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  318  LAEAGKVIAS-LADGANTIQAALERMDNEYCRSALDYLELQPDLSALVRGAHTFRCPNLG  376

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H +DFGWG PV MGP  I YEG  ++LPS ++D SLS+A+ L A+HM  F+
Sbjct  377  LTSWVRLPIHEADFGWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFR  436

Query  104  KLLYKF  87
            K+++ F
Sbjct  437  KMIFDF  442



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGL+ +Q TKLY ATDGR RL P LP G+ GN IFTATP
Sbjct  256  APRFSTYAVLGAHVWRCASMARGLAPEQPTKLYCATDGRQRLTPTLPDGYFGNAIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL +MDDEY  SALDYLE QPDLS LVRG++ F  PNL 
Sbjct  316  LAEAGKV-TGSLADGATTIQEALEKMDDEYCHSALDYLELQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFR  434

Query  104  KLLYKF  87
            K+++ F
Sbjct  435  KMIFDF  440



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 2/175 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
             +AH+WRC   AR L  DQ TKLYIATDGR RL P LP G+ GNVIFTATPVA + E+++
Sbjct  260  FSAHVWRCASLARELPPDQLTKLYIATDGRQRLRPPLPAGYFGNVIFTATPVAAAAEVVS  319

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
                 +A RI+++L RMDD+YLRSA+DYLE QPDL  LVRG++ F  PN+ + SW RLP+
Sbjct  320  S--EGAAGRIQASLARMDDQYLRSAVDYLEIQPDLRALVRGAHTFRCPNIGLTSWVRLPI  377

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG PV MGP  I YEG  ++LPSP+ D SLSLA+ L A+HM  FQKL+Y
Sbjct  378  HDADFGWGRPVFMGPGGIAYEGLAFVLPSPDGDGSLSLAISLQAEHMLRFQKLIY  432



>gb|EMS64908.1| Anthranilate N-benzoyltransferase protein 1 [Triticum urartu]
Length=370

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+AH+WRCVC +RGL  DQ TKLY A DGR RL P LP GFLGNV+FTATP+ E+G++ T
Sbjct  195  LSAHVWRCVCLSRGLPSDQPTKLYCAIDGRKRLKPPLPDGFLGNVLFTATPIVEAGKV-T  253

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
              LA +AK I+  L RM+D+Y RSALDYLE QPDLS LVRG+  +  PNL I SW  LPV
Sbjct  254  RGLADAAKIIQMELDRMNDDYCRSALDYLELQPDLSALVRGAQTYRCPNLGITSWVNLPV  313

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            HN+DFGWG PV MGP  + +EG  Y+LPS + D SLS+A+ L ADHM  F++L++
Sbjct  314  HNADFGWGRPVFMGPGGVAFEGLAYVLPSAHNDGSLSIAISLQADHMKKFRQLIF  368



>ref|XP_004953073.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=518

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 135/189 (71%), Gaps = 1/189 (1%)
 Frame = -1

Query  653  RTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFT  474
            R  A R +    LAAH+WRC   ARGL  DQ TK+Y ATDGR RL P LP G+ GNVIFT
Sbjct  331  REGAPRFSTYAVLAAHVWRCASLARGLPADQPTKMYCATDGRQRLQPPLPEGYFGNVIFT  390

Query  473  ATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASP  294
            ATP+A++G + T  +A  A  I+ AL RMDD Y RSALDYLE QPDLS LVRG++ F  P
Sbjct  391  ATPLADAGTV-TAGVAEGAAVIQEALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCP  449

Query  293  NLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMP  114
            NL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM 
Sbjct  450  NLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHME  509

Query  113  LFQKLLYKF  87
             F+KL+Y F
Sbjct  510  KFRKLIYDF  518



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC  +AR L DDQ TKL++A DGRSRL P LPPGF GNV+F   P A +G+L +
Sbjct  265  LAGHVWRCATKARNLPDDQVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI   +VRM+++YLRSALD+LE QPDLS LVRG++ F  P L I SW RLP+
Sbjct  325  KPTWYAAGRIHDVVVRMNNDYLRSALDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPI  384

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  385  YDADFGWGRPIFMGPGGIGYEGLAFVLPSPTNDGSLSVAISLQSDHMKSFAKLLY  439



>ref|XP_001756433.1| predicted protein [Physcomitrella patens]
 gb|EDQ78829.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ HIW+C+ +AR L++ Q TKL++ATDGRSRL P LP G+ GNVIFT TP+A +GEL++
Sbjct  234  LSGHIWKCITQARKLAESQETKLFVATDGRSRLNPPLPKGYFGNVIFTCTPIATAGELVS  293

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P+  +A++I  +L RM+DEYLRSALDYLE Q D+SKLVRG+++F SPNL I SW R+P 
Sbjct  294  NPITYAARKIHDSLARMNDEYLRSALDYLETQEDISKLVRGAHHFNSPNLGITSWARMPT  353

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            ++ DFGWG P+ MGPA I YEG VY+L SP  D SLSL++ L +DHM  F KL+  F
Sbjct  354  YDCDFGWGRPIFMGPATIAYEGLVYVLASPVNDGSLSLSLGLRSDHMDTFAKLVASF  410



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 134/177 (76%), Gaps = 1/177 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+W+CV  ARGL+ +Q TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ T
Sbjct  264  LAAHVWKCVSLARGLTPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGKV-T  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
              LA  A  I+ AL RMD++Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+
Sbjct  323  SGLAEGAAVIQGALDRMDNDYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H+++FGWG PV MGP  I YEG  ++LPS N D SLS+A+ L A+HM  F+KL+Y+ 
Sbjct  383  HDANFGWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMVKFRKLIYEL  439



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L AHIWRC C+ARGLS DQ TK+ I+T+GR+RL P +PPG+ GNVIF ATP+A SG+L +
Sbjct  259  LTAHIWRCACKARGLSYDQATKINISTNGRNRLRPPIPPGYFGNVIFQATPIALSGDLSS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            E LA  A+RI  A+ RMDDEYLRSA+DYLE   DL+ ++R S  + SPNLNI SW R P 
Sbjct  319  ERLAHIAERIHKAIKRMDDEYLRSAVDYLEKVDDLTTVMRSSETYRSPNLNIVSWVRFPF  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG PV+M PA   +EG  YILPSP  D +LSL +CL+ DH+  FQKL Y++
Sbjct  379  YDADFGWGKPVYMRPAFA-FEGKGYILPSPTNDGTLSLTICLETDHLESFQKLFYEY  434



>gb|AGM90558.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
2 [Panicum virgatum]
Length=446

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = -1

Query  668  SPFSKRTRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLG  489
            S    R    R++    LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ G
Sbjct  254  SQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFG  313

Query  488  NVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSN  309
            NVIFTATP+A++G + T  +A  A  I++AL RMD+ Y RSALDYLE QPDLS LVRG++
Sbjct  314  NVIFTATPLADAGTV-TAGVAEGAAVIQAALDRMDEGYCRSALDYLELQPDLSALVRGAH  372

Query  308  YFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLD  129
             F  PNL + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L 
Sbjct  373  TFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQ  432

Query  128  ADHMPLFQKLLYKF  87
            A+HM  F+K +Y F
Sbjct  433  AEHMEKFRKFIYDF  446



>dbj|BAC78633.1| hydroxyanthranilate hydroxycinnamoyltransferase 1 [Avena sativa]
Length=441

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGL+ +Q TKLY ATDGR RL P  P G+ GNVIFTATP
Sbjct  257  APRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGRQRLTPTHPDGYFGNVIFTATP  316

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL +MDDEY  SALDYLE QPDLS LVRG++ F  PNL 
Sbjct  317  LAEAGKV-TGSLADGATTIQDALEKMDDEYCHSALDYLELQPDLSALVRGAHTFRCPNLG  375

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM  F+
Sbjct  376  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFR  435

Query  104  KLLYKF  87
            K+++ F
Sbjct  436  KMIFDF  441



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAH+WRC+C+ARGLS DQ TKLYI TDGR RL P LPPG+ GN +FT+T  A SG+L
Sbjct  255  ETLAAHLWRCICKARGLSHDQPTKLYIPTDGRLRLRPTLPPGYFGNALFTSTLTANSGDL  314

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
             +E  + + +RIR+A+  M+DEYLRSA+DYLE QP+L+ LVRG++ F SPNL + SWTRL
Sbjct  315  QSEAFSDTVQRIRNAIAGMEDEYLRSAVDYLEMQPNLTALVRGAHTFRSPNLVVGSWTRL  374

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            P+H+++FGWG P+HMG    ++EG   I  SP KD  LS+ +CL+A  M LF+ LLY
Sbjct  375  PIHDANFGWGRPMHMGLGSGVFEGNACIQRSPTKDNHLSVVICLEAQPMQLFKDLLY  431



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR  C+AR L +DQ TKLYIATDGR+RL P LP G+ GNVIFT TP+A +GEL++
Sbjct  254  LSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P   +A +I  AL RMD++YLRSALDYLE QP++S LVRG++ F  PNL I SW RLP+
Sbjct  314  NPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR  C+AR L +DQ TKLYIATDGR+RL P LP G+ GNVIFT TP+A +GEL++
Sbjct  254  LSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P   +A +I  AL RMD++YLRSALDYLE QP++S LVRG++ F  PNL I SW RLP+
Sbjct  314  NPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +AR L  DQ TKLYIATDGRSRL P+LP G+ GNVIFT TP+A + +L++
Sbjct  256  LAGHVWRSVSKARALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL++MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPTWYAASRIHNALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            + +DFGWG P+ MGP  I YEG  +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  376  YEADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +AR L  DQ TKLYIATDGRSRL P+LP G+ GNVIFT TP+A + +L++
Sbjct  256  LAGHVWRSVSKARALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL++MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPTWYAASRIHNALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            + +DFGWG P+ MGP  I YEG  +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  376  YEADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>gb|AFR40245.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=191

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWXAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  158  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  190



>gb|AFR40216.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=192

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  192



>gb|AFR40214.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40215.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40218.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40220.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40221.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40222.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40224.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40225.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40227.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40228.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40237.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40247.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=193

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  192



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+W+CV  AR L  +Q TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ T
Sbjct  263  LAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGKV-T  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
              LA  A  I+ AL RMD++Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+
Sbjct  322  SGLAEGAAVIQGALDRMDNDYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H++DFGWG PV MGP  I YEG  ++LPS N D SLS+A+ L A+HM  F+KL+Y+ 
Sbjct  382  HDADFGWGRPVSMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLIYEL  438



>dbj|BAJ87836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGLS +Q TKLY ATDGR RL PALP G+ GNVIFTATP
Sbjct  256  APRFSTYAVLGAHVWRCASLARGLSPEQPTKLYCATDGRQRLQPALPEGYFGNVIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +A +G++ T  LA  A  I++AL  MD+EY RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  316  LAVAGKV-TGSLADGATTIQAALEVMDNEYCRSALDYLEMQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS ++D SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFR  434

Query  104  KLLYKF  87
            K+++ F
Sbjct  435  KMIFDF  440



>dbj|BAK06288.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    L AH+WRC   ARGLS +Q TKLY ATDGR RL PALP G+ GNVIFTATP
Sbjct  257  APRFSTYAVLGAHVWRCASLARGLSPEQPTKLYCATDGRQRLQPALPEGYFGNVIFTATP  316

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +A +G++ T  LA  A  I++AL  MD+EY RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  317  LAVAGKV-TGSLADGATTIQAALEVMDNEYCRSALDYLEMQPDLSALVRGAHTFRCPNLG  375

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS ++D SLS+A+ L A+HM  F+
Sbjct  376  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFR  435

Query  104  KLLYKF  87
            K+++ F
Sbjct  436  KMIFDF  441



>gb|AFR40243.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=191

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  39   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  99   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  159  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  191



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L DDQ TKL++A DGR+RL P LP  + GNVIFT TP+A +G+L++
Sbjct  263  LSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVS  322

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I   LV+ ++EYL+SA+DYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  323  KPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPI  382

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
            +++DFGWG P+ MGP  I++EG  Y+LPSP  D SLS+A+ L  +HM  F KL+
Sbjct  383  YDADFGWGRPIFMGPGGIMFEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  436



>gb|AFR40251.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40252.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40253.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40254.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40255.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40256.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40257.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40258.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40259.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40260.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40261.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40262.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40263.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40265.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=193

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWCAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  192



>gb|AFR40219.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40226.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=191

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  158  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  190



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR V +AR L  DQ TKLYIATDGRSRL P+LP G+ GNVIFT TP+A + +L++
Sbjct  256  LAGHVWRSVSKARALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI +AL++MD++YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+
Sbjct  316  KPTWYAASRIHNALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            + +DFGWG P+ MGP  I YEG  +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  376  YEADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIGLPPDQMKLFQELFY  430



>gb|AFR40264.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=192

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWCAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  192



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WRC C+AR L DDQ TKL++A DGR+RL P LP  + GNVIFT TP+A +G+L++
Sbjct  256  LSGHVWRCACKARALPDDQETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVS  315

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P+  +A +I   LV+ ++EYL+SA+DYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  316  KPIWYAASQIHKTLVKTNNEYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPI  375

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
            +++DFGWG P+ MGP  I++EG  Y+LPSP  D SLS+A+ L  +HM  F KL+
Sbjct  376  YDADFGWGRPIFMGPGGIMFEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  429



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+ H+WR  C+AR L +DQ TK+YIATDGR+RL P LP G+ GNVIFT TP+A +GEL++
Sbjct  254  LSGHVWRSTCKARELPEDQDTKVYIATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMS  313

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
             P   +A +I  AL RMD++YLRSALDYLE QP++S LVRG++ F  PNL I SW RLP+
Sbjct  314  NPTWFAASKIHDALTRMDNDYLRSALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPI  373

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            H++DFGWG P+ MGP  I YEG  +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  374  HDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>gb|AFR40239.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  39   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLXPTLPPGYFGNVIFTATPIAVAGEIQS  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  99   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  159  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  187



>ref|NP_001047408.1| Os02g0611800 [Oryza sativa Japonica Group]
 dbj|BAD19683.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 3 [Oryza 
sativa Japonica Group]
 dbj|BAF09322.1| Os02g0611800 [Oryza sativa Japonica Group]
 gb|EAY86657.1| hypothetical protein OsI_08038 [Oryza sativa Indica Group]
 dbj|BAG96596.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRC   ARGL  +Q TKLY ATDGR RL P+LP G+ GNVIFTATP
Sbjct  258  APRYSTYAVLAAHVWRCASLARGLPAEQPTKLYCATDGRQRLQPSLPDGYFGNVIFTATP  317

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G + T  LA  A  I+SAL RMD  Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  318  LAEAGRV-TGSLADGAATIQSALDRMDSGYCRSALDYLELQPDLSALVRGAHTFRCPNLG  376

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS + D SLS+A+ L A+HM  F+
Sbjct  377  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASGDGSLSVAISLQAEHMEKFR  436

Query  104  KLLYKF  87
            K+++ F
Sbjct  437  KMIFDF  442



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            +A HIWRC+C+AR L DDQ +K+ IA DGRSRL P LPPG+ GN IF  TP+A SG++L+
Sbjct  262  IAGHIWRCICKARQLPDDQESKVSIAVDGRSRLNPKLPPGYFGNAIFHITPMAASGDILS  321

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +  ++  +L R +DEYLRSA+D+LE  P+ S LVRG + F SPNL I SW ++P+
Sbjct  322  KPLIYAVGKLHESLQRANDEYLRSAIDFLELHPNKSSLVRGPHTFRSPNLGITSWCQMPI  381

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            H +DFGWG P+ MGP  I+YEG  Y+LP+P KD S  LAV L  DHM LF+K  Y F
Sbjct  382  HEADFGWGRPIFMGPGSIIYEGLAYVLPTPEKDGSRFLAVSLLPDHMTLFKKSFYDF  438



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC  +AR L DDQ TKL++A DGRSRL P LPPGF GNV+F   P A +G+L +
Sbjct  265  LAGHVWRCATKARNLPDDQVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI   +VRM+++YLRSALD+LE QPDLS LVRG++ F  P L I SW RLP+
Sbjct  325  KPTWYAAGRIHDVVVRMNNDYLRSALDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPI  384

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS A+ L +DHM  F KLLY
Sbjct  385  YDADFGWGRPIFMGPGGIGYEGLAFVLPSPTNDGSLSGAIPLQSDHMKSFAKLLY  439



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+W+CV  AR L  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  256  APRFSTYAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ +E LA  A  I+ AL RMD++Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  316  LAEAGKVTSE-LAEGAAVIQGALDRMDNDYCRSALDYLELQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N D SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFR  434

Query  104  KLL  96
            KL+
Sbjct  435  KLI  437



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAHIW+C C+ARG+++DQ TKL+I TDGRSRL P LP G+ GNV+FTA  +  SGE+
Sbjct  266  ETLAAHIWQCTCKARGITNDQATKLHIPTDGRSRLNPPLPAGYCGNVLFTAAILGLSGEI  325

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
             ++PL  +  +IR AL RMD+EYLRSA+DYL+ Q DL  L RG + F SPNLNI SW  +
Sbjct  326  QSKPLVDTIAKIRGALKRMDNEYLRSAIDYLQVQADLEALKRGPHTFKSPNLNIVSWMTM  385

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            P++++DFGWG P  MGPA++ +EG  YI   PN D SL +  CL+++HM LF+K  Y F
Sbjct  386  PIYDADFGWGRPYFMGPAIVGFEGMAYIARCPNNDGSLMIFTCLESNHMELFKKFFYDF  444



>gb|AFR40240.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=189

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWXAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  158  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  186



>gb|AFR40246.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  37   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  96

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  97   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  156

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  157  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  185



>gb|AFR40248.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=190

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  39   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  99   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  159  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  187



>gb|AFR40238.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  188



>gb|AFR40250.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  158  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  186



>gb|EAZ23787.1| hypothetical protein OsJ_07497 [Oryza sativa Japonica Group]
Length=463

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRC   ARGL  +Q TKLY ATDGR RL P+LP G+ GNVIFTATP
Sbjct  279  APRYSTYAVLAAHVWRCASLARGLPAEQPTKLYCATDGRQRLQPSLPDGYFGNVIFTATP  338

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G + T  LA  A  I+SAL RMD  Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  339  LAEAGRV-TGSLADGAATIQSALDRMDSGYCRSALDYLELQPDLSALVRGAHTFRCPNLG  397

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS + D SLS+A+ L A+HM  F+
Sbjct  398  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASGDGSLSVAISLQAEHMEKFR  457

Query  104  KLLYKF  87
            K+++ F
Sbjct  458  KMIFDF  463



>gb|AFR40231.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40232.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40234.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40235.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=193

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDL+ LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPLFMGPGGIAYEGLSFIIPSSTND  192



>gb|AFR40229.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=191

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDL+ LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  158  HDADFGWGRPLFMGPGGIAYEGLSFIIPSSTND  190



>gb|AFR40230.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=192

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDL+ LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPLFMGPGGIAYEGLSFIIPSSTND  192



>gb|AFR40241.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40244.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40249.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=189

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  38   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  97

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  98   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  157

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  158  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  186



>gb|AFR40223.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=193

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  40   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  99

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LV MD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  100  KPTWYAAGKIHDSLVXMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  159

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKD  159
            H++DFGWG P+ MGP  I YEG  +I+PS   D
Sbjct  160  HDADFGWGRPIFMGPGGIAYEGLSFIIPSSTND  192



>gb|AFR40365.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40366.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40369.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=152

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSLS  147
            GWG P+ MGP  I YEG  +ILPSP  D S+S
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMS  152



>gb|AFR40242.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=190

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  39   LAGHVWRSACXARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  99   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  159  HDADFGWGRPIFMGPGGIAYEGLSFIIPS  187



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L AHIWRC C+ARGLS+DQ TK+ I+TDGR+R  P +PPG+ GNVIF ATP+A SG LL+
Sbjct  259  LTAHIWRCACKARGLSNDQATKINISTDGRNRFRPPIPPGYFGNVIFQATPIALSGALLS  318

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EPLA +A+RI  A+ RMDDEYLRSA+DYLE   D + ++R S  + SPNL I SW RLP 
Sbjct  319  EPLAHTAERIHKAIKRMDDEYLRSAVDYLERVDDFTTVMRSSETYRSPNLTIASWVRLPF  378

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG PV+M PA   + G  YI PSP  D +LSL + L+ DH+  FQKL Y++
Sbjct  379  YDADFGWGKPVYMRPASA-FVGKGYIQPSPTNDGTLSLTIFLETDHLQSFQKLFYEY  434



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
             +LAAHIW+C C+ARG+S+DQ TKL+I TDGRSRL P LP G+ GN +FT   +  SGE+
Sbjct  265  ETLAAHIWQCTCKARGISNDQATKLHIPTDGRSRLNPPLPAGYCGNALFTTAVLGLSGEI  324

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
             ++PL  +  +IR AL RMD+EYLRSA+DYL  QP+L  L RG + F +PN+NI SW  +
Sbjct  325  QSKPLVHTITKIRGALKRMDNEYLRSAIDYLHVQPNLEALKRGPHTFNNPNINIVSWMTM  384

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            P++++DFGWG P  MGPA++L+EG  YI  SP+ D S  + +CL+++HM LF+K  Y F
Sbjct  385  PIYDADFGWGRPSFMGPAVVLFEGMAYITRSPSNDGSFMIFICLESNHMELFKKFFYDF  443



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -1

Query  623  RSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
            + + AHIWRCV  ARGL   Q TKLYI+TDGRSRL PALPPG+ GNVIFTA PVA SG++
Sbjct  257  QMVVAHIWRCVTRARGLPRAQETKLYISTDGRSRLRPALPPGYFGNVIFTAAPVAVSGDI  316

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
            L+EP+  +A +IR+AL RMDDEY+RSALDYLE Q D+  + RG   F  P+L + SW RL
Sbjct  317  LSEPVTYAAGKIRAALARMDDEYMRSALDYLELQGDVKAVARGPQTFTCPDLGVISWVRL  376

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSP--NKDRSLSLAVCLDADHMPLFQKLLY  93
            PV+++DFGWG PV+MGP  + YEG  +++P P  N++  L +A+ L   H+ +F++LLY
Sbjct  377  PVYDADFGWGKPVYMGPGGLAYEGRCFLMPPPPANEEGGLLVAMSLQKQHVEIFKELLY  435



>ref|XP_003580078.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010240077.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=443

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 134/185 (72%), Gaps = 1/185 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  AR L  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  259  APRFSTYAVLAAHVWRCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATP  318

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  L   A  I+ AL RM D+Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  319  LAEAGKV-TSGLEDGATVIQGALDRMSDDYCRSALDYLELQPDLSALVRGAHTFRCPNLG  377

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  +++PS +KD SLS+A+ L A+HM  F+
Sbjct  378  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVIPSSSKDGSLSIAISLQAEHMEKFR  437

Query  104  KLLYK  90
            KL+++
Sbjct  438  KLIFE  442



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+W+CV  AR L  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  256  APRFSTYAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATP  315

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ +E LA  A  I+ AL RMD++Y RSALDYL+ QPDLS LVRG++ F  PNL 
Sbjct  316  LAEAGKVTSE-LAEGAAVIQGALDRMDNDYCRSALDYLDLQPDLSALVRGAHTFRCPNLG  374

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N D SLS+A+ L A+HM  F+
Sbjct  375  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFR  434

Query  104  KLL  96
            KL+
Sbjct  435  KLI  437



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+W+CV  AR L  +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  257  APRFSTYAVLAAHVWKCVSLARSLPPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATP  316

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RMD++Y RSALDYLE QPDLS LVRG++ F  PNL 
Sbjct  317  LAEAGKV-TSGLAEGAAVIQGALDRMDNDYCRSALDYLELQPDLSALVRGAHTFRCPNLG  375

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N D SLS+A+ L A+HM  F+
Sbjct  376  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFR  435

Query  104  KLL  96
            KL+
Sbjct  436  KLI  438



>gb|AFR40233.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=190

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  39   LAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  98

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDL+ LVRG++ F  PNL I SW RLP+
Sbjct  99   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPI  158

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPS  171
            H++DFGWG P+ MGP  I YEG  +I+PS
Sbjct  159  HDADFGWGRPLFMGPGGIAYEGLSFIIPS  187



>emb|CAR40185.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Populus 
x canadensis]
Length=236

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WR  C+AR L DDQ TKLYIATDGRSR  P LPPG+  NVIFTATP+A +GE+ +
Sbjct  85   LAAHVWRSTCKARELPDDQETKLYIATDGRSRWHPQLPPGYFSNVIFTATPIAVAGEMQS  144

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  145  KPTWYAAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPI  204

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPN  165
            H++DFGWG P+ MGP  I YEG  +ILPSP 
Sbjct  205  HDADFGWGRPIFMGPGGIAYEGLSFILPSPT  235



>gb|EPS73563.1| hypothetical protein M569_01193, partial [Genlisea aurea]
Length=305

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 127/179 (71%), Gaps = 1/179 (1%)
 Frame = -1

Query  620  SLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELL  441
            ++AAH+WRC   AR LS DQ T+L I  +GRSRL P LPPG+ GN IF A   A +G+++
Sbjct  116  TIAAHVWRCATLARSLSADQKTQLDIPVNGRSRLRPPLPPGYFGNGIFPAAASAVAGDVV  175

Query  440  TEPLASSAKRIRSALVRMDDEYLRSALDYLEC-QPDLSKLVRGSNYFASPNLNINSWTRL  264
             +PL+ SA  IR AL RMDDEYLRSALDY+E  +P+L  LVRGS  F  PNL I SW  L
Sbjct  176  GKPLSQSAATIREALARMDDEYLRSALDYVETFRPNLKGLVRGSETFRCPNLGIVSWIGL  235

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            P+H +DFGWG PV MGP  I YEG  Y++PSP+ D SLS+A+CL  DHM  FQKL Y+ 
Sbjct  236  PIHEADFGWGRPVFMGPIGIGYEGLSYVIPSPDNDGSLSVAICLHKDHMVRFQKLFYQI  294



>gb|AFR40236.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=184

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WR  C ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ +
Sbjct  37   LAGHVWRSACXARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQS  96

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+
Sbjct  97   KPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPI  156

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILP  174
            H++DFGWG P+ MGP  I YEG  +I+P
Sbjct  157  HDADFGWGRPIFMGPGGIAYEGLSFIIP  184



>gb|AFR40367.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40368.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=151

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -1

Query  602  WRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLAS  423
            WR  C+AR L DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  422  SAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDF  243
            +A +I  ALVRMD++YL+SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  242  GWGTPVHMGPALILYEGTVYILPSPNKDRSL  150
            GWG P+ MGP  I YEG  +ILPSP  D S+
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSM  151



>gb|EMT08585.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=445

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            L+AH+WRCV  +RGL  DQ TKLY A DGR RL P LP GFLGNV+FTATP+ E+G++ T
Sbjct  270  LSAHVWRCVSLSRGLPSDQPTKLYCAIDGRKRLKPPLPDGFLGNVLFTATPIVEAGKV-T  328

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
              LA +AK I+  L RM+D+Y RSALDYLE QPDLS LVRG+  +  PNL I SW  LPV
Sbjct  329  RGLADAAKIIQMELDRMNDDYCRSALDYLELQPDLSALVRGAQTYRCPNLGITSWVNLPV  388

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            HN+DFGWG P+ MGP  + +EG  Y+LPS + D SLS+A+ L ADHM  F++L++
Sbjct  389  HNADFGWGRPMFMGPGGVAFEGLAYVLPSAHNDGSLSIAISLQADHMKKFRQLIF  443



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC   AR L DDQ TKL+IA DGRSRL P LPPGF GNV+F   P+A +G+L +
Sbjct  264  LAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPQLPPGFFGNVVFAGAPIAAAGDLKS  323

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI  A+VRMD++YLRSALDYLE QPDL  LVRG+  F  P L I +W+RLP+
Sbjct  324  KPTWYAASRIHDAVVRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPI  383

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  + YEG  ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  384  YDADFGWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWRC C AR L +DQ T+L IA +GRSRL P LPP + GN IFTATP++ +G++  
Sbjct  251  LAAHIWRCACSARALPEDQETQLDIAVNGRSRLRPPLPPAYFGNAIFTATPLSVAGDVTG  310

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQP-DLSKLVRGSNYFASPNLNINSWTRLP  261
            +PL  SA +I+ AL RMDDEYLRSALDYLE +  +L  LVRG   F  PNL I SW RLP
Sbjct  311  KPLRHSAAKIQEALWRMDDEYLRSALDYLELRRLELKGLVRGRESFRCPNLGIVSWIRLP  370

Query  260  VHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            VH +DFGWG PV MGPA I YEG  Y++PSP  D SLS+A+CL  DH+  F+K LY
Sbjct  371  VHEADFGWGKPVFMGPAGIGYEGLCYVIPSPADDGSLSVAICLLEDHVEAFRKSLY  426



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 126/175 (72%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC  +AR L DD+ TKL++A DGRSRL P LPPGF GNV+F   P A +G+L +
Sbjct  265  LAGHVWRCASKARNLPDDRVTKLHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKS  324

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   +VR +++YLRSALDYLE QPDLS LVRG++ F  P L I SW RLP+
Sbjct  325  KPTWYAASXIHDVVVRXNNDYLRSALDYLEVQPDLSALVRGAHTFRCPKLGITSWARLPI  384

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ MGP  I YEG  ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  385  YDADFGWGRPIFMGPGGIGYEGLAFVLPSPINDGSLSVAISLQSDHMKSFAKLLY  439



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC   AR L DDQ TKL+IA DGRSRL P LPPGF GNV+F   P+A +G+L +
Sbjct  264  LAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKS  323

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   +VRMD++YLRSALDYLE QPDLS LVRG++ F  P L I SW+RLP+
Sbjct  324  KPTWYAASCIHDTVVRMDNDYLRSALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPI  383

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  + YEG  ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  384  YDADFGWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC   AR L DDQ TKL+IA DGRSRL P LPPGF GNV+F   P+A +G+L +
Sbjct  264  LAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKS  323

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A  I   +VRMD++YLRSALDYLE QPDLS LVRG++ F  P L I SW+RLP+
Sbjct  324  KPTWYAASCIHDTVVRMDNDYLRSALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPI  383

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  + YEG  ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  384  YDADFGWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  AR L+ +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  254  APRFSTYAVLAAHVWRCVSLARNLAPEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATP  313

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RM  +Y +SALDYLE QPDLS LVRG++ F  PNL 
Sbjct  314  LAEAGKV-TSGLAEGAAVIQGALDRMTSDYCQSALDYLEMQPDLSALVRGAHTFRCPNLG  372

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS +KD SLS+A+ L A+HM  F+
Sbjct  373  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASKDGSLSIAISLQAEHMEKFR  432

Query  104  KLL  96
            KL+
Sbjct  433  KLI  435



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  644  ATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP  465
            A R +    LAAH+WRCV  AR L+ +Q TKLY ATDGR RL P LP G+ GNVIFTATP
Sbjct  254  APRFSTYAVLAAHVWRCVSLARNLAPEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATP  313

Query  464  VAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLN  285
            +AE+G++ T  LA  A  I+ AL RM  +Y +SALDYLE QPDLS LVRG++ F  PNL 
Sbjct  314  LAEAGKV-TSGLAEGAAVIQGALDRMTSDYCQSALDYLEMQPDLSALVRGAHTFRCPNLG  372

Query  284  INSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQ  105
            + SW RLP+H++DFGWG PV MGP  I YEG  ++LPS +KD SLS+A+ L A+HM  F+
Sbjct  373  LTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASKDGSLSIAISLQAEHMEKFR  432

Query  104  KLL  96
            KL+
Sbjct  433  KLI  435



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRCV +ARGL DDQ T L+I  DGRSRL P LPPG+ GN I   T  A  GEL +
Sbjct  264  LAGHVWRCVSKARGLRDDQDTNLFITVDGRSRLRPPLPPGYFGNGILLTTSNALCGELRS  323

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +PL  +  R+   + RM+DEY+RSA+DYLE QPDL+  VRG + F SPN  + SW RLP+
Sbjct  324  KPLGYAVGRVHDVVTRMNDEYVRSAIDYLELQPDLTPFVRGPHMFRSPNFWMVSWARLPL  383

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+H+GPA++  EG  YILPSP  D S+ LA+ L +DHM +F+K+LY F
Sbjct  384  YDADFGWGRPIHVGPAVVYSEGLSYILPSPTNDGSVLLAISLQSDHMEVFRKILYDF  440



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LA H+WRC   AR L DDQ TKL+IA DGRSRL P LPPGF GNV+F   P+A +G+L +
Sbjct  264  LAGHVWRCASVARELPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKS  323

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A RI   +VRMD++YLRSALDYLE QPDL  LVRG+  F  P L I +W+RLP+
Sbjct  324  KPTWYAASRIHDTVVRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPI  383

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGP  + YEG  ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  384  YDADFGWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>ref|XP_007149790.1| hypothetical protein PHAVU_005G0989001g, partial [Phaseolus vulgaris]
 gb|ESW21784.1| hypothetical protein PHAVU_005G0989001g, partial [Phaseolus vulgaris]
Length=241

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAHIWR VC+ARGL + Q T+LYI  +GRSRL P LPPG+LGN IF+  P A +G+L++
Sbjct  65   LAAHIWRSVCKARGLPEVQETRLYIPINGRSRLQPPLPPGYLGNAIFSTIPKALAGDLVS  124

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            +P   +A +I +A+ RMD+EYLRSALDYL+ QPDL+ LV G++ F  PN+ INSW + PV
Sbjct  125  KPTWYAANQIHNAIARMDNEYLRSALDYLKLQPDLNALVPGAHTFGCPNVGINSWAKFPV  184

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            +++DFGWG P+ M P  I+YEG   I+PS   D SL L + L   HM LFQ+ LY
Sbjct  185  YDADFGWGRPIFMRPGWIIYEGLAIIIPSSTNDGSLYLKMALPPHHMKLFQEFLY  239



>gb|KJB68219.1| hypothetical protein B456_010G233000 [Gossypium raimondii]
Length=214

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 127/188 (68%), Gaps = 0/188 (0%)
 Frame = -1

Query  650  TRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTA  471
            +  T+ +    LAAHIWRCV +ARGLSDDQ TK+Y   D RS+L P LPPG+ GN IF  
Sbjct  27   SSGTKYSSYNILAAHIWRCVSKARGLSDDQPTKMYFPVDARSKLNPPLPPGYFGNAIFIN  86

Query  470  TPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPN  291
              V ++G+L TE    + KRI   L +++DEYLRSALDY+E   DLS LVRG + F  PN
Sbjct  87   ALVTQAGDLNTESFLDTIKRIHEGLKKINDEYLRSALDYIETVSDLSTLVRGPHTFRCPN  146

Query  290  LNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPL  111
            L +NSW  LP++ +DFGWG P+H GPA + +EG V ILP+P  D SL +A  L   HM  
Sbjct  147  LAVNSWLWLPMYEADFGWGRPIHTGPADVSHEGKVLILPTPINDGSLLVATRLGISHMSC  206

Query  110  FQKLLYKF  87
            F+KLLY+F
Sbjct  207  FEKLLYEF  214



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -1

Query  620  SLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELL  441
            SLAAHIWRCV +AR L DDQ TKLYI  DGRSRL P LPPG+LGNVIF +  +A  G++ 
Sbjct  259  SLAAHIWRCVNKARCLLDDQATKLYIPIDGRSRLRPPLPPGYLGNVIFMSATIASHGDIQ  318

Query  440  TEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLP  261
             E  + +AKRI++ L R DDEYL+SA+DY+E +P++   VRG+  F  PNL+INSW  LP
Sbjct  319  CESFSDTAKRIQNILRRTDDEYLKSAIDYMEKEPNIKAPVRGARGFQCPNLSINSWMWLP  378

Query  260  VHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            ++++DFGWG P+ +GPA +  +G  YILPSP  D SLS+  CLD  HM +F +L Y+F
Sbjct  379  LYDADFGWGRPIWLGPAKVSQDGKTYILPSPANDGSLSVMSCLDTSHMKIFGQLFYEF  436



>gb|KJB68227.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
 gb|KJB68228.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=422

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -1

Query  650  TRATRVAPTRSLAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTA  471
            +  T+ +    LAAHIWRCV +A GLSDDQ TK+Y   D RS+L P LPPG+ GNVIF  
Sbjct  235  SSGTKYSSYNILAAHIWRCVSKAMGLSDDQPTKMYFPVDARSKLNPPLPPGYFGNVIFIN  294

Query  470  TPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPN  291
              + ++G+L TE    + KRI   L +++DEYLRSALDY+E   D S LVRGS+ F  PN
Sbjct  295  ALITQAGDLNTESFLDTIKRIHEGLKQINDEYLRSALDYIETVSDSSTLVRGSHTFRCPN  354

Query  290  LNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPL  111
            L +N+W RLP++ +DFGWG P+H GPA I++EG VY+LP+P  D SL L   L+  HM  
Sbjct  355  LIVNTWMRLPIYEADFGWGRPIHTGPADIVHEGIVYLLPTPINDGSLLLVARLEISHMSC  414

Query  110  FQKLLYKF  87
            F+KLLY+F
Sbjct  415  FEKLLYEF  422



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600