BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030J06

Length=723
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    339   5e-107   Solanum tuberosum [potatoes]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    337   3e-106   Nicotiana sylvestris
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    335   2e-105   Solanum lycopersicum
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    333   7e-105   Nicotiana tomentosiformis
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         333   1e-104   Jatropha curcas
gb|AIU51136.1|  embryo yellow protein                                   331   8e-104   Prunus persica
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    331   8e-104   Prunus mume [ume]
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             331   1e-103   Prunus persica
ref|XP_010089680.1|  hypothetical protein L484_001268                   330   1e-103   Morus notabilis
gb|AIU51140.1|  embryo yellow protein                                   330   1e-103   Ricinus communis
ref|XP_002510953.1|  conserved hypothetical protein                     330   1e-103   Ricinus communis
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    328   6e-103   Populus euphratica
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    328   7e-103   Sesamum indicum [beniseed]
gb|AIU51131.1|  embryo yellow protein                                   328   8e-103   Manihot esculenta [manioc]
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    327   2e-102   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    327   3e-102   Vitis vinifera
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    322   6e-102   
gb|KHG21476.1|  Conserved oligomeric Golgi complex subunit 7            314   9e-102   Gossypium arboreum [tree cotton]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    325   2e-101   Fragaria vesca subsp. vesca
gb|AIU51119.1|  embryo yellow protein                                   325   2e-101   Glycine max [soybeans]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    325   2e-101   Glycine max [soybeans]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    324   2e-101   
gb|AIU51110.1|  embryo yellow protein                                   324   2e-101   Theobroma cacao [chocolate]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            324   2e-101   Glycine soja [wild soybean]
emb|CDP05334.1|  unnamed protein product                                324   3e-101   Coffea canephora [robusta coffee]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             324   3e-101   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   324   3e-101   Phaseolus vulgaris [French bean]
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    323   9e-101   Pyrus x bretschneideri [bai li]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    323   9e-101   
gb|AIU51115.1|  embryo yellow protein                                   323   1e-100   Carica papaya [mamon]
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            322   2e-100   Glycine soja [wild soybean]
gb|AIU51125.1|  embryo yellow protein                                   322   2e-100   Chimonanthus praecox [wintersweet]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    321   5e-100   Pyrus x bretschneideri [bai li]
gb|AIU51152.1|  embryo yellow protein                                   320   2e-99    Platanus x hispanica [London plane tree]
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                319   3e-99    Erythranthe guttata [common monkey flower]
gb|AIU51106.1|  embryo yellow protein                                   317   1e-98    Magnolia denudata [haku-mokuren]
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    317   2e-98    Citrus sinensis [apfelsine]
gb|AIU51111.1|  embryo yellow protein                                   316   3e-98    Acorus calamus [flagroot]
gb|AIU51151.1|  embryo yellow protein                                   316   3e-98    Cinnamomum camphora
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   316   3e-98    Citrus sinensis [apfelsine]
gb|AIU51123.1|  embryo yellow protein                                   309   4e-98    Chloranthus japonicus
gb|AIU51114.1|  embryo yellow protein                                   314   1e-97    Gossypium raimondii
gb|AIU51126.1|  embryo yellow protein                                   305   2e-97    Pandanus utilis
gb|AIU51147.1|  embryo yellow protein                                   314   2e-97    Schrenkiella parvula
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             314   2e-97    Citrus clementina [clementine]
emb|CDY00472.1|  BnaA10g08010D                                          295   4e-97    
gb|AIU51103.1|  embryo yellow protein                                   313   5e-97    Arabidopsis lyrata [lyrate rockcress]
gb|KEH17632.1|  oligomeric component-related/COG complex component      313   5e-97    Medicago truncatula
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    313   7e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51121.1|  embryo yellow protein                                   313   7e-97    Buxus sinica
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    310   8e-97    Eucalyptus grandis [rose gum]
gb|AIU51104.1|  embryo yellow protein                                   312   9e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AIU51116.1|  embryo yellow protein                                   311   2e-96    Capsella rubella
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    311   2e-96    Cicer arietinum [garbanzo]
gb|AIU51108.1|  embryo yellow protein                                   310   6e-96    Pinellia ternata
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    310   7e-96    Eucalyptus grandis [rose gum]
gb|AIU51112.1|  embryo yellow protein                                   310   1e-95    Sarcandra glabra
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             309   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             309   1e-95    
dbj|BAF00649.1|  hypothetical protein                                   309   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199956.1|  COG7-like protein EYE                                 308   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AIU51128.1|  embryo yellow protein                                   308   2e-95    Aristolochia tagala
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    308   2e-95    Cucumis melo [Oriental melon]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    308   3e-95    
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    308   3e-95    Cucumis sativus [cucumbers]
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             308   4e-95    Capsella rubella
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    307   8e-95    Elaeis guineensis
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    307   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    307   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          306   1e-94    Amborella trichopoda
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         306   1e-94    Medicago truncatula
gb|AIU51129.1|  embryo yellow protein                                   306   1e-94    Medicago truncatula
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    306   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132532.1|  uncharacterized protein LOC100193995               292   3e-94    
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    305   3e-94    Phoenix dactylifera
gb|AIU51105.1|  embryo yellow protein                                   295   5e-94    Lilium brownii [Hong Kong lily]
gb|AIU51143.1|  embryo yellow protein                                   304   9e-94    Yucca filamentosa [Adam's-needle]
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    304   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    304   1e-93    Oryza brachyantha
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    304   1e-93    Arabis alpina [alpine rockcress]
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...    300   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    303   2e-93    Brassica rapa
gb|AIU51154.1|  embryo yellow protein                                   303   3e-93    Houttuynia cordata [chameleon-plant]
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    303   5e-93    Tarenaya hassleriana [spider flower]
gb|AIU51127.1|  embryo yellow protein                                   302   6e-93    Asparagus officinalis
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    302   7e-93    
gb|EMT03910.1|  hypothetical protein F775_26031                         299   8e-93    
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       299   9e-93    Triticum urartu
gb|AIU51102.1|  embryo yellow protein                                   301   1e-92    Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU51109.1|  embryo yellow protein                                   300   2e-92    Brachypodium distachyon [annual false brome]
gb|EEE66191.1|  hypothetical protein OsJ_22310                          300   2e-92    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51142.1|  embryo yellow protein                                   300   3e-92    Dioscorea oppositifolia
gb|AIU51130.1|  embryo yellow protein                                   300   3e-92    Canna indica [canna]
gb|EEC81147.1|  hypothetical protein OsI_24056                          300   4e-92    Oryza sativa Indica Group [Indian rice]
gb|AIU51157.1|  embryo yellow protein                                   299   7e-92    Trachycarpus fortunei
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    298   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        300   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51107.1|  embryo yellow protein                                   298   2e-91    Musa acuminata [banana]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          297   3e-91    Sorghum bicolor [broomcorn]
emb|CDX99921.1|  BnaC09g27840D                                          293   6e-91    
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    297   6e-91    
gb|AIU51137.1|  embryo yellow protein                                   296   7e-91    Panicum virgatum
dbj|BAJ95800.1|  predicted protein                                      296   1e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94393.1|  predicted protein                                      296   1e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51146.1|  embryo yellow protein                                   295   2e-90    Sorghum bicolor [broomcorn]
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    295   3e-90    Setaria italica
gb|AIU51149.1|  embryo yellow protein                                   295   3e-90    Lactuca sativa [cultivated lettuce]
gb|AIU51153.1|  embryo yellow protein                                   294   6e-90    Ginkgo biloba [ginkgo]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    293   1e-89    
gb|AIU51144.1|  embryo yellow protein                                   292   2e-89    Setaria italica
gb|AIU51155.1|  embryo yellow protein                                   291   8e-89    Zea mays [maize]
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         289   1e-88    
gb|AIU51124.1|  embryo yellow protein                                   289   4e-88    Ceratophyllum demersum [hornwort]
gb|AIU51156.1|  embryo yellow protein                                   285   1e-86    Alisma plantago-aquatica
gb|AIU51150.1|  embryo yellow protein                                   285   1e-86    Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51158.1|  embryo yellow protein                                   279   2e-84    Cabomba caroliniana
gb|EPS73811.1|  hypothetical protein M569_00940                         266   2e-79    Genlisea aurea
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             214   2e-60    
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             213   3e-60    
emb|CDY56655.1|  BnaA02g11250D                                          211   2e-59    Brassica napus [oilseed rape]
emb|CDY00475.1|  BnaA10g07980D                                          209   9e-59    
emb|CDX91578.1|  BnaC02g15820D                                          209   1e-58    
ref|XP_001770876.1|  predicted protein                                  195   1e-53    
gb|AIU51139.1|  embryo yellow protein                                   177   2e-52    Artemisia annua [sweet Annie]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    161   5e-42    
ref|NP_001058323.2|  Os06g0669600                                       142   2e-38    
ref|XP_006491716.1|  PREDICTED: uncharacterized protein LOC102619662    149   4e-37    
ref|XP_001418731.1|  predicted protein                                  130   1e-30    Ostreococcus lucimarinus CCE9901
ref|XP_003080398.1|  conserved oligomeric Golgi complex component...    119   1e-27    
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           119   1e-26    Ostreococcus tauri
gb|AIU51120.1|  embryo yellow protein                                   117   4e-26    Illicium henryi
emb|CBI21190.3|  unnamed protein product                                103   1e-23    Vitis vinifera
ref|XP_002503576.1|  predicted protein                                  108   5e-23    Micromonas commoda
ref|XP_007513783.1|  predicted protein                                  103   3e-21    Bathycoccus prasinos
ref|XP_002731007.1|  PREDICTED: conserved oligomeric Golgi comple...  98.6    7e-21    Saccoglossus kowalevskii
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             100   2e-20    Chlorella variabilis
ref|XP_003055554.1|  predicted protein                                  100   3e-20    Micromonas pusilla CCMP1545
ref|XP_001701937.1|  component of oligomeric golgi complex 7          91.7    2e-17    Chlamydomonas reinhardtii
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            90.9    4e-17    Coccomyxa subellipsoidea C-169
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          87.8    5e-16    Crassostrea gigas
ref|XP_797564.3|  PREDICTED: conserved oligomeric Golgi complex s...  85.1    5e-16    
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  87.4    5e-16    Crassostrea gigas
gb|EFA86654.1|  oligomeric Golgi complex component                    87.0    9e-16    Heterostelium album PN500
ref|XP_011402672.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    2e-15    
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  85.5    3e-15    Strongylocentrotus purpuratus [purple urchin]
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    3e-15    Aplysia californica
ref|XP_001844946.1|  conserved hypothetical protein                   82.4    2e-14    Culex quinquefasciatus
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           80.5    1e-13    Lottia gigantea
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  79.0    3e-13    Ixodes scapularis [blacklegged tick]
ref|XP_004206189.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-13    
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                78.6    4e-13    Capitella teleta
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    76.6    2e-12    Lichtheimia ramosa
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    4e-12    
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             74.7    7e-12    Acytostelium subglobosum LB1
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            74.3    8e-12    Trichoplax adhaerens
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    8e-12    Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    8e-12    Fopius arisanus
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    9e-12    Fopius arisanus
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               74.3    1e-11    Guillardia theta CCMP2712
ref|XP_006682175.1|  hypothetical protein BATDEDRAFT_27828            73.9    1e-11    Batrachochytrium dendrobatidis JAM81
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11    
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11    Bombus terrestris [large earth bumblebee]
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    4e-11    Chrysochloris asiatica
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    7e-11    Lepisosteus oculatus
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    8e-11    
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11    
gb|EFZ22757.1|  hypothetical protein SINV_01051                       71.2    1e-10    
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    1e-10    Solenopsis invicta [imported red fire ant]
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          70.9    1e-10    Zootermopsis nevadensis
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001652664.1|  AAEL007307-PA                                    70.1    2e-10    
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Orycteropus afer afer
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Oryzias latipes [Japanese rice fish]
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Latimeria chalumnae
ref|XP_010985221.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    3e-10    Camelus dromedarius [camel]
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...  69.7    3e-10    Camelus ferus
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    3e-10    Camelus bactrianus [camel]
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Camelus ferus
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Apis dorsata [rock honeybee]
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Xiphophorus maculatus
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Apis dorsata [rock honeybee]
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  69.3    4e-10    
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Trichechus manatus latirostris
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    4e-10    Loxodonta africana [African bush elephant]
ref|XP_007571518.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-10    Poecilia formosa
gb|ENN72949.1|  hypothetical protein YQE_10420                        67.0    5e-10    Dendroctonus ponderosae
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Chelonia mydas [green seaturtle]
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  68.9    5e-10    
ref|XP_004360949.1|  oligomeric Golgi complex component               68.9    6e-10    Cavenderia fasciculata
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10    Chrysemys picta bellii
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    8e-10    Sorex araneus [Eurasian shrew]
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Vicugna pacos
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_002953697.1|  component of oligomeric golgi complex 7          67.8    1e-09    Volvox carteri f. nagariensis
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    1e-09    
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    1e-09    Acromyrmex echinatior
gb|ERL93874.1|  hypothetical protein D910_11160                       67.4    1e-09    Dendroctonus ponderosae
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          67.4    2e-09    Acromyrmex echinatior
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Poecilia reticulata
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Takifugu rubripes [tiger puffer]
ref|XP_002293816.1|  predicted protein                                63.9    2e-09    Thalassiosira pseudonana CCMP1335
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  67.0    2e-09    Monodelphis domestica
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Odobenus rosmarus divergens
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Nasonia vitripennis
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Nasonia vitripennis
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Nasonia vitripennis
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  67.0    2e-09    Ursus maritimus [white bear]
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    Mesitornis unicolor
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    Orcinus orca [Orca]
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    Ailuropoda melanoleuca
gb|ELK37852.1|  Conserved oligomeric Golgi complex subunit 7          66.6    3e-09    Myotis davidii
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7     66.6    3e-09    Rattus norvegicus [brown rat]
gb|ERE78144.1|  conserved oligomeric Golgi complex subunit 7          66.6    4e-09    Cricetulus griseus [Chinese hamsters]
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Physeter catodon
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Lipotes vexillifer [baiji]
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Dasypus novemcinctus
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Heterocephalus glaber [naked mole rat]
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Esox lucius
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Poecilia formosa
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    Poecilia formosa
gb|ABC86343.1|  IP14069p                                              64.7    5e-09    Drosophila melanogaster
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Harpegnathos saltator
gb|EPQ17692.1|  Conserved oligomeric Golgi complex subunit 7          65.9    5e-09    Myotis brandtii
ref|XP_005882395.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_001510180.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Eptesicus fuscus
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Condylura cristata
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Otolemur garnettii
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Mustela putorius furo [black ferret]
gb|EDL17254.1|  component of oligomeric golgi complex 7               65.9    5e-09    Mus musculus [mouse]
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    Microtus ochrogaster [prairie voles]
ref|XP_002431030.1|  conserved hypothetical protein                   65.9    6e-09    Pediculus humanus corporis [human body lice]
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...  65.9    6e-09    Mus musculus [mouse]
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7     65.9    6e-09    Mus musculus [mouse]
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          65.5    6e-09    Pteropus alecto
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    Jaculus jaculus
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    Cricetulus griseus [Chinese hamsters]
ref|XP_005405157.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    
emb|CBY21571.1|  unnamed protein product                              65.5    6e-09    Oikopleura dioica
ref|XP_005405156.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    
ref|XP_007986068.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    Chlorocebus sabaeus
gb|AAQ88995.1|  COG7                                                  65.5    6e-09    Homo sapiens [man]
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_005405154.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    Peromyscus maniculatus bairdii
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09    Alligator sinensis
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09    Ceratosolen solmsi marchali
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  65.1    8e-09    Canis lupus familiaris [dogs]
ref|XP_009428772.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    9e-09    Pan troglodytes
ref|XP_005255738.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    9e-09    
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Octodon degus
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Leptonychotes weddellii
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...  65.1    1e-08    Pan troglodytes
ref|XP_010339086.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Saimiri boliviensis boliviensis
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Callithrix jacchus [common marmoset]
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7        65.1    1e-08    Homo sapiens [man]
dbj|BAG52793.1|  unnamed protein product                              64.7    1e-08    Homo sapiens [man]
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Rhinopithecus roxellana
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    1e-08    Pan paniscus [bonobo]
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    Saimiri boliviensis boliviensis
emb|CDQ68336.1|  unnamed protein product                              64.7    1e-08    
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
emb|CDQ66102.1|  unnamed protein product                              64.7    1e-08    
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_007084222.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
ref|XP_005141261.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08    
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_008504971.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     64.3    2e-08    
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     64.3    2e-08    
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7     63.9    2e-08    
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  63.9    3e-08    
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_009957143.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFQ15936.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_008474511.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    3e-08    
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFQ25509.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_008933945.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFQ47789.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
gb|KFQ77454.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_002105431.1|  GD17535                                          63.2    4e-08    
ref|XP_010010968.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
ref|XP_002037280.1|  GM12202                                          63.2    4e-08    
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    5e-08    
ref|XP_005426090.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    5e-08    
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    5e-08    
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    5e-08    
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7          62.8    5e-08    
ref|XP_009318776.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    5e-08    
gb|KFV44518.1|  Conserved oligomeric Golgi complex subunit 7          62.8    6e-08    
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          62.8    6e-08    
ref|XP_009284907.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|XP_009974505.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
gb|KFW64649.1|  Conserved oligomeric Golgi complex subunit 7          62.8    6e-08    
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|NP_651750.1|  Cog7                                                62.8    6e-08    
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    6e-08    
ref|XP_009919151.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    6e-08    
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    6e-08    
gb|KFM12505.1|  Conserved oligomeric Golgi complex subunit 7          62.4    7e-08    
ref|XP_001357618.1|  GA15960                                          62.4    7e-08    
ref|XP_313727.3|  AGAP004439-PA                                       62.4    7e-08    
ref|XP_009919150.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    7e-08    
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    7e-08    
gb|KFQ05597.1|  Conserved oligomeric Golgi complex subunit 7          62.4    7e-08    
ref|XP_002098511.1|  GE10410                                          62.4    8e-08    
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_001993908.1|  GH22206                                          62.4    8e-08    
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_010171643.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
gb|KFZ48154.1|  Conserved oligomeric Golgi complex subunit 7          62.0    8e-08    
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    9e-08    
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          62.0    9e-08    
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    9e-08    
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    9e-08    
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    9e-08    
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    9e-08    
gb|KFW91579.1|  Conserved oligomeric Golgi complex subunit 7          62.0    9e-08    
ref|XP_009503997.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_009585506.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_009930601.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_009815736.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
gb|KFR08003.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
ref|XP_010295242.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
gb|KFQ70547.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
gb|KFP63966.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
gb|KFQ52210.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_009482406.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_010125973.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
ref|XP_009696306.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
gb|KFV98617.1|  Conserved oligomeric Golgi complex subunit 7          61.6    1e-07    
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          61.6    1e-07    
gb|KFP45453.1|  Conserved oligomeric Golgi complex subunit 7          61.6    1e-07    
ref|XP_005443671.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|NP_001015714.1|  component of oligomeric golgi complex 7          61.6    1e-07    
ref|XP_003230028.2|  PREDICTED: conserved oligomeric Golgi comple...  60.8    2e-07    
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07    
gb|KFM79726.1|  Conserved oligomeric Golgi complex subunit 7          58.5    2e-07    
ref|XP_002001440.1|  GI21972                                          61.2    2e-07    
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7          61.2    2e-07    
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
gb|KDO27581.1|  hypothetical protein SPRG_06849                       61.2    2e-07    
ref|XP_002058398.1|  GJ14333                                          61.2    2e-07    
gb|ETN63528.1|  hypothetical protein AND_004755                       61.2    2e-07    
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
ref|XP_009248828.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-07    
ref|XP_001981279.1|  GG11984                                          60.8    2e-07    
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    2e-07    
ref|XP_009983312.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    2e-07    
gb|KFV17186.1|  Conserved oligomeric Golgi complex subunit 7          60.8    3e-07    
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07    
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    3e-07    
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     60.5    3e-07    
ref|NP_001085832.1|  component of oligomeric golgi complex 7          60.5    3e-07    
ref|XP_009466130.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07    
gb|KFQ99971.1|  Conserved oligomeric Golgi complex subunit 7          60.5    3e-07    
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07    
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7          60.5    3e-07    
ref|XP_010073318.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    4e-07    
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07    
gb|KFP10525.1|  Conserved oligomeric Golgi complex subunit 7          60.1    5e-07    
ref|XP_009646382.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    5e-07    
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  59.7    6e-07    
ref|XP_010000872.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    6e-07    
gb|KFU93333.1|  Conserved oligomeric Golgi complex subunit 7          59.7    6e-07    
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    7e-07    
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          59.3    7e-07    
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    7e-07    
ref|XP_004176695.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  59.3    7e-07    
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07    
gb|KFZ67320.1|  Conserved oligomeric Golgi complex subunit 7          58.9    1e-06    
gb|KFP88492.1|  Conserved oligomeric Golgi complex subunit 7          58.9    1e-06    
ref|XP_007442324.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    1e-06    
ref|XP_009867466.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    1e-06    
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  58.5    1e-06    
ref|XP_005494576.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06    
ref|XP_001955508.1|  GF16218                                          58.2    2e-06    
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    2e-06    
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  57.8    3e-06    
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7          57.4    3e-06    
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  57.4    3e-06    
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  56.2    8e-06    
ref|XP_009839113.1|  hypothetical protein H257_13328                  55.8    1e-05    
ref|XP_009839112.1|  hypothetical protein, variant                    55.8    1e-05    
gb|EXX54575.1|  hypothetical protein RirG_233350                      55.8    1e-05    
ref|XP_008619063.1|  hypothetical protein SDRG_14692                  55.5    2e-05    
gb|KIJ18193.1|  hypothetical protein PAXINDRAFT_32237                 55.1    2e-05    
ref|XP_005709389.1|  hypothetical protein Gasu_02200                  54.7    3e-05    
ref|XP_002073360.1|  GK14089                                          54.7    3e-05    
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      54.3    3e-05    
gb|KFB52038.1|  AGAP004439-PA-like protein                            54.3    4e-05    
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...  54.3    4e-05    
gb|KFD70340.1|  hypothetical protein M514_06928                       53.9    4e-05    
ref|XP_003737280.1|  PREDICTED: conserved oligomeric Golgi comple...  53.5    6e-05    
dbj|BAE37211.1|  unnamed protein product                              53.1    9e-05    
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    9e-05    
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...  52.8    1e-04    
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...  52.4    2e-04    
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...  52.0    2e-04    
gb|KIK29353.1|  hypothetical protein PISMIDRAFT_27259                 51.6    3e-04    
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...  51.2    4e-04    
ref|XP_005782152.1|  component of oligomeric Golgi complex 7          50.4    5e-04    
dbj|GAA52089.1|  conserved oligomeric Golgi complex subunit 7         50.8    6e-04    
ref|XP_010145231.1|  PREDICTED: conserved oligomeric Golgi comple...  50.4    7e-04    
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 50.1    0.001    
ref|XP_009167964.1|  hypothetical protein T265_13613                  50.1    0.001    



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISK+RQHFNDLSRLPIWSS+EEHS RPLPTFSAYPQSYVT VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKIRQHFNDLSRLPIWSSIEEHSLRPLPTFSAYPQSYVTGVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  719  LVESISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SLE
Sbjct  779  NVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISLE  835



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   337 bits (864),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ F DLSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQQFIDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  718  LVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  777

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE
Sbjct  778  NVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISLE  834



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISK+RQ FNDLSRLPIWSSVEEHS RPLPTFS+YPQSYVT VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKIRQQFNDLSRLPIWSSVEEHSLRPLPTFSSYPQSYVTGVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  719  LVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SLE
Sbjct  779  NVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISLE  835



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   333 bits (855),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ F  LSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQQFIGLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  719  LVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SLE
Sbjct  779  NVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISLE  835



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  656  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  715

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLSVDIEYLS
Sbjct  716  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYVTDRGAQQLSVDIEYLS  775

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+C STPR QLK LVKSD+GNQLD+PTANLVCK+RRVSL+
Sbjct  776  NVLSALSMPIPPILATFHTCFSTPRDQLKHLVKSDAGNQLDIPTANLVCKIRRVSLD  832



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLS
Sbjct  722  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  782  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  838



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLS
Sbjct  723  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  783  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  839



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   331 bits (848),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDIEYLS
Sbjct  723  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++LE
Sbjct  783  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNLE  839



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+S LPIWS+VEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  657  VYDVLISKVRQRLSDVSHLPIWSAVEEQSAFPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  716

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  717  LAEGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLST R +LKELVKSDSGNQLDLPTANLVCKMRRVSL+
Sbjct  777  NVLSALSMPIPPVLATFHTCLSTSRDELKELVKSDSGNQLDLPTANLVCKMRRVSLD  833



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  715  LAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL+
Sbjct  775  NVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD  831



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  656  VYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQQLEP  715

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  716  LAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDIEYLS  775

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL+
Sbjct  776  NVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSLD  832



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LA+GISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  715  LADGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL+
Sbjct  775  NVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSLD  831



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLI KVRQHF+DLSRLPIWSSVEE SA P+P+FSAYPQSYVTNVGEYLLTLPQQLEP
Sbjct  662  VYDVLILKVRQHFSDLSRLPIWSSVEEPSAFPVPSFSAYPQSYVTNVGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDANA+EAQ+FATEWMFKVAEGATALY++QLRGI  ITDRGAQQLSVDIEYLS
Sbjct  722  LAEGISNSDANAEEAQFFATEWMFKVAEGATALYIEQLRGIHKITDRGAQQLSVDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVL+TFH+C STP  QLK+LVKSDSGNQLDLPTANLVCKMR V L+
Sbjct  782  NVLSALSMPIPPVLSTFHTCFSTPTDQLKDLVKSDSGNQLDLPTANLVCKMRGVRLD  838



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   328 bits (841),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSS+EE  A PLPTFSAYPQSYV++VGEYLLTLPQQLEP
Sbjct  657  VYDVLISKVRQRLSDVSRLPIWSSIEEQGAFPLPTFSAYPQSYVSSVGEYLLTLPQQLEP  716

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SD N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL+VDIEYLS
Sbjct  717  LAEGISSSDVNNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLAVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RR+SL+
Sbjct  777  NVLSALSMPIPPVLATFHTCLSTPRDQLKHLVKSDAGNQLDLPTANLVCKIRRISLD  833



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LA+GISN+DAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  715  LADGISNNDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL+
Sbjct  775  NVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSLD  831



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS+VEE SA PLP+F+AYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVSRLPIWSAVEEPSAFPLPSFNAYPQAYVTSVGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SD NADEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  722  LAEGISSSDPNADEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFHSCLSTPR QLK+ VKSD+GNQLDLPTANLVCK+RRV LE
Sbjct  782  NVLSALSMPIPPILATFHSCLSTPRDQLKDFVKSDAGNQLDLPTANLVCKIRRVGLE  838



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   322 bits (824),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 164/174 (94%), Gaps = 1/174 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  475  VYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYLLTLPQQLEP  534

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L EGISNSDAN DEAQ FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  535  LVEGISNSDANNDEAQIFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSVDIEYLS  594

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCKMRR+
Sbjct  595  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKMRRL  647



>gb|KHG21476.1| Conserved oligomeric Golgi complex subunit 7 [Gossypium arboreum]
Length=420

 Score =   314 bits (804),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  244  VYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQQLEP  303

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  304  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDIEYLS  363

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L+
Sbjct  364  NVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNLD  420



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE S   LPTFSA PQSYVTNVGEYLLTLPQQLEP
Sbjct  656  VYDVLISKVRQRLSDVSRLPIWSSVEEQSVYHLPTFSASPQSYVTNVGEYLLTLPQQLEP  715

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI+NSDAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  716  LAEGIANSDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  775

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVL+TFH+CLSTPR QL++L+KSDSGNQLDLPTANL+CKMRRV ++
Sbjct  776  NVLSALSMPIPPVLSTFHTCLSTPRDQLRDLIKSDSGNQLDLPTANLICKMRRVIID  832



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  715  LAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L+
Sbjct  775  NVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD  831



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  715  LAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L+
Sbjct  775  NVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNLD  831



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD  833



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ FNDLSRLP+WSSV+E SA PLP+FS+YPQSYVTNVGEYLLTLPQQLEP
Sbjct  668  VYDVLISKVRQQFNDLSRLPVWSSVDEPSAFPLPSFSSYPQSYVTNVGEYLLTLPQQLEP  727

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SD NADEAQ+FATEWMFKVAEGA+ LY++QLRGIQY+TDRGAQQL+ DIEYLS
Sbjct  728  LAEGISSSDTNADEAQFFATEWMFKVAEGASTLYMEQLRGIQYVTDRGAQQLAADIEYLS  787

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVK-SDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CLSTPR QLK+LVK SDSGNQLDLPTANLVCKMRR+SL+
Sbjct  788  NVLSALSMPIPPVLATFQTCLSTPREQLKDLVKSSDSGNQLDLPTANLVCKMRRLSLD  845



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   324 bits (830),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  722  LAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL+
Sbjct  782  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSLD  837



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 168/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  723  LAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL+
Sbjct  783  NVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSLD  838



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D++ LPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVAHLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSD N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  723  LAEGISNSDINSDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDHGAQQLSVDIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMPVPPVLATF +CLST R QLK+L+K+DSGNQLDLPTANLVCK+RRVSL+
Sbjct  783  NVLSALSMPVPPVLATFQTCLSTQRDQLKDLIKADSGNQLDLPTANLVCKIRRVSLD  839



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE  + PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQGSFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  718  LAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD  833



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   322 bits (824),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   +D+SRLPIWSSVEE SA  LP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  654  VYDVLISKVRHRLSDVSRLPIWSSVEEASAFHLPSFSAYPQSYVTSVGEYLLTLPQQLEP  713

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLS DIEYLS
Sbjct  714  LAEGISNSDANTDEAQFFATEWMFKVAEGATALYIEQLRGIQYMTDRGAQQLSADIEYLS  773

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PPVLATFH+CLSTPR QL++L+KSD GNQLDLPTANLVCK+RRV+
Sbjct  774  NVLSALSMPIPPVLATFHTCLSTPRDQLRDLLKSDGGNQLDLPTANLVCKIRRVN  828



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSD N DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDIEYLS
Sbjct  722  LAEGISNSDVNNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+CLSTPR QLKELV+SD+GN LDLPTANLVCK+RR+SL+
Sbjct  782  NVLSALSMPIPPVLATFHTCLSTPRDQLKELVQSDAGN-LDLPTANLVCKIRRLSLD  837



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGA QLS DIEYLS
Sbjct  723  LAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGALQLSADIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VLATFH+CLSTPR QL++L+KSD+GNQLDLPTA+LVCK+RRV+L+
Sbjct  783  NVLSALSMPIPQVLATFHTCLSTPRDQLRDLLKSDAGNQLDLPTAHLVCKIRRVTLD  839



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLI KVRQHFN+LSRLP+WSSVEE SA P+P+FSAYPQ YVTNVGEYLLTLPQQLEP
Sbjct  663  VYDVLILKVRQHFNELSRLPVWSSVEETSAHPVPSFSAYPQPYVTNVGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+ANA+EAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLSVDIEYLS
Sbjct  723  LAEGISNSEANAEEAQFFATEWMFKVAEGATALYIEQLRGIQKITDRGAQQLSVDIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP P VL+TFH+C STP  QLKE+VKSDSGNQLD+PTANLVCKMR + L+
Sbjct  783  NVLSALSMPTPLVLSTFHTCSSTPTDQLKEIVKSDSGNQLDIPTANLVCKMRGLRLD  839



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SR+PIWSSVEE +A PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLSDVSRMPIWSSVEEPTAFPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SD N DEAQ+FATEWMFKVAEGAT LY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  715  LAEGISSSDPNTDEAQFFATEWMFKVAEGATTLYMEQLRGIQYITDRGAQQLSADIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP+LATFH+CLSTPR QL++LVKSD+GNQLDLPTA+LVCK+RRV+
Sbjct  775  NVLSALSMPIPPILATFHTCLSTPRDQLRDLVKSDAGNQLDLPTAHLVCKIRRVT  829



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  660  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEP  719

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  720  LAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  779  NVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD  835



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE +ARPLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  653  VYDVLISKVRQRLSDVSRLPIWSSVEEPTARPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  712

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLS DIEYLS
Sbjct  713  LAEGISSSEANTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSTDIEYLS  772

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+P +LATF +CLSTP  QL+EL+KSDS NQLDLPTANLVCK+RRVS
Sbjct  773  NVLSALSMPIPQILATFQTCLSTPNDQLRELLKSDSANQLDLPTANLVCKIRRVS  827



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D++RLPIWSSVEE SA  LP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVARLPIWSSVEEASAFHLPSFSAYPQAYVTSVGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGI YITDRGAQQLS DIEYLS
Sbjct  722  LAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIHYITDRGAQQLSTDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPV+ATFH+CLSTPR QL++LVKSDSG+QLDLP ANLVCK+RRV+L+
Sbjct  782  NVLSALSMPIPPVMATFHTCLSTPRDQLRDLVKSDSGSQLDLPIANLVCKIRRVNLD  838



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  660  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEP  719

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  720  LAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  779  NVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSLD  835



>gb|AIU51123.1| embryo yellow protein, partial [Chloranthus japonicus]
Length=567

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SRLPIWSS +E SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  394  VYDVLISKVRQRLNDVSRLPIWSSFDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  453

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYIT+RGAQQLS DIEYLS
Sbjct  454  LAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITERGAQQLSADIEYLS  513

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PP+LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RRV
Sbjct  514  NVLSALSMPMPPILATFHTCLSTQRDQLHDLVKSDGGNQLDLPTAHLVCKIRRV  567



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  654  VYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQQLEP  713

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  714  LAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDIEYLS  773

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L+
Sbjct  774  NVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNLD  830



>gb|AIU51126.1| embryo yellow protein, partial [Pandanus utilis]
Length=477

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  303  VYDVLISKVRQRLSDVSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  362

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+A +DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLS
Sbjct  363  LAEGISSSEAGSDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLS  422

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+T+H+CLSTPR QL++L+KSD   QLDLPTA+LVCK+RR++
Sbjct  423  NVLSALSMPIPPFLSTYHTCLSTPRDQLRDLLKSDGATQLDLPTAHLVCKIRRIA  477



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISN D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  715  LAEGISNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVDIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  775  NVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  831



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  660  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEP  719

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDIEYLS
Sbjct  720  LAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALS+P+PP LATFH+CLSTPR QLK+ +KSDSGNQLDLPTANLVCK+RRVSL+
Sbjct  779  NVLSALSVPIPPALATFHTCLSTPRDQLKDQLKSDSGNQLDLPTANLVCKIRRVSLD  835



>emb|CDY00472.1| BnaA10g08010D [Brassica napus]
Length=234

 Score =   295 bits (756),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQQLEP
Sbjct  57   VYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQQLEP  116

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYL
Sbjct  117  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYL  176

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G +LD PTANLVCKMRR+S +
Sbjct  177  SNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGRELDFPTANLVCKMRRISFD  234



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   313 bits (802),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  719  LAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S +
Sbjct  779  NVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRISFD  835



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   313 bits (801),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE  A  LPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQGAFHLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI+YLS
Sbjct  718  LAEGISSSEAN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDIDYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VLATFHSCLST R QLK+L+K+DS NQLDLPTANLVCKMR+++L+
Sbjct  777  NVLSALSMPIPAVLATFHSCLSTSRDQLKDLLKTDSANQLDLPTANLVCKMRQLNLD  833



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +DLSR+PIWSS EE SA  LP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLSDLSRMPIWSSAEETSAFHLPSFSAYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+ DAN DEAQ+FATEWMFKVAEGATA+Y++QLRGIQYITDRGAQQLSVDIEYL+
Sbjct  719  LAEGISSDDANTDEAQFFATEWMFKVAEGATAIYIEQLRGIQYITDRGAQQLSVDIEYLA  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALS+P+PP+L+TF +CLSTPR QL++L+KSDSG QLDL TANL+CKMRR++L+
Sbjct  779  NVLSALSVPIPPILSTFQTCLSTPRDQLRDLIKSDSGTQLDLSTANLICKMRRLNLD  835



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWS VEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSLVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG++QLS DIEYLS
Sbjct  723  LAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSKQLSADIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P  LATFH+CLSTPR QL++LVKSD G+QLDLPTA+LVCK+RR++L+
Sbjct  783  NVLSALSMPIPSTLATFHTCLSTPRDQLRDLVKSDQGSQLDLPTAHLVCKIRRINLD  839



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQQLEP
Sbjct  546  VYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQQLEP  605

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDIEYLS
Sbjct  606  LAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDIEYLS  665

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL+
Sbjct  666  NVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSLD  722



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   312 bits (800),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  719  LAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  779  NVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  835



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYLS
Sbjct  719  LAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  779  NVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRISFD  835



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 2/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI+YLS
Sbjct  718  LAEGISSSETN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDIDYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS-DSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VLATF SCLST R QLK+L+K+ DS NQLDLPTANLVCKMRRV+L+
Sbjct  777  NVLSALSMPIPAVLATFQSCLSTSRDQLKDLLKTPDSANQLDLPTANLVCKMRRVNLD  834



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   310 bits (794),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND++RLPIWSSVEE SA PLPTFSAYPQSYVT++GEYLLTLPQQLEP
Sbjct  655  VYDVLISKVRQRLNDVARLPIWSSVEEQSAHPLPTFSAYPQSYVTSIGEYLLTLPQQLEP  714

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+  A+EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  715  LAEGISSSEPGAEEAQLFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLS  774

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP LATFH+C+STPR QL E +KSD G+QLDLPTA+LVC++RR++
Sbjct  775  NVLSALSMPIPPFLATFHTCVSTPRDQLPEQIKSDGGSQLDLPTAHLVCRIRRIT  829



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   310 bits (794),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDIEYLS
Sbjct  722  LAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL+
Sbjct  782  NVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSLD  838



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSS++E SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  663  VYDVLISKVRQRLSDVSRLPIWSSIDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  722

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  723  LAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADIEYLS  782

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PP+LATFH+CLST R QL++LVKS+  NQLDLPTA+LVCK+RRV
Sbjct  783  NVLSALSMPIPPILATFHTCLSTQRDQLRDLVKSEGSNQLDLPTAHLVCKIRRV  836



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  655  VYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  714

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  715  LAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVDIEYL  774

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  775  SNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  832



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRISFD  836



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  836



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISFD  836



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  660  VYDVLISKVRQRLSDVSRLPIWSSVEEPSAHPLPSFSAYPQSYVTSVGEYLLTLPQQLEP  719

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI++ ++N DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL+ DIEYLS
Sbjct  720  LAEGIASRESNTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLAADIEYLS  779

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALS+P+P VLATF +CLSTPR QL++LVKSD GNQLDLPTANL+CK+RR++
Sbjct  780  NVLSALSVPIPQVLATFLTCLSTPREQLRDLVKSDGGNQLDLPTANLICKIRRIA  834



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+
Sbjct  718  LAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLT  777

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSM +PP L+TF +C STPR QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  778  NVLSALSMEIPPALSTFLTCFSTPREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+
Sbjct  718  LAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLT  777

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  778  NVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  658  VYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQQLEP  717

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDIEYL+
Sbjct  718  LAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDIEYLT  777

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L+
Sbjct  778  NVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNLD  834



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   308 bits (788),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   307 bits (786),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT++GEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSIGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+A  +EAQ+FA+EWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  708  LAEGISSSEAGTEEAQFFASEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L+
Sbjct  768  NVLSALSMPIPPFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIALD  823



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   307 bits (787),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   307 bits (787),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+++LP+WSSVEE  +  +P+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  651  VYDVLISKVRQRLSDVAKLPVWSSVEETVSHKMPSFSAYPQAYVTSVGEYLLTLPQQLEP  710

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGISNS++NADE+Q+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  711  LAEGISNSESNADESQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSADIEYLS  770

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMPV P L+TFH+CL T R QL++LVKSD GNQLDLPTA L+CKMRRVSL+
Sbjct  771  NVLSALSMPVAPFLSTFHTCLLTQRDQLRDLVKSDGGNQLDLPTARLLCKMRRVSLD  827



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  652  VYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQQLEP  711

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI+YLS
Sbjct  712  LAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDIDYLS  770

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L+
Sbjct  771  NVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNLD  827



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  652  VYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQQLEP  711

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI+YLS
Sbjct  712  LAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDIDYLS  770

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L+
Sbjct  771  NVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNLD  827



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTA+LVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTASLVCKMRRISFD  836



>ref|NP_001132532.1| uncharacterized protein LOC100193995 [Zea mays]
 gb|ACF81411.1| unknown [Zea mays]
Length=344

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  168  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  227

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+
Sbjct  228  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLN  287

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L+
Sbjct  288  NVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITLD  344



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  708  LAEGISSSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+P  L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L+
Sbjct  768  NVLSALSMPIPAFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIALD  823



>gb|AIU51105.1| embryo yellow protein, partial [Lilium brownii]
Length=450

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  277  VYDVLISKVRQRLSEVSRLPIWSSVEEPSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  336

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+ NA+EAQ+FATEWMFKVAEGAT L+++QLRGI YIT+RGAQQLS DIEYL+
Sbjct  337  LAEGISSSENNAEEAQFFATEWMFKVAEGATDLFMEQLRGIHYITERGAQQLSADIEYLT  396

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PP L TFH+CLSTPR Q +EL+K+D G+QLD PTA+LVCK+RR+
Sbjct  397  NVLSALSMPIPPFLTTFHTCLSTPRDQFRELLKADGGSQLDQPTAHLVCKIRRL  450



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   304 bits (779),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SR+P+WSSVEE SA PLP+FSAYPQ+Y+T+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLSDVSRMPVWSSVEEPSALPLPSFSAYPQAYITSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SD   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLS
Sbjct  708  LAEGISSSDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+T+H+CLSTPR QL++L+KS++G+QLD+PTA+LVCK+RR++
Sbjct  768  NVLSALSMPIPPFLSTYHTCLSTPRDQLQDLIKSEAGSQLDIPTAHLVCKIRRIA  822



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  662  VYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQTYVTSVGEYLLTLPQQLEP  721

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+SDANADEAQ+FATEWMFKVAEGA A+Y +QLRGIQYITDRGAQQLS DIEYLS
Sbjct  722  LAEGISSSDANADEAQFFATEWMFKVAEGAVAIYTEQLRGIQYITDRGAQQLSADIEYLS  781

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMPVP VL+TFH+ LST R ++++L+KSD+ +QLDLPTA+LVCKMRRV+L+
Sbjct  782  NVLSALSMPVPQVLSTFHTFLSTSRDKIQDLLKSDAVSQLDLPTAHLVCKMRRVTLD  838



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  +EAQ+FATEW+FKVAEGATAL+ +QLRGI YITDRGAQQL+ DIEYLS
Sbjct  708  LAEGISGSEAGNEEAQFFATEWIFKVAEGATALFTEQLRGIHYITDRGAQQLAADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP LATFH+C+STPR Q++EL+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  768  NVLSALSMPIPPFLATFHTCISTPRDQVRELIKSDGGSQLDLPTAHLVCKIRRIS  822



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   D+S LPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRQRLGDVSHLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQQLEP  718

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDIEYL
Sbjct  719  LAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLSVDIEYL  778

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  779  SNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  836



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  504  VYDVLISKVRQRLGEVSRLPIWSSVEEQTAFSLPNFSSYPQSYVTSVGEYLLTLPQQLEP  563

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDIEYL
Sbjct  564  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYL  623

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S +
Sbjct  624  SNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFHTANLVCKMRRISFD  681



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   ++SRLPIWSS EE SA PLP+FS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  652  VYDILISKVRQRLGEVSRLPIWSSSEEQSAFPLPSFSSYPQSYVTSVGEYLLTLPQQLEP  711

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVDIEYL
Sbjct  712  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVDIEYL  771

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  772  SNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  829



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   303 bits (776),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   ND+S+LPIWS+VEE SA PLP+FSAYPQ YVT++GEYLLTLPQQLEP
Sbjct  659  VYDVLISKVRHRLNDVSQLPIWSAVEEPSAFPLPSFSAYPQLYVTSIGEYLLTLPQQLEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS++D+N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DIEYLS
Sbjct  719  LAEGISSNDSNSDEAQFFATEWMFKVAEGATALYLEQLRGIQYITDRGAQQLSADIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALS P+P  LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RR++
Sbjct  779  NVLSALSTPIPLALATFHTCLSTARDQLHDLVKSDGGNQLDLPTAHLVCKIRRIT  833



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   D+S +PIWS+ EE +A PLPTFS+YPQSYVT+VGEYLLTLPQQLEP
Sbjct  660  VYDVLISKVRQRLGDVSHMPIWSAAEEQTAFPLPTFSSYPQSYVTSVGEYLLTLPQQLEP  719

Query  543  LAEGISN-SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGISN SDAN ++AQ+FATEWMFKVAEGATALY++QLRGIQ+ +DRGAQQLSVDIEYL
Sbjct  720  LAEGISNNSDANNEDAQFFATEWMFKVAEGATALYMEQLRGIQHASDRGAQQLSVDIEYL  779

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVLSALSMP+PPVLATF +CL+T R QLK+L++S++ NQLDLPTANLVCKMRRVS +
Sbjct  780  SNVLSALSMPIPPVLATFQTCLATSREQLKDLMRSEAANQLDLPTANLVCKMRRVSFD  837



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   302 bits (773),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNDVSRMPIWSSVEEQSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS++D   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLS
Sbjct  708  LAEGISSNDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVL ALSMP+PP L+T+H+CLS PR QL++L+KS+ G+QLD+PTA+LVCK+RR++
Sbjct  768  NVLFALSMPIPPFLSTYHTCLSKPRDQLRDLIKSEPGSQLDVPTAHLVCKIRRIA  822



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   302 bits (773),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  649  VYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  708

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  709  LAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  768

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+ LE
Sbjct  769  NVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRIPLE  825



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  521  VYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  580

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  581  LAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  640

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SLE
Sbjct  641  NVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGAQLDLPTAHLVSKIRRISLE  697



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   299 bits (765),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ   +++RLPIWSSVEE    PLP+FSAYPQSYVT+VGEYLLTLPQQLEP
Sbjct  530  VYDVLISKVRQRLCEIARLPIWSSVEEQGGLPLPSFSAYPQSYVTSVGEYLLTLPQQLEP  589

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  590  LAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  649

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SLE
Sbjct  650  NVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGTQLDLPTAHLVSKIRRISLE  706



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D++RLPIWS +EE S   LP+FS YPQSYVT+VGEYLLTLPQQ EP
Sbjct  659  VYDVLISKVRQRLSDVARLPIWSKIEEPSTFALPSFSVYPQSYVTSVGEYLLTLPQQFEP  718

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  D+N DEAQ+ ATEWMFKVAEGA  LY +QLRGI YIT+RGAQQLS DIEYLS
Sbjct  719  LAEGISGGDSNTDEAQFLATEWMFKVAEGAAVLYTEQLRGIHYITERGAQQLSADIEYLS  778

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PPVLATFH+C STPR QL ELVKSD GN+LDLPTANLVCK+RRV+L+
Sbjct  779  NVLSALSMPIPPVLATFHTCFSTPREQLPELVKSDGGNELDLPTANLVCKIRRVALD  835



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  611  VYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  670

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  671  LAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  730

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+
Sbjct  731  NVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRI  784



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  613  VYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  672

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLS
Sbjct  673  LAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLS  732

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  733  NVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  787



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +DLSRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  657  VYDVLISKVRQRLSDLSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  716

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQLS DIEYLS
Sbjct  717  LAEGISSSETGTDEAQFFATEWVFKVAEGATALFMEQLRGIHYITDRGAQQLSADIEYLS  776

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+TFH+CLSTPR Q+++L+K D+ +QLDLPTA+LVCK+RR++
Sbjct  777  NVLSALSMPIPPFLSTFHTCLSTPRDQVRDLLKLDAASQLDLPTAHLVCKIRRIA  831



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  641  VYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  700

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGA QLS DIEYL+
Sbjct  701  LAEGISGSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGALQLSADIEYLN  760

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSM +PP L TFH+C+STPR QL +L+KSD GNQLD+PTA+LVCK+RR++
Sbjct  761  NVLSALSMTIPPFLMTFHTCISTPREQLPDLIKSDGGNQLDIPTAHLVCKIRRIT  815



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLS
Sbjct  708  LAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  768  NVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  822



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   299 bits (765),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SR+ IWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  648  VYDVLISKVRQRLNDVSRMSIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  707

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S+A  +EAQ+FATEWMFKV EGATAL+++QLRGIQYITDRGA QLS DIEYLS
Sbjct  708  LAEGISSSEAGTEEAQFFATEWMFKVVEGATALFMEQLRGIQYITDRGALQLSADIEYLS  767

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++
Sbjct  768  NVLSALSMPIPPFLTTFHACLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIA  821



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  641  VYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  700

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DIEYLS
Sbjct  701  LAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADIEYLS  760

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+ L+
Sbjct  761  NVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRIPLD  817



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  696  VYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  755

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYLS
Sbjct  756  LAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLS  815

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  816  NVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  870



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  641  VYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  700

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DIEYLS
Sbjct  701  LAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADIEYLS  760

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+
Sbjct  761  NVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRI  814



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+
Sbjct  704  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++L+
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRITLD  820



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQQLEP
Sbjct  464  VYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQQLEP  523

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYL
Sbjct  524  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYL  583

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL+ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S +
Sbjct  584  SNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFLTANLVCKMRRISFD  641



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   297 bits (760),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VG YLLTLPQQLEP
Sbjct  654  VYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGXYLLTLPQQLEP  713

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYL
Sbjct  714  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYL  773

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S +
Sbjct  774  SNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRISFD  831



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   296 bits (759),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  704  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  647  VYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  706

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  707  LTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  766

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SLE
Sbjct  767  NVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISLE  823



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  647  VYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  706

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  707  LTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  766

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SLE
Sbjct  767  NVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISLE  823



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+
Sbjct  704  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIT  818



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  704  LAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+SL+
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRISLD  820



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR+  N +S LPIWSSVEE +   LP+FSAY QSY+T VGEYLLTLPQQLEP
Sbjct  652  VYDVLISKVRKQLNGVSNLPIWSSVEEQTTFHLPSFSAYAQSYITTVGEYLLTLPQQLEP  711

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAE ISN+DANA+EAQ+FATEWMFKVAEGA  L+++QLRGIQYIT+RGAQQLSVDIEYLS
Sbjct  712  LAETISNNDANAEEAQFFATEWMFKVAEGAAGLFMEQLRGIQYITERGAQQLSVDIEYLS  771

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+LATFH+CLSTPR QLK+++K+D    LD+PTANLVCKMRRVSLE
Sbjct  772  NVLSALSMPIPPILATFHTCLSTPRDQLKDVMKNDL-ESLDVPTANLVCKMRRVSLE  827



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY+VLI K+R   +D+SR+ IW+SVEE +A  LP+FSAYPQ YVT++GEYLLTLPQQLEP
Sbjct  640  VYEVLILKIRHRLSDVSRMAIWTSVEEDNAFSLPSFSAYPQPYVTSIGEYLLTLPQQLEP  699

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L  G+SN+DA ADEAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLS DIEYL 
Sbjct  700  LTTGLSNADATADEAQFFATEWMFKVAEGATALYIEQLRGIQSITDRGAQQLSADIEYLC  759

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP PPVLATFHSCL+T R QL+ELVKSD+G+QLDLPTA LVCK+R V+LE
Sbjct  760  NVLSALSMPTPPVLATFHSCLATSREQLRELVKSDAGSQLDLPTARLVCKIRHVTLE  816



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+
Sbjct  704  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L+
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITLD  820



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DIEYL+
Sbjct  704  LAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   291 bits (745),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  644  VYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  703

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DIEYL+
Sbjct  704  LAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADIEYLN  763

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++
Sbjct  764  NVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRIT  818



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 1/163 (1%)
 Frame = -1

Query  681  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  502
            D+SRL IWSSVEE +A  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEG+S+S+AN DE
Sbjct  593  DVSRLSIWSSVEEQTAFRLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGVSSSEAN-DE  651

Query  501  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  322
            AQ+FATEWMFKVAEGAT LY++QLRG+QYITDRGAQQLSVDI+YLSNVLSALSMP+P VL
Sbjct  652  AQFFATEWMFKVAEGATTLYIEQLRGVQYITDRGAQQLSVDIDYLSNVLSALSMPIPAVL  711

Query  321  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            ATFHSCLST R QLK+LVK+DS NQLDLPTANLVCKMRRV+L+
Sbjct  712  ATFHSCLSTSRDQLKDLVKTDSANQLDLPTANLVCKMRRVNLD  754



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY VLISKVRQ   ++SRLPIWSSVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQQLEP
Sbjct  639  VYAVLISKVRQRLKEVSRLPIWSSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQQLEP  698

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDIEYLS
Sbjct  699  LAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDIEYLS  758

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  759  NVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLI+KVRQ  +D+SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  651  VYDVLIAKVRQRLSDVSRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  710

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGIS +D   ++AQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL+ DIEYLS
Sbjct  711  LAEGISGADTATEDAQFFATEWMFKVAEGATALYMEQLRGIQYLTDRGAQQLAADIEYLS  770

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            NVLSALSMP+PP L T+H+C++TPR +L++L+KS++ +QLDLPTA+LVCK+RR+
Sbjct  771  NVLSALSMPIPPFLVTYHNCVATPRDELRDLLKSEN-HQLDLPTAHLVCKIRRL  823



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY VLISKVRQ   ++SRL IW+SVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQQLEP
Sbjct  639  VYAVLISKVRQRLKEVSRLSIWTSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQQLEP  698

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            LAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDIEYLS
Sbjct  699  LAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDIEYLS  758

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            NVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  759  NVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY+VLISKVRQ  ++++++PIWSS+EE S  P+P+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  628  VYEVLISKVRQRLSNVAQMPIWSSIEEQSGFPIPSFSAYPQAYVTSVGEYLLTLPQQLEP  687

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
            L   +S+ ++N DEAQ+FA EWMFKVAEGATALY++QLR IQ ITDRGAQQL+ DIEYLS
Sbjct  688  LGGTVSSGESNNDEAQFFAAEWMFKVAEGATALYIEQLRSIQSITDRGAQQLATDIEYLS  747

Query  363  NVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            NVLSALSMP+PP+L TF +CLSTP  QL ELVKSD+G+QLDLP A LVCK+ RV+LE
Sbjct  748  NVLSALSMPIPPILYTFQACLSTPADQLPELVKSDAGSQLDLPAARLVCKILRVNLE  804



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 10/185 (5%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSS--------VEEHSARPLPTFSAYPQSYVTNVGEYLL  568
            VYDVLI KVRQHF+DLSR P WSS         +E SA P+P+FSAYPQ YVTNVGEYLL
Sbjct  656  VYDVLILKVRQHFHDLSRQPTWSSSSSSSSSSTDEPSAHPVPSFSAYPQPYVTNVGEYLL  715

Query  567  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  388
            TLPQQLEPLAEGI+NS AN++EAQ+FATEWMFKVAEGATALYV+QLR IQ +TDRGA+QL
Sbjct  716  TLPQQLEPLAEGIANSHANSEEAQFFATEWMFKVAEGATALYVEQLRAIQKVTDRGAEQL  775

Query  387  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  208
            SVDIEYLSNVLSALSMP+P VL+TFH+C S    +L++LVK  S + LD+  ANLVCKMR
Sbjct  776  SVDIEYLSNVLSALSMPIPQVLSTFHACFSGSMDELRDLVK--SRDDLDVVAANLVCKMR  833

Query  207  RVSLE  193
             V L+
Sbjct  834  GVRLD  838



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 4/180 (2%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQLEP
Sbjct  601  VYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQLEP  660

Query  543  LAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIE  373
            L   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS DI+
Sbjct  661  LTSSMTTSDTSDDIDEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSADID  720

Query  372  YLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V +E
Sbjct  721  YLCNVLTALSMNVPAVLSTFQQCVGATRDQLAEFAKG-VGPDLDGPTVRLVCKMRQVPVE  779



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 4/180 (2%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQLEP
Sbjct  601  VYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQLEP  660

Query  543  LAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIE  373
            L   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS DI+
Sbjct  661  LTSSMTTSDTSDDINEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSADID  720

Query  372  YLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V +E
Sbjct  721  YLCNVLTALSMNVPAVLSTFQQCVGATREQLAEFTKG-VGPDLDGPTVRLVCKMRQVLVE  779



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 125/178 (70%), Gaps = 43/178 (24%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ                                             +LEP
Sbjct  653  VYDILISKVRQRLG------------------------------------------ELEP  670

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVDIEYL
Sbjct  671  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVDIEYL  730

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  731  SNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  788



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 125/178 (70%), Gaps = 43/178 (24%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ                                             +LEP
Sbjct  653  VYDILISKVRQRLG------------------------------------------ELEP  670

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VDIEYL
Sbjct  671  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVDIEYL  730

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S +
Sbjct  731  SNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRISFD  788



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 125/178 (70%), Gaps = 43/178 (24%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYD+LISKVRQ                                             +LEP
Sbjct  653  VYDILISKVRQRLG------------------------------------------ELEP  670

Query  543  LAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYL  367
            LAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGI+YITDRGAQQLSVDIEYL
Sbjct  671  LAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIEYITDRGAQQLSVDIEYL  730

Query  366  SNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            SNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S +
Sbjct  731  SNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISFD  788



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 135/182 (74%), Gaps = 11/182 (6%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VY+VL+SKVR    D++R  +W+  EE +   LP FSAY   Y+T++GEYLLTLPQQL P
Sbjct  672  VYEVLMSKVRAKLADMAREAVWNQQEEQNLFSLPNFSAYASEYITSIGEYLLTLPQQLLP  731

Query  543  LA-----EGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  379
            LA     EG+   +  +D+AQYFATEWMFKVAEGATA Y +Q+RGIQ +++RGAQQLS D
Sbjct  732  LAGSGNPEGV---EEGSDDAQYFATEWMFKVAEGATAAYTEQIRGIQALSERGAQQLSAD  788

Query  378  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            IEYL NVL+ALSM  PPVL TFH C+STPR++L E+V+ D    +D  T  LVCKMR+V 
Sbjct  789  IEYLCNVLNALSMSTPPVLHTFHVCVSTPRNKLFEVVEQDG---IDNATFRLVCKMRQVK  845

Query  198  LE  193
            LE
Sbjct  846  LE  847



>gb|AIU51139.1| embryo yellow protein, partial [Artemisia annua]
Length=98

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -1

Query  489  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  310
            +TEWMFKVAEGA AL+++QLRGIQYITDRGAQQLSVDIEYLSNVLS LSMP+PP+LATFH
Sbjct  1    STEWMFKVAEGAAALFMEQLRGIQYITDRGAQQLSVDIEYLSNVLSVLSMPIPPILATFH  60

Query  309  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  193
            +CLSTPR QLK+++K+DS   LDLPTANLVCKMRRVSLE
Sbjct  61   TCLSTPRDQLKDVIKTDS-ESLDLPTANLVCKMRRVSLE  98



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEY+LTLPQQLEP
Sbjct  534  VYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYILTLPQQLEP  593

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEG  457
            L EG+SNSD N DEAQ FATEWMFKVAEG
Sbjct  594  LTEGVSNSDTNNDEAQIFATEWMFKVAEG  622



>ref|NP_001058323.2| Os06g0669600 [Oryza sativa Japonica Group]
 dbj|BAF20237.2| Os06g0669600, partial [Oryza sativa Japonica Group]
Length=160

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  36   VYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQQLEP  95

Query  543  LAEGISNSDANADEAQYFATEWMFKV  466
            LAEGIS  +A  +EAQ+FATEW+FKV
Sbjct  96   LAEGISGGEAGNEEAQFFATEWIFKV  121



>ref|XP_006491716.1| PREDICTED: uncharacterized protein LOC102619662 [Citrus sinensis]
Length=870

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQQLEP
Sbjct  366  VYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQQLEP  425

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALY  442
            LAEGIS SD N DEAQ+FATEWMFKV    T+LY
Sbjct  426  LAEGISTSD-NNDEAQFFATEWMFKV----TSLY  454



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 103/182 (57%), Gaps = 6/182 (3%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-  547
            VYD L+ +V      +S   +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+ 
Sbjct  631  VYDTLLGRVSLELKGISTSEVWSAKPAESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDN  690

Query  546  ----PLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  382
                 LA   S + D+NA +    +  W+ K+AE +  L + ++R I  +TD+GA QLS 
Sbjct  691  MHDDDLARATSLSGDSNAAQEPATSEAWIAKIAEASAELLLKEVRAIASLTDQGAAQLSA  750

Query  381  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            D+EY SN+++ALS+  P  L  ++ C S PR + ++  ++ +   +D+         R +
Sbjct  751  DLEYFSNIVAALSLAPPSALIAWYKCASAPRDEYEDFARAATSEGIDVRVVRAAAATRGI  810

Query  201  SL  196
             L
Sbjct  811  KL  812



>ref|XP_003080398.1| conserved oligomeric Golgi complex component-related / COG complex 
component-related (ISS) [Ostreococcus tauri]
Length=396

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 101/180 (56%), Gaps = 6/180 (3%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-  547
            V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+ 
Sbjct  215  VHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDG  274

Query  546  ----PLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  379
                 +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++GA QL+VD
Sbjct  275  ANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQLAVD  333

Query  378  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            +EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      V   R ++
Sbjct  334  LEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRAVAATRGIA  393



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 101/180 (56%), Gaps = 6/180 (3%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE-  547
            V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ L+ 
Sbjct  605  VHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQHLDG  664

Query  546  ----PLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  379
                 +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++GA QL+VD
Sbjct  665  ANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQLAVD  723

Query  378  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
            +EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      V   R ++
Sbjct  724  LEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRAVAATRGIA  783



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            VYDVLISKVRQ  ND+SR+PIWSSVEE S  PLP+FSAYPQ YVT+VGEYLLTLPQQLEP
Sbjct  656  VYDVLISKVRQRLNDVSRMPIWSSVEETSGLPLPSFSAYPQPYVTSVGEYLLTLPQQLEP  715

Query  543  LAEGI  529
            L+EGI
Sbjct  716  LSEGI  720



>emb|CBI21190.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  627  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATA  448
            LP+F+AYPQ+YVT+VGEYLLTLPQQLEPLAEGI +SD NADEAQ+FATEWMFKV     +
Sbjct  55   LPSFNAYPQAYVTSVGEYLLTLPQQLEPLAEGICSSDPNADEAQFFATEWMFKVTNLYCS  114

Query  447  LY  442
            L+
Sbjct  115  LH  116



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 101/187 (54%), Gaps = 13/187 (7%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            V DVL+SKVR  F  L++   WS+  E S   LPTFSAYPQ YVT  GEYLL+LPQ LE 
Sbjct  585  VLDVLLSKVRSEFRGLAKRAEWSTSAESSDFDLPTFSAYPQGYVTTAGEYLLSLPQHLES  644

Query  543  LAEGISNSDANADE----------AQYF-ATEWMFKVAEGATALYVDQLRGIQYITDRGA  397
            +A+      A A            A++F + EWM +VAE A  L + ++R I  + + GA
Sbjct  645  IADAAEEERAAAAAAGEMGRAATAAEHFDSGEWMTRVAEAAAGLLLAEVRAITTLGEPGA  704

Query  396  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  217
             QL+ D+EY +N++SAL    P  L T+  C +  R      V+   G   D+  A  V 
Sbjct  705  AQLAADLEYFNNIISALFSEPPSALRTYAVCAAAARDSYAISVRDVEGMDEDVIRA--VA  762

Query  216  KMRRVSL  196
            K R + L
Sbjct  763  KARGIKL  769



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 54/153 (35%), Positives = 88/153 (58%), Gaps = 11/153 (7%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            V D L+ +VR+   ++    IW+ +   +A  LPTFSAYPQ   TN GEYLL+LP +LE 
Sbjct  776  VRDFLLHRVRRELENIENEQIWTKMAAQTAHDLPTFSAYPQEKATNSGEYLLSLPTRLEA  835

Query  543  LAEGISNSDANA-----------DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  397
            L   + +   +A           DE +  A+ WM +VAE +  +++++++ I+ +++ GA
Sbjct  836  LVNVVGDDVGSAASASAGIFGNDDEDEDLASIWMERVAEASATIFLERVKSIRRLSEPGA  895

Query  396  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLS  298
             QL+ D+EY SNV++AL+      L  +  C S
Sbjct  896  AQLAADLEYFSNVVTALTSRPQRGLLAYMQCAS  928



>ref|XP_002731007.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Saccoglossus kowalevskii]
Length=259

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 95/189 (50%), Gaps = 21/189 (11%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHS--ARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D++   ++    DLS + +WSSV   +  +  LP+FS  P  Y+T +G+YL+TLPQQLE
Sbjct  75   FDIVFCPLKVQLADLSTMEVWSSVGSGAVLSVDLPSFSLSPMEYITKIGQYLMTLPQQLE  134

Query  546  PLAEGISNSDANA--------------DEAQYFATEWMFKVAEGATALYVDQLRGIQYIT  409
                  + +   A               E      +W+  +A      YV+Q+  +  +T
Sbjct  135  SFTTQDNTALEKALQMGKLPFPDTQGEHEEDTVVDQWIGSIARATMHHYVEQILMVPQLT  194

Query  408  DRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTA  229
             +G +QLS DI+YL NVL AL +P    L++  + L TP +Q +E+     G+ ++    
Sbjct  195  TQGTKQLSADIDYLCNVLDALGIPASTSLSSVDTLLKTPIAQYEEI-----GDDIEARLI  249

Query  228  NLVCKMRRV  202
            N V  MR +
Sbjct  250  NAVVGMRSI  258



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 75/134 (56%), Gaps = 6/134 (4%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            V +VL  + R     L RL  W   +   A  LPTFSAYP  YVT+VGEYL+ LPQQLE 
Sbjct  576  VLEVLTQRPRAQLAGLPRLGEWQ--QRAGALLLPTFSAYPLQYVTSVGEYLMMLPQQLES  633

Query  543  LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLS  364
               G    + N +EA     +W+ KVA    A Y  QL  +  +T +GA QL+ D+EY  
Sbjct  634  ALLG----EDNGEEAGQLVGDWIDKVALDTAAHYQQQLAALPGLTAQGAAQLAADLEYFC  689

Query  363  NVLSALSMPVPPVL  322
            NVL+ L + VPP L
Sbjct  690  NVLTTLGVAVPPSL  703



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 95/184 (52%), Gaps = 10/184 (5%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            V DVL SKVR     +     W          LPTFSAYPQ Y+TN GEYLL+LP  L+ 
Sbjct  611  VLDVLASKVRNELRGMRGRAEWGETRASGGLNLPTFSAYPQEYMTNAGEYLLSLPTTLDA  670

Query  543  LAEGISNSDANA-----DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  379
            +A   + + A       D  +  A EWM KVA  A +L + ++RGI  +TD GA QL+ D
Sbjct  671  IAGAGAVAGAAGPGGADDVPELDAGEWMAKVAAAAASLLLTEVRGISALTDLGAAQLAAD  730

Query  378  IEYLSNVLSALSM---PVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMR  208
            ++Y  NV++ALS+   P    L  F +C +  R     ++ +  G+ +D     +V   R
Sbjct  731  LDYFVNVIAALSLDDVPDAKKLRCFATCCAAARDAY--VMSTRDGDAVDEDIVKIVAAAR  788

Query  207  RVSL  196
             + L
Sbjct  789  GIKL  792



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 91/195 (47%), Gaps = 19/195 (10%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            V+DVL+++V      L  LP W    E   H A PLP+F+ YP  YVT +G++L+ +PQQ
Sbjct  556  VFDVLLARVASLLASLPVLPEWRKGAEGSAHPAAPLPSFNTYPLPYVTAIGDHLMAMPQQ  615

Query  552  LEPLAEGISNSDANADEAQYFATEWMF--------------KVAEGATALYVDQLRGIQY  415
            LE L  G +  D +A  A   A                   K   GA A+Y D +  I  
Sbjct  616  LEVLM-GDTGDDTSATAAAGGADASGGGAAEWEELAAEWLDKAVSGAAAMYADAIFKIGD  674

Query  414  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSD-SGNQLDL  238
            +  +G  QL+ D+EY  NV+ AL +  PP L T          +  EL +   +    D 
Sbjct  675  LGQQGGCQLATDVEYFVNVMGALHVAPPPSLLTVQLLAGAAPEEFAELGRGALAEGAADG  734

Query  237  PTANLVCKMRRVSLE  193
            P    +  MRR++LE
Sbjct  735  PALRALAGMRRIALE  749



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 76/145 (52%), Gaps = 17/145 (12%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSAR-------PLPTFSAYPQSYVTNVGEYLLT  565
            VYDVL S        L   P+W +              PLP FSAYPQ  VT  GEYL+ 
Sbjct  557  VYDVLGS-----LEGLGAQPVWGARGGEGGGAGGGAGGPLPAFSAYPQQAVTAAGEYLMM  611

Query  564  LPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLS  385
            LPQ LE L  G S +     E +    EW+ +VA GA  LYV +L  I  +++ GA QL+
Sbjct  612  LPQTLEGLLGGDSEA-----EEEAVDAEWLDRVAAGAAELYVRELAKIAALSESGAAQLA  666

Query  384  VDIEYLSNVLSALSMPVPPVLATFH  310
             D++Y  NVL+AL + VP  L T+ 
Sbjct  667  ADLDYFCNVLAALGVAVPLQLVTWQ  691



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TLPQ LE
Sbjct  591  FDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTLPQHLE  650

Query  546  P------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P            L  G        +  ++ A  W+  +A G   LY +Q+  IQ +++ 
Sbjct  651  PFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQELSNH  710

Query  402  GAQQLSVDIEYLSNVLSALSM  340
              +QL  DI+YL NVL  L +
Sbjct  711  AVKQLITDIDYLCNVLDDLGL  731



>ref|XP_797564.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=348

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 82/165 (50%), Gaps = 14/165 (8%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
             + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQLE 
Sbjct  163  AFGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQLET  222

Query  543  LAEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQYITD  406
                 + +   A EA               + A  W+  VA     +YV+ +  I  +T 
Sbjct  223  CTSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINGLTQ  282

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  271
            + A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  283  QAARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  327



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TLPQ LE
Sbjct  571  FDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTLPQHLE  630

Query  546  P------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P            L  G        +  ++ A  W+  +A G   LY +Q+  IQ +++ 
Sbjct  631  PFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQELSNH  690

Query  402  GAQQLSVDIEYLSNVLSALSM  340
              +QL  DI+YL NVL  L +
Sbjct  691  AVKQLITDIDYLCNVLDDLGL  711



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 98/215 (46%), Gaps = 49/215 (23%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            V++ +I+ +R    DL RLP W   S  E +   P         SY+T + E+LL +PQQ
Sbjct  578  VFETMINFIRLKLKDLPRLPEWKQQSGTESYQTNPSQV------SYITQIAEHLLNIPQQ  631

Query  552  LEPLAE----------GISNSDANADEAQYF----------------------------A  487
            L+P +E           +S   AN D  Q                              A
Sbjct  632  LDPYSEEELIRFSYRIALSQPIANDDFYQNLVRQLYKSEQTTSAATISEDEEEEEEDGIA  691

Query  486  TEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHS  307
             +WM  VA+    LY+  +  I  +TD G QQL+ DI YL N+LSA+ +P  P+L+    
Sbjct  692  HQWMSLVAKATEKLYLQSIVEISTLTDSGCQQLANDISYLFNILSAIGVPHDPLLSLTQQ  751

Query  306  CLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
             +S P+ +  E + +   ++ ++  +NL+ KMR +
Sbjct  752  LISIPKDKYLESIANYESSEKNI--SNLISKMRGI  784



>ref|XP_011402672.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Amphimedon queenslandica]
Length=553

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 83/165 (50%), Gaps = 21/165 (13%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS-----VEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  562
            +DV+ S+++Q   ++ +L +WS      +E   A    LP+FS  P +Y+T +G++LLTL
Sbjct  362  FDVVFSQLKQKLIEIPKLKVWSRSTSSPLESPQALTDDLPSFSLSPLTYITEIGDHLLTL  421

Query  561  PQQLEP--------LAEGISNS------DANADEAQYFATEWMFKVAEGATALYVDQLRG  424
            P+QLEP        LA  + +       D   +     +  W+  +A G    YV+ +  
Sbjct  422  PEQLEPFTSQDNPSLAAAMKHGRLPFTEDDGENRDLSLSDMWLDAIARGTMETYVESILK  481

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPR  289
            I  +TD  A QLS DI YL NVL+AL  P  P L      L + +
Sbjct  482  IPRLTDAAALQLSTDIGYLCNVLAALDQPPIPALTALEKLLKSDK  526



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 14/164 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPL  541
            + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQLE  
Sbjct  578  FGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQLETC  637

Query  540  AEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQYITDR  403
                + +   A EA               + A  W+  VA     +YV+ +  I  +T +
Sbjct  638  TSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINELTQQ  697

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  271
             A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  698  AARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  741



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 14/154 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSARP--LPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            ++++ S+++ + N +S + IW+S     A    LPTFS  PQ Y+T VG+YL+TLPQ L+
Sbjct  567  FEIVFSQLKTYLNGVSIMEIWTSQSAGGAMTSDLPTFSLSPQEYITKVGQYLMTLPQHLD  626

Query  546  P------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P            L  G      + +  ++ A  W+  VA G    Y +++  I Y T  
Sbjct  627  PFTLQESPALITALKHGRLPYTNHQELPEHLADIWLESVAMGTMHTYTEEILKIPYATPH  686

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  301
            G +QL  DI+YL NVL  L +     +    + L
Sbjct  687  GCKQLITDIDYLCNVLEDLGLKASETMTHIQTLL  720



>ref|XP_001844946.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS38841.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=727

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 12/155 (8%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            +   ++  + +HFN +     +S+ +E     LP +S  PQ Y+T +G+YLLTLPQ LEP
Sbjct  552  IMKFILYAIEKHFNGMR----FSANKEGEGFNLPDYSYAPQEYITQIGQYLLTLPQHLEP  607

Query  543  LAE--------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  388
            L           + + D    + ++ A   +  + E  TA Y + +  IQ +T  G++QL
Sbjct  608  LLLSPSPSLKFALQSCDDAYSKDKFCADVLLALIVEETTAFYQESIDNIQSLTAAGSKQL  667

Query  387  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  283
            +VDIEY  NVL  +S+P    L      L TP  Q
Sbjct  668  AVDIEYFGNVLEEMSLPFNATLQQTVVLLRTPLEQ  702



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 77/141 (55%), Gaps = 14/141 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            ++++ ++++++ +++S + IW+S     A    LP+FS  PQ Y+T +G+YL+T+PQ LE
Sbjct  554  FEIVFAQLKKYLSNISNMEIWTSKRAEGALTSDLPSFSLSPQEYITKIGQYLMTIPQHLE  613

Query  546  P------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P            L  G      + D  ++ A  W+  VA+G   +Y +++  I  ++  
Sbjct  614  PFMLHDNPTLTTALKYGKLPYIDDQDLPEHLADLWLESVAKGTMHIYCEEILKIINLSPH  673

Query  402  GAQQLSVDIEYLSNVLSALSM  340
              +QL  DIEYL NVL  L +
Sbjct  674  ATKQLITDIEYLLNVLDDLGL  694



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 78/157 (50%), Gaps = 14/157 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D + ++V+ HFN +  L +W+      A  R LP FS  P  Y+T +G+YLLT+PQ +E
Sbjct  567  FDTVFAEVQSHFNTVPSLKVWALENPGGAIARDLPAFSISPLEYITQIGQYLLTIPQHIE  626

Query  546  P--------LAEGISNSD----ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P        LA  +  S+      +    + A   +  VA+     Y+D +  I  +T +
Sbjct  627  PFIVEENEALAMALKYSNLPHVIESTSTDHVADYLLGCVAQATMYTYLDTVMQIDRLTQQ  686

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
             + QL+ DI YL NVL  L +P+   L    + L +P
Sbjct  687  ASAQLATDIGYLCNVLDDLGLPLLENLQQLAALLKSP  723



>ref|XP_004206189.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Hydra vulgaris]
Length=216

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 83/167 (50%), Gaps = 12/167 (7%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            +D++  + +   + +S + +W + E+ +A   LP FS  PQSY+T +G+ LLTLPQQLE 
Sbjct  35   FDLIFYQFKCLLDGVSSMEVWRTEEKEAAGGDLPKFSLSPQSYITQIGDSLLTLPQQLEG  94

Query  543  ----------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQ  394
                      ++  +        E  +    W+  +A  A+A YV+ +  I Y+T  G +
Sbjct  95   YFNEQNVSLIVSLKVGRLPFQETEGAHLDHCWLESLARSASANYVEAIIKIPYLTAYGTR  154

Query  393  QLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSG  253
            QL  DI+Y   +L AL + V   L T    +    S   E V +++G
Sbjct  155  QLLADIDYYLKILGALEVNVNEKLLTIQKLMIADPSSFNE-VAAETG  200



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 70/142 (49%), Gaps = 15/142 (11%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +DV+ + ++Q    L    IW S  +  A    LP F   PQ Y+T +G+YL+TLPQQLE
Sbjct  569  FDVVFAPLQQLLMSLPDFEIWQSESQAGAITTNLPAFGLTPQEYITKIGQYLMTLPQQLE  628

Query  546  PLAEG-------------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  406
            P  +              + ++    D  +  A  W+  VA G+  LY +Q+  I  ++ 
Sbjct  629  PFTQEDNPALCVALKHGRLPHTLDQTDMPEQLADLWLESVANGSMRLYAEQILNIPKLST  688

Query  405  RGAQQLSVDIEYLSNVLSALSM  340
               QQL +DI+Y  NV+  L +
Sbjct  689  LATQQLLIDIDYFCNVMDDLGL  710



>emb|CDS12214.1| hypothetical protein LRAMOSA04409 [Absidia idahoensis var. thermophila]
Length=892

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 86/192 (45%), Gaps = 50/192 (26%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRL-PIWSSVEEHSARP----------LPTFSAYPQSYVTNVGE  577
            ++  ++  + +H + +  L  +W++ E  S R           +P FS  P +Y+T +GE
Sbjct  700  LHKAILGPIIRHLDTIPTLRSVWTAPEPPSRRKNVQDATIHVDMPQFSLSPNAYITRIGE  759

Query  576  YLLTLPQQLEPLAEG------------ISNSDANA---DEAQYFATE-------------  481
             LL LPQ+ E  A+             I  SD +A   +E    A+E             
Sbjct  760  KLLMLPQEFEVYADDSSLRYHIESAPFIEKSDLSAHDEEEDTIDASEEHQQQPLDNEEEE  819

Query  480  -----------WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  334
                       W   +A G  A ++D++R IQ  T +G +QL  DIEYL NVLSAL +  
Sbjct  820  EEEEGSDVIQLWTTSIARGTMARFLDEIRKIQKTTPQGQRQLRTDIEYLVNVLSALDVQP  879

Query  333  PPVLATFHSCLS  298
             P L  FHS LS
Sbjct  880  LPDLVEFHSTLS  891



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 78/148 (53%), Gaps = 15/148 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  578  YEVIFAPIFTQLLLVQKAPAWSTETNKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  637

Query  549  EP--LAEGIS-NSDANADEAQYF--ATEWMFK------VAEGATALYVDQLRGI-QYITD  406
            EP  L E  S N    A + QY    TE  F       +A+G   +++DQ  GI Q+++ 
Sbjct  638  EPFLLRENPSLNQALKAADPQYAQGTTESGFTGILLDIIAKGTCQMFLDQTLGICQFLSS  697

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVL  322
               +QL+ DI+YL NVL  L + +   L
Sbjct  698  AACKQLATDIDYLGNVLEELGLSLSENL  725



>dbj|GAM17697.1| hypothetical protein SAMD00019534_008720 [Acytostelium subglobosum 
LB1]
Length=735

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  519  DANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  340
            D N DE    A +WM  VA     LY+  +  I  +++ G QQLS DI YL NVLSAL +
Sbjct  626  DENIDEMDGIAHQWMTLVASATEKLYLQSIVEISMLSEFGCQQLSNDIGYLFNVLSALGV  685

Query  339  PVPPVLATFHSCLSTPRSQLKELVKS--DSGNQLDLPTANLVCKMRRVSL  196
               P+L+     +STP+ +  E++ +   S N  +   ANL+ KMR + L
Sbjct  686  SADPLLSRTQQLVSTPKERYAEIISNIMKSDNNAEKNIANLIAKMRGIKL  735



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 22/152 (14%)
 Frame = -1

Query  678  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA----------  538
            L  + +WS+   V + S   LPTF + P SY+T +G+YLL LPQQLEP A          
Sbjct  539  LKSVKVWSAEKEVSDVSNEDLPTFIS-PSSYITQIGDYLLNLPQQLEPFATQNNPSLEMA  597

Query  537  --EG------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  382
              EG       S+++  +         W+  VA G    YV+ +  I  +TD  A+QL  
Sbjct  598  LKEGKLPYPDTSDNEDTSLNVNDTTIYWLGAVARGTVLTYVENIMKIPTLTDHAARQLIE  657

Query  381  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRS  286
            DIEYL N+L AL +     L      L +P S
Sbjct  658  DIEYLFNILEALEISPGIKLKQIVLLLKSPSS  689



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  513  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  571

Query  552  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  572  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  631

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  301
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  632  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  666



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  565  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  623

Query  552  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  624  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  683

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  301
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  684  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  718



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  551  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  609

Query  552  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  610  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  669

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  301
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  670  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  704



>ref|XP_004535745.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Ceratitis capitata]
Length=751

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 76/151 (50%), Gaps = 22/151 (15%)
 Frame = -1

Query  627  LPTFSAYPQSYVTNVGEYLLTLPQQLEP--------LAEGISNSDANADEAQYFATEWMF  472
            +P FS  PQ  +T +G+YLLTLPQ LEP        L + +   +A   ++   A   + 
Sbjct  603  MPEFSFVPQESITQIGQYLLTLPQHLEPLLFTPSALLKQALEICNAKYTQSIPCADILLS  662

Query  471  KVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
             V E    LY  Q+  ++ +    ++Q +VDIEYLSNVL  L + +           ST 
Sbjct  663  LVVEQCCQLYQSQILQVKVMPVSSSKQFAVDIEYLSNVLEELGLNI-----------STS  711

Query  291  RSQLKELVKSDSGNQLDLPTANLVCKMRRVS  199
             SQ+  L+K+DSGN L L      C+ R V+
Sbjct  712  LSQILVLLKADSGNYLALSVG---CEPRLVT  739



>ref|XP_005825555.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
 gb|EKX38575.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
Length=842

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 74/140 (53%), Gaps = 15/140 (11%)
 Frame = -1

Query  717  DVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA  538
            D  +S VR+   ++++L +W   E      LP+FS+ P  +VTN+ E+L +LP+QL+P A
Sbjct  657  DTALSFVRRQLINVAKLQVWG--ENKKKGHLPSFSSSPLPHVTNIAEHLFSLPEQLDPAA  714

Query  537  EG---ISNSDA-------NADEA---QYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  397
                  S S A       N DE      F  +W+ ++     +LYV+++  I  ++  G 
Sbjct  715  HDEVPCSTSAALQLTQPQNVDEGSSEHKFMQKWLSRITGEVVSLYVEKILEIPALSPSGR  774

Query  396  QQLSVDIEYLSNVLSALSMP  337
             QL  DI+Y+S++L  L  P
Sbjct  775  VQLGTDIQYISSILDTLGAP  794



>ref|XP_006682175.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77069.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
Length=846

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 81/180 (45%), Gaps = 18/180 (10%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSA-----RPLPTFSAYPQSYVTNVGEYLLTLP  559
            V+  L+ ++ +  + +  L  W+S   ++        LP FS  P +Y+TN+GE LL LP
Sbjct  648  VFQCLLQRMTREMDGMFALSCWTSQYTNTVAGSFDTQLPEFSLLPLAYMTNIGEQLLALP  707

Query  558  QQLEPLAE------------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQY  415
              L+  A             G+   D    E+      W+  ++    +  +DQ++ I  
Sbjct  708  LHLDTFAGEQSLQYSLATLPGVECIDLEDQESIDVTHVWILSMSRAIESRLMDQVKRIPT  767

Query  414  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQL-KELVKSDSGNQLDL  238
            ++ RG +QL+ DI YLSNV SA+ +     L     CL      L K + + D+    D+
Sbjct  768  LSSRGCRQLATDINYLSNVFSAMEIEPHMTLQVMIQCLECNEQDLEKRMTEQDTAENSDI  827



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 92/189 (49%), Gaps = 19/189 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  598  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  657

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  658  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  717

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  223
              +QL+ DI+YL NVL  L + +   L      L  P    +   KS SG    +  A  
Sbjct  718  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPPEDYQ---KSSSGCNARVVAA--  772

Query  222  VCKMRRVSL  196
            V +MR ++ 
Sbjct  773  VRQMRNITF  781



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 93/189 (49%), Gaps = 19/189 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  610  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  669

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  223
              +QL+ DI+YL NVL  L + +   L      L  P    ++  KS SG    +  A  
Sbjct  670  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPP---EDYHKSSSGCNARVVAA--  724

Query  222  VCKMRRVSL  196
            V +MR ++ 
Sbjct  725  VRQMRNITF  733



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 80/174 (46%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W+  SV E  A  LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNAVSVGEPLAEDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  700  IPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 75/170 (44%), Gaps = 18/170 (11%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++   + + R+  WSS    E     LPTFS  P  Y+TN+G+Y+++LP  LE
Sbjct  541  FDAVFLQIKHQLSLVHRMESWSSSGTGETLTEDLPTFSLSPLEYITNIGQYIMSLPLHLE  600

Query  546  PL-------------AEGISNSDANAD---EAQYFATEWMFKVAEGATALYVDQLRGIQY  415
            P              A  +      AD   E    A  W+  +A      Y D +  I  
Sbjct  601  PFVTQEDPALELALHAGKLPFPPEQADDLPELDNIADYWLGSIARATMQTYCDAILQIPE  660

Query  414  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  265
            +T   A+QL+ DI+YLSNV+ AL +     L    + L       ++  K
Sbjct  661  LTPHSAKQLATDIDYLSNVMDALGLQASRTLQQIVTLLKAKPEDFRQTAK  710



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  520  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  579

Query  549  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  580  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  639

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  640  ACKQLATDIDYLGNVLEELGLCLSENL  666



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  549  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  669

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  670  ACKQLATDIDYLGNVLEELGLCLSENL  696



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  595  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  653

Query  552  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  654  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  713

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  714  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  751



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  608

Query  552  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  609  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  668

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  669  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 77/163 (47%), Gaps = 24/163 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E  A  LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWSTAGIGETLADDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  295
            I  +T    +QL+ DI+YL+NV+ AL +    +L    + L T
Sbjct  700  IPELTPHSTKQLTTDIDYLTNVMDALGLQPSRLLQNIVTLLKT  742



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 66/131 (50%), Gaps = 16/131 (12%)
 Frame = -1

Query  666  PIWSSVEEHSAR---PLPTFSAYPQSYVTNVGEYLLTLPQQLEP----------LAEGIS  526
            P WS+  + +A     LP FS  PQ Y+T +G+YL+TLPQ LEP          LA  ++
Sbjct  573  PAWSNANKQAATVAADLPDFSFAPQEYITQIGQYLMTLPQHLEPFLLQDNPSLTLALQVA  632

Query  525  NSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
            + +    +A+    FA   +  +A G    Y D + GI  +     +QL+ DI+YL NVL
Sbjct  633  DVEYGLLSAEAEGGFAGVLLGIIARGTCQTYCDNILGICELGSSSCKQLATDIDYLGNVL  692

Query  354  SALSMPVPPVL  322
              L + +   L
Sbjct  693  EDLGLSLSEHL  703



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (48%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS  SV E     LPTFS  P  Y++N+G+YL++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWSTASVGETLTDDLPTFSLTPLEYISNIGQYLMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGAIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_001652664.1| AAEL007307-PA [Aedes aegypti]
 gb|EAT41036.1| AAEL007307-PA [Aedes aegypti]
Length=708

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 9/133 (7%)
 Frame = -1

Query  654  SVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG--------ISNSDANADE  502
            ++++HS    LP +S  PQ YVT +G+YLLTLPQ LEPL           +   +     
Sbjct  551  TIKQHSENYDLPDYSYAPQEYVTQIGQYLLTLPQHLEPLLLSPSPALKFIMEFCEDKYKG  610

Query  501  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  322
             +  A   +F + E  TA+Y +++  I  ++   A+QL+ DIEY  NVL  +S+ +   L
Sbjct  611  EKACADVLLFLIVEETTAMYQEKIDEILSLSASSAKQLATDIEYFGNVLEEMSLTLSTNL  670

Query  321  ATFHSCLSTPRSQ  283
                  L  P  Q
Sbjct  671  QQIIVLLRAPLDQ  683



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 24/163 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  544  FDSIFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  603

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  604  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLVSIARATMQTYCDVILQ  660

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  295
            I  +T    +QL+ DI+YL+NV+ AL +     L    + L T
Sbjct  661  IPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLHNIVTLLKT  703



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (48%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++     +S++ I   S + E+    LPTFS  PQ Y+TN+G+YL++LP  LE
Sbjct  582  FDSVFLQIKHQLGLVSKMEIQEASGIGENFTEDLPTFSLSPQEYITNIGQYLMSLPLHLE  641

Query  546  PLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVDQLRG  424
            P    ++  D   + A +                    A  W+  +A      Y D +  
Sbjct  642  PF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILL  698

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  699  IPQLTPHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (48%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q  + +SR+  WSS  + E     LPTFS  P  Y+TN+G+Y+++LP  LE
Sbjct  582  FDSVFLRIKQQLSLVSRMESWSSGGMGETLTDDLPTFSLTPLEYITNIGQYIMSLPLHLE  641

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D   +                   E    A  W+  +A      Y + +  
Sbjct  642  PF---VTQEDPALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEIILQ  698

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  699  IPELTMHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_010985221.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camelus dromedarius]
Length=705

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (44%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  518  FDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  577

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D L  
Sbjct  578  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQ  634

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  635  IPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  689

Query  243  DLPTANLVCKMRRV  202
                A+ V  MR V
Sbjct  690  PRRLASTVAAMRSV  703



>gb|EPY74529.1| conserved oligomeric Golgi complex subunit 7-like protein [Camelus 
ferus]
Length=800

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (44%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  613  FDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  672

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D L  
Sbjct  673  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQ  729

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  730  IPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  784

Query  243  DLPTANLVCKMRRV  202
                A+ V  MR V
Sbjct  785  PRRLASTVATMRSV  798



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (44%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D L  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  700  IPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  754

Query  243  DLPTANLVCKMRRV  202
                A+ V  MR V
Sbjct  755  PRRLASTVAAMRSV  768



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (44%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D L  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDALLQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  700  IPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  754

Query  243  DLPTANLVCKMRRV  202
                A+ V  MR V
Sbjct  755  PRRLASTVATMRSV  768



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  549  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  608

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  609  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  668

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  669  ACKQLATDIDYLGNVLEELGLSLSENL  695



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  512  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  571

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  572  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  631

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  632  ACKQLATDIDYLGNVLEELGLSLSENL  658



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 22/125 (18%)
 Frame = -1

Query  657  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  493
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   D A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALDMALHAGKLP  661

Query  492  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
                           A  W+  +A      Y D +  I +++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPHLSPHSTKQLATDIEYLSNVM  721

Query  354  SALSM  340
             AL +
Sbjct  722  DALGL  726



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  575  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  634

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  635  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  694

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  695  ACKQLATDIDYLGNVLEELGLSLSENL  721



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  548  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  607

Query  549  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  403
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  608  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  667

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  668  ACKQLATDIDYLGNVLEELGLCLSENL  694



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 79/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  700  IPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 79/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  700  IPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_007571518.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=224

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -1

Query  657  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  493
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  60   SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  116

Query  492  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  117  FPPDQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  176

Query  354  SALSM  340
             AL +
Sbjct  177  DALGL  181



>gb|ENN72949.1| hypothetical protein YQE_10420, partial [Dendroctonus ponderosae]
Length=247

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 73/160 (46%), Gaps = 14/160 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL LPQ LE
Sbjct  63   YQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLELPQHLE  122

Query  546  PL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P             + I    A+A D     A  ++ KVA G    + +++  I  ++  
Sbjct  123  PFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSISTLSQP  182

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  283
             ++QLS DI YL+N+L  L + +   L    + L  P  Q
Sbjct  183  ASRQLSHDINYLNNILQDLGITMSENLQQLLALLKIPPDQ  222



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISRMEGWSSGGIGETLTDDLPNFSLTPLEYISNIGQYIMSLPLHLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  VA      Y + +  
Sbjct  643  PF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSVARATMQTYCEVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  700  IPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 79/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  513  FDSVFLRIKQQLLLISKMEGWSSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLPLHLE  572

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y + +  
Sbjct  573  PF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQ  629

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     +++ KS
Sbjct  630  IPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQIAKS  683



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/211 (24%), Positives = 94/211 (45%), Gaps = 43/211 (20%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  544
            +Y+ +I+ ++  F ++ ++  W    + +   + ++ +   +Y T + ++LLT+PQQL+P
Sbjct  656  IYETMITFIKLKFKEVPKMNEW----KQNLNIVDSYQSNQSAYSTQIADHLLTIPQQLDP  711

Query  543  LAE-------------------------------------GISNSDANADEAQYFATEWM  475
             +E                                      IS++    D+    A +W+
Sbjct  712  YSEEISLRFSYQIAISYPTNDEMYQNIIKQLHQTMLNETKDISDTSDIEDDMVGIAHQWI  771

Query  474  FKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  295
              VA     LY+  +  I  +TD G   L+ DI YL NVLSAL +   P+L+     +  
Sbjct  772  HIVACATEKLYLQSIVEITSLTDYGCHHLANDITYLFNVLSALGVAPDPLLSKTQLLVQI  831

Query  294  PRSQLKELVKSDSGNQLDLPTANLVCKMRRV  202
            P+    E ++S  G + ++  A L+ KMR +
Sbjct  832  PKEAYLESIQSLEGGEKNI--AILISKMRSI  860



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 78/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISRMEGWSSAGIGETLTDDLPNFSLTPLEYISNIGQYIMSLPLHLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y + +  
Sbjct  643  PF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  700  IPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + R+  W++  + E     LPTFS  P  Y++N+G+YL++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVCRMDSWTTAGIGETLTDDLPTFSLTPLEYISNIGQYLMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_009194445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Papio 
anubis]
Length=781

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 71/148 (48%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++ IW++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  594  FDSVFLRIKQQLLLISKMDIWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  653

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  654  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQ  710

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  711  IPELSPHSAKQLATDIDYLINVMDALGL  738



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS   +   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFSQLLLVQKAPAWSLDANKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  549  EP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP        L + +  +D   A       F    +  VA G   ++ DQ  GI  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYAQGLTESGFTGILLDIVARGTCQMFQDQTLGICQLNSV  669

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  670  ACKQLATDIDYLGNVLEELGLCLSENL  696



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPGLTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS   +   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  562  YEVIFAPIFSQLLLVQKAPAWSLDANKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  621

Query  549  EP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP        L + +  +D   A       F    +  VA G   ++ DQ  GI  +   
Sbjct  622  EPFLLRDNPSLTQALKAADPQYAQGLTESGFTGILLDIVARGTCQMFQDQTLGICQLNSV  681

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  682  ACKQLATDIDYLGNVLEELGLCLSENL  708



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 63/133 (47%), Gaps = 26/133 (20%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSSVEEH----SARPLPTFSAYPQSYVTNVGEYLLTLPQ  556
            V+DVL+++V      L  LP W          +A PLPTF+ YP  YVT +G++L+ +PQ
Sbjct  660  VFDVLLARVASLLAPLPSLPEWRKAAGADPGTAAAPLPTFNTYPLPYVTAIGDHLMAMPQ  719

Query  555  QLEPL--------AEGISNSDANADEA--------------QYFATEWMFKVAEGATALY  442
            QLE L        A G++   A A  A              +  A EW+ K   GA  +Y
Sbjct  720  QLEVLMGDTADEAASGVTIGTAAAVSADGSGAGSGDPTAEWEELAAEWLDKAVSGAAGMY  779

Query  441  VDQLRGIQYITDR  403
             D +  I  +T++
Sbjct  780  ADTIFKIPTLTEQ  792



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 63/140 (45%), Gaps = 22/140 (16%)
 Frame = -1

Query  627  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSD-------------------ANAD  505
            LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D                    +  
Sbjct  391  LPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHTGKLPYPPEQGDDVP  447

Query  504  EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPV  325
            E +  A  W+  +A      Y D +  IQ +     +QL+ DI+YLSNV+ AL +     
Sbjct  448  ELENTADYWLGSIARATMQTYCDVILQIQELNPHSTKQLATDIDYLSNVMDALGLQTSRT  507

Query  324  LATFHSCLSTPRSQLKELVK  265
            L    + L     + ++  K
Sbjct  508  LQNITTLLRAKPEEFRQTAK  527



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 76/157 (48%), Gaps = 14/157 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  549  EP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGICQLNSV  669

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
              +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  670  ACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 73/160 (46%), Gaps = 14/160 (9%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL LPQ LE
Sbjct  479  YQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLELPQHLE  538

Query  546  PL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            P             + I    A+A D     A  ++ KVA G    + +++  I  ++  
Sbjct  539  PFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSISTLSQP  598

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  283
             ++QLS DI YL+NVL  L + +   L    + L  P  Q
Sbjct  599  ASRQLSHDINYLNNVLQDLGITMSENLQQLLALLKIPPDQ  638



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 14/158 (9%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  553
             Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  678  TYEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQH  737

Query  552  LEP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITD  406
            LEP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI  +  
Sbjct  738  LEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGICQLNS  797

Query  405  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  292
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  798  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  835



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -1

Query  657  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD---------  505
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   +         
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALELALHAGKLP  661

Query  504  ----------EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
                      E    A  W+  +A      Y D +  I +++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPHLSPHSTKQLATDIEYLSNVM  721

Query  354  SALSM  340
             AL +
Sbjct  722  DALGL  726



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 22/121 (18%)
 Frame = -1

Query  645  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY---------  493
            E+    LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +         
Sbjct  609  ENYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLPFPPE  665

Query  492  ----------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  343
                       A  W+  +A      Y D +  I  ++ R  +QL+ DI+YLSNV+ AL 
Sbjct  666  QGDDLPELDNVADYWLGSIARATMQTYCDAILLIPQLSTRSTKQLATDIDYLSNVMDALG  725

Query  342  M  340
            +
Sbjct  726  L  726



>ref|XP_002293816.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88825.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=162

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = -1

Query  621  TFSAYPQSYVTNVGEYLLTLPQQLEPLAE-----GISNSDANADE--AQYFATEWMFKVA  463
            ++   PQS++T+VGE++L L Q LEP A      G++N D + +   +  F  +W+  V 
Sbjct  5    SYGILPQSFITHVGEHMLALVQALEPFASDSEALGLANEDGDVESKASTAFCNQWLDVVG  64

Query  462  EGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  328
               T   +++   I  +  +GA+ L+ D+ Y+ NV +AL +   P
Sbjct  65   LAVTGRILERTMRIPRLGRKGAEHLAADLNYIRNVFTALGVAGHP  109



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 86/195 (44%), Gaps = 29/195 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  582  FDSVFLRIKQQLLLISKMESWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  641

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  642  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCDVILQ  698

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  699  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNMVTLLKTKPEDYRQVAKG-----L  753

Query  243  DLPTANLVCKMRRVS  199
                A+ V  MR V+
Sbjct  754  PRRLASKVASMRNVN  768



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 78/173 (45%), Gaps = 24/173 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  265
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSK  752



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILH  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ D++YL NV+ AL +     L    + L T     +++ K      L
Sbjct  700  IPELTPHSTKQLATDMDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  754

Query  243  DLPTANLVCKMRRV  202
                A  V  MR V
Sbjct  755  PRRLATTVANMRNV  768



>ref|XP_008202373.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Nasonia vitripennis]
Length=749

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (49%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ L
Sbjct  564  YEVIFAPIFTQLLLVRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHL  623

Query  549  EP--LAEGIS-NSDANADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP  L +  S      A ++QY        F    +  VA+    ++ DQ  GI  +   
Sbjct  624  EPFLLRDNPSLTKTLKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAA  683

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL N+L  L + +   L
Sbjct  684  ACKQLATDIDYLGNILEELGLSLSENL  710



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = -1

Query  627  LPTFSAYPQSYVTNVGEYLLTLPQQLEPL----------AEGISNSDANADEAQY--FAT  484
            LP +S  PQ ++T +G+YL+TLPQ LEP           A  +++   N  E     F  
Sbjct  620  LPDYSFIPQEFITLIGQYLMTLPQHLEPFLLTDNPSLNYALKMADDKFNHLEGGSGGFTG  679

Query  483  EWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  340
              +  VA+ A  ++ DQ+ GI+ +  +G +QL+VDI+YL N+   L +
Sbjct  680  ILLGIVAKDACQMFFDQILGIRELDAKGCKQLAVDIDYLGNIFEELGL  727



>ref|XP_008202376.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Nasonia vitripennis]
Length=698

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ L
Sbjct  513  YEVIFAPIFTQLLLVRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHL  572

Query  549  EP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP  L +  S +    A ++QY        F    +  VA+    ++ DQ  GI  +   
Sbjct  573  EPFLLRDNPSLTKTLKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAA  632

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL N+L  L + +   L
Sbjct  633  ACKQLATDIDYLGNILEELGLSLSENL  659



>ref|XP_008202375.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Nasonia vitripennis]
Length=706

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (49%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ L
Sbjct  521  YEVIFAPIFTQLLLVRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHL  580

Query  549  EP--LAEGIS-NSDANADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP  L +  S      A ++QY        F    +  VA+    ++ DQ  GI  +   
Sbjct  581  EPFLLRDNPSLTKTLKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAA  640

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL N+L  L + +   L
Sbjct  641  ACKQLATDIDYLGNILEELGLSLSENL  667



>ref|XP_008202374.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Nasonia vitripennis]
Length=737

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSSVEEHSA---RPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS+    ++     LP FS  PQ Y+T VG+YL+TLPQ L
Sbjct  552  YEVIFAPIFTQLLLVRKAPAWSANANKTSTISSDLPDFSFAPQEYITQVGQYLMTLPQHL  611

Query  549  EP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP  L +  S +    A ++QY        F    +  VA+    ++ DQ  GI  +   
Sbjct  612  EPFLLRDNPSLTKTLKAADSQYSQESCESGFTNILLGIVAKETCQMFQDQTWGIYELNAA  671

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL N+L  L + +   L
Sbjct  672  ACKQLATDIDYLGNILEELGLSLSENL  698



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  574  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  633

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  634  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  690

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  691  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  745

Query  243  DLPTANLVCKMRRV  202
                A  V  MR V
Sbjct  746  PRRLATTVANMRNV  759



>ref|XP_010184345.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesitornis 
unicolor]
 gb|KFQ27417.1| Conserved oligomeric Golgi complex subunit 7 [Mesitornis unicolor]
Length=769

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 78/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D + ++++Q    +S++  W+S  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  582  FDSVFTRIKQQLLLVSKMEGWNSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLPLHLE  641

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y + +  
Sbjct  642  PF---VTQEDSALEVALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQ  698

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T   A+QL+ DI+YL NV+ AL +     L    + L       ++  KS
Sbjct  699  IPELTAHSAKQLATDIDYLINVMDALGLQPSRTLQNIVALLKAKPEDFRQTAKS  752



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+L+LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYILSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELSELDNMADSWLGSIARATMQTYCDAVLQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_002927171.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ailuropoda 
melanoleuca]
 gb|EFB18307.1| hypothetical protein PANDA_016927 [Ailuropoda melanoleuca]
Length=770

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 29/194 (15%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQL  244
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K      L
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG-----L  754

Query  243  DLPTANLVCKMRRV  202
                A  V  MR V
Sbjct  755  PRRLATTVAHMRNV  768



>gb|ELK37852.1| Conserved oligomeric Golgi complex subunit 7 [Myotis davidii]
Length=705

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP  LE
Sbjct  518  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLPLNLE  577

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  578  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  634

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  635  IPELTPHSTKQLATDIDYLVNVMDALGL  662



>ref|NP_001029061.1| conserved oligomeric Golgi complex subunit 7 [Rattus norvegicus]
 sp|Q3T1G7.1|COG7_RAT RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Rattus norvegicus]
 gb|AAI01932.1| Component of oligomeric golgi complex 7 [Rattus norvegicus]
 gb|EDM17578.1| component of oligomeric golgi complex 7 [Rattus norvegicus]
Length=770

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGEELPELDNMADNWLGSIARATMQTYCDGILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  700  IPAVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIATLLKAKPEEYRQVSKG  753



>gb|ERE78144.1| conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=1090

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720   YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
             +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  903   FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  962

Query  546   PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
             P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  963   PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  1019

Query  423   IQYITDRGAQQLSVDIEYLSNVLSALSM  340
             I  +T    +QL+ DI+YL NV+ AL +
Sbjct  1020  ISEVTPHSTKQLATDIDYLINVMDALGL  1047



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  ISEVTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_006753680.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
davidii]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP  LE
Sbjct  583  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLVNVMDALGL  727



>ref|XP_007105719.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Physeter 
catodon]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  VA      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSVARATMQTYCDAVLQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 24/173 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    ++++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  572  FDSVFLRIKQQLLLVTKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  631

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  632  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDIILQ  688

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  265
            I  +T    +QL+ DI+YL NV+ AL +     L +  + L T     ++  K
Sbjct  689  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQSIATLLKTKPGDFRQASK  741



>ref|XP_004900783.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Heterocephalus glaber]
 gb|EHB13186.1| Conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  700  IPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCDAVLQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDDLPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_004855999.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  700  IPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 22/121 (18%)
 Frame = -1

Query  645  EHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANAD-------------  505
            E  A  LPTFS  PQ Y+TN+G+Y+++LP  LEP    ++  D   +             
Sbjct  608  ESYAEDLPTFSLSPQEYITNIGQYIMSLPLHLEPF---VTQEDPALELALHAGKLPFPPE  664

Query  504  ------EAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALS  343
                  E    A  W+  +A      Y D +  I  +T    +QL+ DIEYLSNV+ AL 
Sbjct  665  QGDDLPELDNTADYWLGSIARATMQTYCDAILLIPELTAHSTKQLATDIEYLSNVMDALG  724

Query  342  M  340
            +
Sbjct  725  L  725



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -1

Query  657  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  493
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  661

Query  492  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  662  FPPDQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  721

Query  354  SALSM  340
             AL +
Sbjct  722  DALGL  726



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = -1

Query  657  SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQY-----  493
            S++ E     LPTFS  PQ Y+TN+G+YL++LP  LEP    ++  D   + A +     
Sbjct  605  SAIGESYTEDLPTFSLSPQEYITNIGQYLMSLPLHLEPF---VTQEDPALEMALHAGKLP  661

Query  492  --------------FATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVL  355
                           A  W+  +A      Y D +  I  ++    +QL+ DIEYLSNV+
Sbjct  662  FPPEQGDDLPELDNTADYWLGSIARATMQTYCDAILLIPRLSPHSTKQLATDIEYLSNVM  721

Query  354  SALSM  340
             AL +
Sbjct  722  DALGL  726



>gb|ABC86343.1| IP14069p [Drosophila melanogaster]
Length=271

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 10/116 (9%)
 Frame = -1

Query  651  VEEHSAR--PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA--------EGISNSDANADE  502
            V++H+A    +P+FS  PQ  +T +G+YLLTLPQ LEPL         + +   +    +
Sbjct  113  VQDHAASGIEMPSFSFAPQESITQIGQYLLTLPQHLEPLLLSPSSLLKQALEVCNIKYTQ  172

Query  501  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPV  334
            A   A   +  V E    LYV Q+  I+ +    A QLSVDIEYLSNVL  L + +
Sbjct  173  AIPCADVLLSLVVEQCCVLYVTQILQIKSLPSSAATQLSVDIEYLSNVLEELGLSI  228



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 69/147 (47%), Gaps = 14/147 (10%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
            Y+V+ + +      + + P WS   +   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFSQLLLVQKAPAWSLETNKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  549  EP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  403
            EP        L + +  +D   A       F    +  VA G   ++ DQ   I  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYAQGSTESGFTGILLDIVARGTCQMFQDQTLSICQLNSI  669

Query  402  GAQQLSVDIEYLSNVLSALSMPVPPVL  322
              +QL+ DI+YL NVL  L + +   L
Sbjct  670  ACKQLATDIDYLGNVLEELGLSLSENL  696



>gb|EPQ17692.1| Conserved oligomeric Golgi complex subunit 7 [Myotis brandtii]
Length=705

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 77/173 (45%), Gaps = 24/173 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  518  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLPLNLE  577

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  578  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  634

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  265
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K
Sbjct  635  IPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSK  687



>ref|XP_005882395.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
brandtii]
Length=757

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  570  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLPLNLE  629

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  630  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  686

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  687  IPELTPHSTKQLATDIDYLVNVMDALGL  714



>ref|XP_001510180.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ornithorhynchus 
anatinus]
Length=777

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 78/174 (45%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W+S  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  590  FDSVFLRIKQQLLLVSKMESWNSGGIGETLTEDLPTFSLTPLEYISNIGQYIMSLPLNLE  649

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y + +  
Sbjct  650  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCEVILQ  706

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T   + ++  K 
Sbjct  707  IPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEEYRQTAKG  760



>ref|XP_008150973.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Eptesicus 
fuscus]
Length=770

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  700  IPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  753



>ref|XP_004691773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Condylura 
cristata]
Length=770

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMERWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_003795773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
1 [Otolemur garnettii]
Length=772

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q  + +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  585  FDSVFLRIKQQLSLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLE  644

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  645  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  701

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  702  IPELTPHSTKQLATDIDYLINVMDALGL  729



>ref|XP_004778381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004819145.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
Length=770

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  700  IPELTPHSTKQLATDIDYLINVMDALGL  727



>gb|EDL17254.1| component of oligomeric golgi complex 7 [Mus musculus]
Length=823

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  636  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  695

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  696  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  752

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  753  IPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  806



>ref|XP_006085922.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Myotis lucifugus]
Length=950

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 24/149 (16%)
 Frame = -1

Query  723  VYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  550
             +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  L
Sbjct  762  AFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLPLNL  821

Query  549  EPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLR  427
            EP    ++  D+  +                   E    A  W+  +A      Y D + 
Sbjct  822  EPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVIL  878

Query  426  GIQYITDRGAQQLSVDIEYLSNVLSALSM  340
             I  +T    +QL+ DI+YL NV+ AL +
Sbjct  879  QIPELTPHSTKQLATDIDYLVNVMDALGL  907



>ref|XP_006085923.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Myotis lucifugus]
Length=949

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP  LE
Sbjct  762  FDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLPLNLE  821

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  822  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  878

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  879  IPELTPHSTKQLATDIDYLVNVMDALGL  906



>ref|XP_006912615.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
alecto]
Length=755

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    + ++  WS+  V E  A  LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  568  FDSVFLRIKQQLLLVPKMESWSTAGVGESLADGLPAFSLTPLEYISNIGQYIMSLPLNLE  627

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  628  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  684

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  685  IPTLTPHSTKQLATDIDYLINVMDALGL  712



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  700  IPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKAKPEEYRQISKG  753



>ref|XP_002431030.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB18292.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=731

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 16/122 (13%)
 Frame = -1

Query  639  SARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP----------LAEGISNS------DANA  508
            S   LP +S  PQ Y+T +G+YL+ +PQ L+P          LA  +  S      D+ A
Sbjct  578  STSDLPDYSFVPQEYITQIGQYLMNMPQLLDPFSLSKNLELALALSLVGSYYSELLDSTA  637

Query  507  DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPP  328
             +   FA  ++ ++++G    Y  Q+  IQ +++  ++QL+ DI YL NVL  +   +  
Sbjct  638  TDENSFAELFLSQISKGTCKAYAKQILAIQKLSNFASKQLATDINYLGNVLEDMGFNLTK  697

Query  327  VL  322
             L
Sbjct  698  KL  699



>sp|Q3UM29.1|COG7_MOUSE RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Mus musculus]
 dbj|BAE26269.1| unnamed protein product [Mus musculus]
Length=770

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  700  IPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|NP_001028490.2| conserved oligomeric Golgi complex subunit 7 [Mus musculus]
 dbj|BAE32768.1| unnamed protein product [Mus musculus]
Length=770

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (14%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  583  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  642

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  643  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  699

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  262
            I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  700  IPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|XP_005063464.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesocricetus 
auratus]
Length=715

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -1

Query  720  YDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  547
            +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP  LE
Sbjct  528  FDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLPLNLE  587

Query  546  PLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVDQLRG  424
            P    ++  D+  +                   E    A  W+  +A      Y D +  
Sbjct  588  PF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDVILQ  644

Query  423  IQYITDRGAQQLSVDIEYLSNVLSALSM  340
            I  +T    +QL+ DI+YL NV+ AL +
Sbjct  645  IPEVTPHSTKQLATDIDYLINVMDALGL  672



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440