BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030H23

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               244   5e-77   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          243   2e-76   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               241   9e-76   Nicotiana sylvestris
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               236   7e-75   
gb|KHG24129.1|  Reticulon-like protein B3                               232   2e-72   Gossypium arboreum [tree cotton]
ref|XP_002509881.1|  conserved hypothetical protein                     230   9e-72   Ricinus communis
emb|CDP12094.1|  unnamed protein product                                228   6e-71   Coffea canephora [robusta coffee]
gb|AFK41983.1|  unknown                                                 224   1e-69   Medicago truncatula
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               224   2e-69   Nicotiana tomentosiformis
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               223   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          223   5e-69   Solanum tuberosum [potatoes]
gb|ACJ84486.1|  unknown                                                 223   5e-69   Medicago truncatula
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               223   6e-69   Vitis vinifera
ref|NP_001239711.1|  uncharacterized protein LOC100811024               223   9e-69   Glycine max [soybeans]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             222   1e-68   Phaseolus vulgaris [French bean]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    221   2e-68   Sesamum indicum [beniseed]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               222   2e-68   Nicotiana sylvestris
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    221   2e-68   Glycine max [soybeans]
gb|ACU23452.1|  unknown                                                 221   2e-68   Glycine max [soybeans]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               221   4e-68   
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         220   1e-67   Jatropha curcas
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    219   2e-67   Nicotiana tomentosiformis
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               219   3e-67   Eucalyptus grandis [rose gum]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     219   4e-67   Eucalyptus grandis [rose gum]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               218   5e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    218   6e-67   Nicotiana sylvestris
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               218   7e-67   Nicotiana sylvestris
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     219   8e-67   Eucalyptus grandis [rose gum]
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               218   8e-67   Phoenix dactylifera
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               217   1e-66   Phoenix dactylifera
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               216   3e-66   Eucalyptus grandis [rose gum]
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               215   6e-66   Vitis vinifera
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          215   6e-66   Cicer arietinum [garbanzo]
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               215   9e-66   Elaeis guineensis
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    214   1e-65   
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               214   3e-65   Populus euphratica
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          214   3e-65   Citrus sinensis [apfelsine]
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             213   3e-65   Citrus clementina [clementine]
emb|CDP05124.1|  unnamed protein product                                213   3e-65   Coffea canephora [robusta coffee]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               213   4e-65   Solanum lycopersicum
gb|KJB52210.1|  hypothetical protein B456_008G250900                    213   4e-65   Gossypium raimondii
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               213   4e-65   Phoenix dactylifera
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               213   6e-65   Sesamum indicum [beniseed]
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               213   8e-65   Nicotiana tomentosiformis
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    212   1e-64   Solanum tuberosum [potatoes]
gb|KJB19087.1|  hypothetical protein B456_003G084400                    211   2e-64   Gossypium raimondii
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    212   2e-64   Nicotiana sylvestris
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               211   2e-64   Elaeis guineensis
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               211   3e-64   Elaeis guineensis
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               211   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        209   8e-64   Theobroma cacao [chocolate]
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                210   9e-64   Erythranthe guttata [common monkey flower]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               209   2e-63   Tarenaya hassleriana [spider flower]
gb|KHG09260.1|  Reticulon-like protein B3                               209   2e-63   Gossypium arboreum [tree cotton]
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          210   3e-63   Glycine max [soybeans]
ref|NP_001149653.1|  LOC100283279                                       208   5e-63   Zea mays [maize]
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                207   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_002299504.1|  reticulon family protein                           207   9e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             207   9e-63   Capsella rubella
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               207   1e-62   Cucumis melo [Oriental melon]
ref|XP_010092876.1|  Reticulon-like protein                             207   1e-62   Morus notabilis
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          206   2e-62   Solanum tuberosum [potatoes]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          206   2e-62   Setaria italica
gb|KHG15548.1|  Reticulon-like protein B3                               206   2e-62   Gossypium arboreum [tree cotton]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          206   2e-62   Solanum tuberosum [potatoes]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    211   2e-62   
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 206   3e-62   Elaeis guineensis
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               206   3e-62   Nicotiana sylvestris
ref|XP_002874678.1|  VIRB2-interacting protein 2                        206   6e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          205   7e-62   Cucumis sativus [cucumbers]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               205   8e-62   Tarenaya hassleriana [spider flower]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               205   9e-62   Solanum lycopersicum
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               205   9e-62   Prunus mume [ume]
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         204   1e-61   Jatropha curcas
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               205   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          204   1e-61   Oryza brachyantha
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               204   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               204   2e-61   Solanum lycopersicum
ref|NP_001042463.1|  Os01g0226300                                       201   3e-61   
gb|KHG04885.1|  Reticulon-like protein B5                               203   3e-61   Gossypium arboreum [tree cotton]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             203   4e-61   Citrus clementina [clementine]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   203   4e-61   Citrus sinensis [apfelsine]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               203   4e-61   Malus domestica [apple tree]
gb|EAY73097.1|  hypothetical protein OsI_00974                          203   5e-61   Oryza sativa Indica Group [Indian rice]
gb|KHG20258.1|  Reticulon-like protein B3                               202   6e-61   Gossypium arboreum [tree cotton]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               202   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               202   1e-60   
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               202   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               202   1e-60   Sesamum indicum [beniseed]
ref|NP_001150474.1|  seed maturation protein                            202   1e-60   
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               202   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               203   1e-60   Elaeis guineensis
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               201   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               202   1e-60   Brachypodium distachyon [annual false brome]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    201   1e-60   Gossypium raimondii
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             202   2e-60   Prunus persica
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               202   2e-60   Camelina sativa [gold-of-pleasure]
gb|KHN15986.1|  Reticulon-like protein B5                               201   2e-60   Glycine soja [wild soybean]
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               202   2e-60   Brassica rapa
ref|XP_002511930.1|  conserved hypothetical protein                     201   2e-60   Ricinus communis
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               201   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA52789.1|  TPA: seed maturation protein                           202   2e-60   
emb|CDP08746.1|  unnamed protein product                                201   2e-60   Coffea canephora [robusta coffee]
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               201   2e-60   Populus euphratica
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                201   2e-60   Erythranthe guttata [common monkey flower]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               201   2e-60   Glycine max [soybeans]
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               201   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               201   3e-60   Malus domestica [apple tree]
gb|KJB06451.1|  hypothetical protein B456_001G157900                    201   3e-60   Gossypium raimondii
gb|ABK23818.1|  unknown                                                 197   3e-60   Picea sitchensis
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          201   4e-60   Setaria italica
dbj|BAB32723.1|  unknown protein                                        201   4e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62606.1|  Reticulon-like protein B1                               200   5e-60   Triticum urartu
ref|NP_192861.1|  reticulon-like protein B2                             200   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|EMT18983.1|  Reticulon-like protein B1                               199   8e-60   
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               200   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               200   1e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               199   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               200   1e-59   
gb|KHG29253.1|  Reticulon-like protein B5                               199   1e-59   Gossypium arboreum [tree cotton]
gb|EAY75742.1|  hypothetical protein OsI_03655                          199   1e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_002303615.1|  reticulon family protein                           199   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007051689.1|  Reticulon family protein                           199   2e-59   
ref|NP_001056102.1|  Os05g0526400                                       198   2e-59   
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    198   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          199   2e-59   
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               198   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    199   3e-59   
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          198   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    198   4e-59   Arabis alpina [alpine rockcress]
ref|NP_001044177.1|  Os01g0736900                                       198   4e-59   
gb|ABR17571.1|  unknown                                                 198   5e-59   Picea sitchensis
gb|EMT19773.1|  Reticulon-like protein B1                               198   6e-59   
emb|CDJ26559.1|  unnamed protein product                                198   7e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          196   1e-58   Oryza brachyantha
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     193   2e-58   Eucalyptus grandis [rose gum]
dbj|BAJ89699.1|  predicted protein                                      196   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN40158.1|  unknown                                                 196   2e-58   Picea sitchensis
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               196   2e-58   Sesamum indicum [beniseed]
gb|ACF87936.1|  unknown                                                 194   2e-58   Zea mays [maize]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               196   2e-58   Prunus mume [ume]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             196   3e-58   
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             196   3e-58   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               195   3e-58   Brachypodium distachyon [annual false brome]
ref|NP_001130478.1|  Seed maturation protein                            194   6e-58   Zea mays [maize]
gb|KJB24288.1|  hypothetical protein B456_004G137000                    194   9e-58   Gossypium raimondii
dbj|BAH20346.1|  AT4G11220                                              190   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             194   1e-57   Prunus persica
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      194   2e-57   
gb|KJB24285.1|  hypothetical protein B456_004G137000                    193   2e-57   Gossypium raimondii
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    193   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      194   3e-57   
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               193   4e-57   Malus domestica [apple tree]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                192   5e-57   Erythranthe guttata [common monkey flower]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               192   5e-57   Eucalyptus grandis [rose gum]
ref|NP_194094.1|  VIRB2-interacting protein 1                           193   6e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EAY98759.1|  hypothetical protein OsI_20691                          192   8e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_002320163.1|  reticulon family protein                           191   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             194   1e-56   
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               191   1e-56   Pyrus x bretschneideri [bai li]
gb|ABK94480.1|  unknown                                                 191   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        192   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_002870630.1|  VIRB2-interacting protein 3                        191   2e-56   
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             191   3e-56   
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               191   3e-56   Brachypodium distachyon [annual false brome]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               190   3e-56   Populus euphratica
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               191   3e-56   Malus domestica [apple tree]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               191   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          190   5e-56   Cucumis sativus [cucumbers]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             190   6e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          189   7e-56   Oryza brachyantha
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    190   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               190   8e-56   Camelina sativa [gold-of-pleasure]
emb|CDY57657.1|  BnaC01g15350D                                          189   1e-55   Brassica napus [oilseed rape]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               188   1e-55   Fragaria vesca subsp. vesca
emb|CDX90792.1|  BnaA03g24720D                                          189   2e-55   
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               189   2e-55   Tarenaya hassleriana [spider flower]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         188   2e-55   Jatropha curcas
emb|CDY44123.1|  BnaA01g13310D                                          189   3e-55   Brassica napus [oilseed rape]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               188   3e-55   Brassica rapa
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               189   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             187   4e-55   Eutrema salsugineum [saltwater cress]
dbj|BAJ98297.1|  predicted protein                                      187   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             188   5e-55   Eutrema salsugineum [saltwater cress]
dbj|BAJ33905.1|  unnamed protein product                                188   5e-55   Eutrema halophilum
emb|CDY10954.1|  BnaA03g46130D                                          187   5e-55   Brassica napus [oilseed rape]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          187   6e-55   Setaria italica
ref|NP_198975.1|  reticulon-like protein B4                             187   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010112604.1|  Reticulon-like protein                             187   7e-55   Morus notabilis
emb|CDY25557.1|  BnaC09g11820D                                          186   1e-54   Brassica napus [oilseed rape]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               186   1e-54   Brassica rapa
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               186   2e-54   Fragaria vesca subsp. vesca
gb|AFK42059.1|  unknown                                                 186   2e-54   Lotus japonicus
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   185   2e-54   Citrus sinensis [apfelsine]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             186   2e-54   Capsella rubella
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   186   2e-54   Citrus sinensis [apfelsine]
emb|CDY05135.1|  BnaC03g29330D                                          187   2e-54   
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             186   3e-54   
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               186   3e-54   Pyrus x bretschneideri [bai li]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    185   3e-54   Arabis alpina [alpine rockcress]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               185   4e-54   
dbj|BAH57206.1|  AT1G64090                                              184   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KHN29299.1|  Reticulon-like protein B5                               184   4e-54   Glycine soja [wild soybean]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               185   5e-54   Camelina sativa [gold-of-pleasure]
emb|CDY41666.1|  BnaC03g62180D                                          185   5e-54   Brassica napus [oilseed rape]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    185   5e-54   Camelina sativa [gold-of-pleasure]
emb|CDY24806.1|  BnaA08g15040D                                          185   5e-54   Brassica napus [oilseed rape]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               184   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               185   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               184   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               184   5e-54   Camelina sativa [gold-of-pleasure]
ref|NP_176592.1|  reticulon-like protein B3                             184   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               184   6e-54   Pyrus x bretschneideri [bai li]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    185   6e-54   Gossypium raimondii
gb|EMS62854.1|  Reticulon-like protein B1                               184   7e-54   Triticum urartu
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               185   7e-54   Brassica rapa
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             184   7e-54   Citrus clementina [clementine]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               184   8e-54   Glycine max [soybeans]
gb|KHN40449.1|  Reticulon-like protein B5                               184   8e-54   Glycine soja [wild soybean]
gb|EMT25698.1|  Reticulon-like protein B2                               184   8e-54   
ref|NP_001185307.1|  reticulon-like protein B3                          184   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               184   1e-53   Malus domestica [apple tree]
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               184   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               184   1e-53   Pyrus x bretschneideri [bai li]
gb|ABK22748.1|  unknown                                                 183   2e-53   Picea sitchensis
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             183   2e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          183   2e-53   Oryza brachyantha
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               183   2e-53   Fragaria vesca subsp. vesca
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             183   2e-53   Capsella rubella
gb|ABB51093.1|  reticulon                                               181   3e-53   Hordeum vulgare [barley]
ref|XP_002887921.1|  reticulon family protein                           182   3e-53   Arabidopsis lyrata subsp. lyrata
emb|CDY34396.1|  BnaA09g11380D                                          182   3e-53   Brassica napus [oilseed rape]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               182   5e-53   Brassica rapa
ref|NP_001239653.1|  uncharacterized protein LOC100793862               182   5e-53   Glycine max [soybeans]
emb|CDM81762.1|  unnamed protein product                                182   7e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             182   7e-53   Phaseolus vulgaris [French bean]
ref|NP_001046501.1|  Os02g0265900                                       181   7e-53   
ref|NP_001057713.1|  Os06g0503400                                       182   7e-53   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          181   8e-53   Oryza brachyantha
dbj|BAJ94514.1|  predicted protein                                      181   1e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               181   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               181   1e-52   Camelina sativa [gold-of-pleasure]
emb|CDY52012.1|  BnaC06g42920D                                          181   1e-52   Brassica napus [oilseed rape]
emb|CDY38194.1|  BnaA09g11950D                                          181   1e-52   Brassica napus [oilseed rape]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               181   1e-52   Populus euphratica
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               181   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             181   1e-52   Phaseolus vulgaris [French bean]
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               181   1e-52   Prunus mume [ume]
gb|EMS50148.1|  Reticulon-like protein B2                               180   2e-52   Triticum urartu
gb|EAY85291.1|  hypothetical protein OsI_06662                          179   2e-52   Oryza sativa Indica Group [Indian rice]
emb|CDY42012.1|  BnaC04g00900D                                          180   2e-52   Brassica napus [oilseed rape]
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               180   2e-52   Brassica rapa
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               180   3e-52   Brassica rapa
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          180   3e-52   Sorghum bicolor [broomcorn]
gb|ACG36034.1|  reticulon                                               180   3e-52   Zea mays [maize]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    180   3e-52   Arabis alpina [alpine rockcress]
ref|XP_002880222.1|  reticulon family protein                           180   4e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             179   5e-52   Capsella rubella
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             179   6e-52   Populus trichocarpa [western balsam poplar]
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    178   8e-52   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    179   1e-51   Arabis alpina [alpine rockcress]
gb|ACG32549.1|  seed maturation protein                                 179   1e-51   Zea mays [maize]
gb|AFK34557.1|  unknown                                                 179   1e-51   Medicago truncatula
ref|NP_001130603.1|  uncharacterized protein LOC100191702               178   1e-51   Zea mays [maize]
ref|NP_566065.1|  reticulon-like protein B5                             179   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               177   4e-51   Brassica rapa
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          177   4e-51   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      177   4e-51   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               177   5e-51   Zea mays [maize]
emb|CDY08353.1|  BnaC09g12430D                                          177   5e-51   Brassica napus [oilseed rape]
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               177   7e-51   Cucumis melo [Oriental melon]
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               176   7e-51   Phoenix dactylifera
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             176   8e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               176   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          176   1e-50   Sorghum bicolor [broomcorn]
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               176   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               175   3e-50   Zea mays [maize]
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          175   3e-50   Cicer arietinum [garbanzo]
gb|EPS71452.1|  hypothetical protein M569_03311                         174   3e-50   Genlisea aurea
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          175   4e-50   
ref|XP_003592173.1|  Reticulon family protein                           174   5e-50   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               174   5e-50   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               174   7e-50   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          182   1e-49   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               173   2e-49   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             173   2e-49   
gb|EPS73616.1|  hypothetical protein M569_01145                         172   2e-49   
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               172   3e-49   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          172   4e-49   
gb|EMT06999.1|  Reticulon-like protein B1                               172   5e-49   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               172   5e-49   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               171   6e-49   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          171   7e-49   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               171   8e-49   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     169   2e-48   
ref|XP_002876621.1|  reticulon family protein                           170   2e-48   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          170   2e-48   
ref|NP_191715.2|  reticulon-like protein B6                             170   2e-48   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               170   2e-48   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             169   5e-48   
gb|KHN21799.1|  Reticulon-like protein B1                               168   6e-48   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               168   8e-48   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          168   1e-47   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          168   1e-47   
ref|XP_010105716.1|  Reticulon-like protein                             168   2e-47   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               167   2e-47   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               167   3e-47   
gb|KHN12926.1|  Reticulon-like protein B1                               167   4e-47   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          167   4e-47   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               165   1e-46   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               165   1e-46   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               164   3e-46   
gb|KJB52679.1|  hypothetical protein B456_008G272900                    164   3e-46   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    164   6e-46   
gb|ABK26525.1|  unknown                                                 164   6e-46   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               160   1e-44   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             159   2e-44   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          158   7e-44   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               158   1e-43   
gb|EPS64109.1|  hypothetical protein M569_10676                         157   2e-43   
gb|ABK94711.1|  unknown                                                 153   3e-43   
gb|KJB41425.1|  hypothetical protein B456_007G104000                    153   3e-43   
gb|EAY97489.1|  hypothetical protein OsI_19418                          156   3e-43   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               157   3e-43   
gb|KJB41424.1|  hypothetical protein B456_007G104000                    152   5e-43   
ref|NP_001055164.1|  Os05g0312500                                       155   9e-43   
gb|EEC80692.1|  hypothetical protein OsI_23118                          164   1e-42   
dbj|BAH20230.1|  AT4G23630                                              151   1e-42   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               155   1e-42   
ref|NP_001149072.1|  LOC100282693                                       154   2e-42   
gb|KJB41426.1|  hypothetical protein B456_007G104000                    152   3e-42   
dbj|BAK06264.1|  predicted protein                                      154   3e-42   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 154   3e-42   
gb|EPS69502.1|  hypothetical protein M569_05265                         153   4e-42   
gb|EMS49910.1|  Reticulon-like protein B3                               155   4e-42   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          153   5e-42   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               153   5e-42   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               152   1e-41   
ref|XP_004971481.1|  PREDICTED: reticulon-like protein B1-like          147   8e-41   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               148   1e-40   
ref|NP_001150935.1|  seed maturation protein                            150   1e-40   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               149   2e-40   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               149   3e-40   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    148   5e-40   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    148   6e-40   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               147   1e-39   
gb|ABK26009.1|  unknown                                                 147   1e-39   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               147   2e-39   
gb|EPS67049.1|  hypothetical protein M569_07727                         145   2e-39   
gb|EMS52545.1|  Reticulon-like protein B1                               146   3e-39   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    145   6e-39   
ref|XP_010921233.1|  PREDICTED: reticulon-like protein B1 isoform X2    144   7e-39   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                144   8e-39   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              144   2e-38   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    143   6e-38   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    142   6e-38   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          143   8e-38   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          141   3e-37   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         139   3e-37   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               140   4e-37   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          140   6e-37   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               139   8e-37   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          140   9e-37   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    139   2e-36   
emb|CDY13240.1|  BnaC09g24160D                                          136   2e-36   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               139   2e-36   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     139   4e-36   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    138   5e-36   
ref|XP_002521590.1|  conserved hypothetical protein                     137   5e-36   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    138   7e-36   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         137   8e-36   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               136   1e-35   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             136   2e-35   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               135   3e-35   
ref|XP_007048924.1|  Reticulon family protein                           135   4e-35   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             135   4e-35   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    135   5e-35   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               134   6e-35   
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          134   6e-35   
gb|EMT10142.1|  Reticulon-like protein B1                               135   7e-35   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               134   9e-35   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    134   1e-34   
ref|XP_002302126.2|  reticulon family protein                           134   1e-34   
ref|NP_192032.1|  reticulon-like protein B7                             134   1e-34   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    134   1e-34   
gb|ACJ84844.1|  unknown                                                 131   1e-34   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               134   1e-34   
ref|NP_566371.1|  reticulon-like protein B8                             134   2e-34   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          134   2e-34   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               134   2e-34   
ref|NP_850552.1|  reticulon-like protein B8                             134   3e-34   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             133   3e-34   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    133   4e-34   
ref|XP_002872901.1|  reticulon family protein                           132   4e-34   
emb|CDY07184.1|  BnaCnng01990D                                          132   4e-34   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    132   4e-34   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    132   5e-34   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             132   6e-34   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          132   7e-34   
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             132   9e-34   
gb|KDP35031.1|  hypothetical protein JCGZ_09319                         131   9e-34   
ref|NP_001051461.1|  Os03g0781700                                       132   1e-33   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               132   1e-33   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    131   1e-33   
emb|CDY41331.1|  BnaA01g31880D                                          131   1e-33   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    131   1e-33   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               131   2e-33   
gb|EAY92056.1|  hypothetical protein OsI_13754                          132   2e-33   
gb|EAY98925.1|  hypothetical protein OsI_20880                          130   2e-33   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               130   2e-33   
gb|ACF82336.1|  unknown                                                 125   3e-33   
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               130   3e-33   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    130   3e-33   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               130   4e-33   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          132   4e-33   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               129   4e-33   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                129   5e-33   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    130   5e-33   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          130   5e-33   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    130   5e-33   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    130   6e-33   
gb|KHG28741.1|  Reticulon-like protein B8                               130   6e-33   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               129   7e-33   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               129   7e-33   
gb|KHN11998.1|  Reticulon-like protein B8                               129   8e-33   
ref|XP_002306759.1|  reticulon family protein                           129   8e-33   
gb|ACN35543.1|  unknown                                                 124   9e-33   
ref|NP_001150885.1|  seed maturation protein                            129   9e-33   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               129   1e-32   
emb|CDY00916.1|  BnaC05g42840D                                          129   1e-32   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               129   1e-32   
tpg|DAA61174.1|  TPA: hypothetical protein ZEAMMB73_087528              126   1e-32   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               129   1e-32   
ref|XP_006855801.1|  hypothetical protein AMTR_s00044p00221140          128   2e-32   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               128   2e-32   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    128   2e-32   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   128   2e-32   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    128   3e-32   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               128   3e-32   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             127   3e-32   
gb|ACG31942.1|  seed maturation protein                                 127   4e-32   
gb|AFA36590.1|  putative 24 kDa seed maturation protein                 124   4e-32   
emb|CDY56712.1|  BnaC01g38700D                                          129   4e-32   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          126   5e-32   
emb|CDY66516.1|  BnaAnng22410D                                          125   6e-32   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               127   6e-32   
emb|CDY67571.1|  BnaCnng55510D                                          126   8e-32   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    126   9e-32   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          126   1e-31   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               125   1e-31   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    126   1e-31   
ref|XP_009112842.1|  PREDICTED: reticulon-like protein B9               125   1e-31   
emb|CDP18758.1|  unnamed protein product                                126   1e-31   
gb|ACG26944.1|  seed maturation protein                                 126   1e-31   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     125   1e-31   
ref|NP_001137021.1|  seed maturation protein isoform 1                  126   1e-31   
ref|XP_006396287.1|  hypothetical protein EUTSA_v10029354mg             125   1e-31   
tpg|DAA51729.1|  TPA: seed maturation protein                           126   1e-31   
gb|AAM64795.1|  unknown                                                 125   2e-31   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     125   2e-31   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               125   2e-31   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580          125   3e-31   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    125   3e-31   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    125   3e-31   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               125   4e-31   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               125   4e-31   
emb|CDP04019.1|  unnamed protein product                                125   4e-31   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    125   4e-31   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             124   4e-31   
ref|XP_006406630.1|  hypothetical protein EUTSA_v10021470mg             124   4e-31   
ref|XP_008374784.1|  PREDICTED: reticulon-like protein B9               124   7e-31   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    124   8e-31   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               123   1e-30   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    125   1e-30   
ref|NP_566604.1|  reticulon-like protein B9                             123   1e-30   
ref|XP_010456227.1|  PREDICTED: reticulon-like protein B7 isoform X2    123   1e-30   
ref|XP_006298494.1|  hypothetical protein CARUB_v10014570mg             123   1e-30   
ref|XP_010926506.1|  PREDICTED: reticulon-like protein B2               123   1e-30   
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1    123   1e-30   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               123   1e-30   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               123   1e-30   
ref|XP_010093192.1|  Reticulon-like protein                             123   1e-30   
ref|XP_010506654.1|  PREDICTED: reticulon-like protein B9 isoform X2    122   2e-30   
ref|XP_010506647.1|  PREDICTED: reticulon-like protein B9 isoform X1    122   2e-30   
gb|ABC69764.1|  unknown                                                 122   2e-30   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             122   2e-30   
ref|XP_001754332.1|  predicted protein                                  122   2e-30   
ref|XP_010422783.1|  PREDICTED: reticulon-like protein B7 isoform X2    122   4e-30   
ref|XP_010422782.1|  PREDICTED: reticulon-like protein B7 isoform X1    122   4e-30   
emb|CDX82165.1|  BnaC02g21250D                                          122   4e-30   
gb|KDO41234.1|  hypothetical protein CISIN_1g0293962mg                  120   4e-30   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    122   5e-30   
ref|XP_010465914.1|  PREDICTED: reticulon-like protein B9               121   5e-30   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    122   6e-30   
ref|NP_001058867.1|  Os07g0142000                                       122   6e-30   
ref|XP_001783072.1|  predicted protein                                  121   7e-30   
ref|XP_010036908.1|  PREDICTED: reticulon-like protein B9               120   8e-30   
ref|XP_010427657.1|  PREDICTED: reticulon-like protein B7 isoform X2    121   8e-30   
ref|XP_002527026.1|  conserved hypothetical protein                     120   8e-30   
ref|XP_010427652.1|  PREDICTED: reticulon-like protein B7 isoform X1    121   9e-30   



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   244 bits (623),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT +CHGL++ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FASALRN++N
Sbjct  112  VVEYHLLTLLCHGLMIALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASALRNEIN  171

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLR+IASGRDLKMFL+VI GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED
Sbjct  172  RALAVLREIASGRDLKMFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYED  231

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKA+HELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  232  QVDAFAEKALHELKKQYAVLDAKVLSKIPRGPLKDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT +CHGL++ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL FASALRN++N
Sbjct  112  VVEYHLLTLLCHGLMVALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLAFASALRNEIN  171

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLR+IASGRDLK FL+VI GLW+ SI+G CCDFLTLFYI VV+LHTVPVLYEKYED
Sbjct  172  RALAVLREIASGRDLKTFLLVIGGLWLASILGGCCDFLTLFYIIVVVLHTVPVLYEKYED  231

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKA+HELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  232  QVDAFAEKALHELKKQYAVFDAKVLSKIPRGPLKDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYH LT +CHGLI+ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N
Sbjct  110  VVEYHFLTLLCHGLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEIN  169

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IA+GRDLK FLMVI GLWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED
Sbjct  170  RAFAVLREIAAGRDLKTFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYED  229

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D+FAEKA+HELKKQYAVFDAKVLSKIPRGPL+DKK A
Sbjct  230  QIDSFAEKALHELKKQYAVFDAKVLSKIPRGPLRDKKKA  268



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYH LT +CH LI+ALA LFLWSNAS+FI KSAPHIPEVHIPE+PVL+FA+ LRN++N
Sbjct  39   VVEYHFLTLLCHCLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEIN  98

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IA+GRDLKMFLMVI GLWI+S++GSCCDFL+LFYI VV+LHTVPVLYEKYED
Sbjct  99   RAFAVLREIAAGRDLKMFLMVIGGLWILSVLGSCCDFLSLFYIIVVVLHTVPVLYEKYED  158

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D+FAEKA HELKKQYAVFDAKVLSKIPRGPL+DKK A
Sbjct  159  QIDSFAEKAFHELKKQYAVFDAKVLSKIPRGPLRDKKKA  197



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALAVLFLWSNA++FI KS P IPEV IP++PV++FA ALR ++N
Sbjct  92   MLEYHLLTLVCHLLILALAVLFLWSNAATFINKSPPRIPEVQIPKDPVMEFAQALRFEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGR+LK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  152  RAFAVLRDIASGRELKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAMHE+KKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  212  KVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPLKEKK  248



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CHG ILALA+LFLWSNAS+FI KS PHIPEVHIPEEPVLQ A+ALR ++N
Sbjct  102  LIEYHLLTLICHGFILALAILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAALRMEIN  161

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            +  A+LRDIASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPV YEKYED
Sbjct  162  YAFAILRDIASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYED  221

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VDAFAEKA  E+KKQYAVFDAKVLSKIPRGPLKDKK A
Sbjct  222  KVDAFAEKAAIEIKKQYAVFDAKVLSKIPRGPLKDKKKA  260



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   228 bits (581),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCHGLI+ LAVLFLWSNAS+FI KS P IPEV +PE+PVLQFAS  R  +N
Sbjct  94   ILEYHLLTLVCHGLIIVLAVLFLWSNASTFINKSPPRIPEVSVPEKPVLQFASDARVAIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRD+ASGR+LK FL VI GLWI SI+GSCCDFLTL YI+ VLLHTVPV+Y+KYED
Sbjct  154  QTFALLRDVASGRNLKKFLSVIAGLWIFSILGSCCDFLTLLYISAVLLHTVPVIYDKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+FAEKA+ ELKKQYAVFD KVLSKIPRGPLKDKK
Sbjct  214  QVDSFAEKALAELKKQYAVFDKKVLSKIPRGPLKDKK  250



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT + H  ILALAVLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N
Sbjct  79   LLEYHLLTLISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEIN  138

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRDIASGRDLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  139  RAFAILRDIASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYED  198

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F EKA+HE KKQYAVFD KVLSKIP+GPLKDKK
Sbjct  199  RVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPLKDKK  235



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT +CH LI++LAVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N
Sbjct  110  LLEYHLLTLICHILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEIN  169

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+LR+IASGR+LK FL V+ GLWIISIVGS C+FLTLFYI+ VLLHTVPVLYEKYED
Sbjct  170  RALALLREIASGRELKKFLGVVAGLWIISIVGSWCNFLTLFYISFVLLHTVPVLYEKYED  229

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKAMHE+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  230  KVDPLAEKAMHEIKKQYAVFDKKVLSKIPRGPLKDKK  266



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LI++LAVLFL+SNA +F+ K+ P IPEV+IPE+PVLQFASALR ++N
Sbjct  96   LLEYHLLTLVCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPVLYEKYED
Sbjct  156  RAFAVLRDIASGRDLKKFLAVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD+FAEKAM E+KKQY +FDAKVLSKIP+GPLKDKK A
Sbjct  216  QVDSFAEKAMAEIKKQYVIFDAKVLSKIPKGPLKDKKHA  254



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT +CH LI+ LAVLFLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N
Sbjct  107  LLEYHLLTLICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEIN  166

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IASGR+LK FL VI GLWI+SIVGS C+FLTLFYI+ VLLHT+PVLYEKYED
Sbjct  167  RALDLLREIASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTIPVLYEKYED  226

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKAMHE+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  227  KVDPLAEKAMHEIKKQYAVFDAKVLSKIPRGPLKDKK  263



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT + H  ILALAVLFLWSNAS+FI KS P IP+VHIPEEPVLQ ASA+R ++N
Sbjct  102  LLEYHLLTLISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEIN  161

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRDIASGRDLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  162  RAFAILRDIASGRDLKQFLSVIAGLWVLSIVGSWTNFLTLFYIAFVLLHTVPVLYEKYED  221

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F EKA+HE KKQYAVFD KVLSKIP+GPLKDKK
Sbjct  222  RVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPLKDKK  258



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  ILALA+LFLWSNA++FI K+ PHIPEVHIPE+PVLQFASALR ++N
Sbjct  94   LLEYHLLTLVCHCSILALAILFLWSNATTFINKAPPHIPEVHIPEDPVLQFASALRIEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR++ASG+DLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  154  RGFTLLRNVASGKDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
             VD+FAEKAM E+K+QYAVFDAKVLS+IPRGPLKDKK+A
Sbjct  214  PVDSFAEKAMVEIKRQYAVFDAKVLSRIPRGPLKDKKIA  252



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   223 bits (567),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LAVLFLWSNAS+FI KS P IP+VHIPE+PVL+FASALR ++N
Sbjct  96   LLEYHLLTLVCHFLILGLAVLFLWSNASTFINKSPPKIPQVHIPEKPVLEFASALRVEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRDIASGRDLK FL VI GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  156  RAFALLRDIASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F  KA+ E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  216  HVDSFGGKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH +ILALA LFLWSNAS+FI K  P IP+VHIPE+P+LQFASALR ++N
Sbjct  96   LLEYHLLTLVCHFVILALAGLFLWSNASTFINKRPPKIPQVHIPEDPILQFASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               +VLRDIASGRDLK FL VI GLW+ SI+GS  +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  156  RAFSVLRDIASGRDLKKFLSVIAGLWVFSILGSWANFLTLFYIAFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+F EKA+ E+KKQYAVFDAKVLSKIP+GPLKDKK
Sbjct  216  QVDSFGEKAIAEIKKQYAVFDAKVLSKIPKGPLKDKK  252



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VLEYHLLT VCHGLI+ LA+LFLWS+  +FI KS P IPEV IPEEP L+FASALR ++N
Sbjct  90   VLEYHLLTLVCHGLIVGLALLFLWSSIMTFINKSPPRIPEVSIPEEPALKFASALRVEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H  AVLRDIASGRDLK FL V+ GLWI+S+VG CCDFLTL Y   VLL TVP+ YEKYED
Sbjct  150  HGFAVLRDIASGRDLKKFLSVVAGLWILSVVGGCCDFLTLLYTITVLLFTVPLFYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+FAEKAM E+KKQY VFDA+VLSKIPRGPLKDKK
Sbjct  210  QVDSFAEKAMAEVKKQYVVFDARVLSKIPRGPLKDKK  246



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT +CH LI++LAVLFLWSNA++FI K  PHIPE+H+P++P LQ ASALR ++N
Sbjct  108  LLEYHLLTLICHILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEIN  167

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+LR+IASGR+LK FL V+ GLWI+SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  168  RALALLREIASGRELKKFLGVVAGLWILSIVGSWCNFLTLFYILFVLLHTVPVLYEKYED  227

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKAMHE+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  228  KVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPLKDKK  264



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA LFLWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N
Sbjct  96   LLEYHLLTLVCHFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  156  RAFAVLRDIASGRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F EKA+ E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  216  HVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA LFLWSNAS+FI KS P IP+VHIPEEPVL+FASALR ++N
Sbjct  95   LLEYHLLTLVCHFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW+ SI+G   +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  155  RAFAVLRDIASGRDLKKFLSVIAGLWVFSILGCWANFLTLFYIAFVLLHTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F EKA+ E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  215  HVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPLKDKK  251



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT +CH LI+ LAVLFLWSNA++FI K  PHIPEVH+PE P+LQ ASALR ++N
Sbjct  105  LLEYHLLTLICHILIITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IASGR+LK FL VI GLWI+SIVGS C+FLTLFYI+ VLLHTVPV+YEKYED
Sbjct  165  RALDLLREIASGRELKKFLAVIAGLWILSIVGSWCNFLTLFYISFVLLHTVPVIYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKAMHE+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  225  KVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPLKDKK  261



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CHGLIL+LAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ A ALR+++N
Sbjct  99   LIEYHLLTLICHGLILSLAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQVADALRSEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SIVGS  +FLTLFYI  VLL+TVPV YEKYED
Sbjct  159  WGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGSWVNFLTLFYIVFVLLYTVPVFYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+ AEKA+ ELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  219  KVDSLAEKALIELKKQYAVLDAKVLSKIPRGPLKDKK  255



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALAVLFLWSNAS+FI KS P IPEV +PE+ VL  ASALR ++N
Sbjct  96   LLEYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED
Sbjct  156  RALEILRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  216  QVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKL  253



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N
Sbjct  104  LLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +A LR+IASGRDLK FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED
Sbjct  164  QGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKA  E+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  224  KVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N
Sbjct  104  LLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +A LR+IASGRDLK FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED
Sbjct  164  QGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKA  E+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  224  KVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLL+ +CH L+L + VLFLWSNAS+FI K+ P IP+V IPE PVL+ ASAL+ ++N
Sbjct  90   IFEYHLLSLICHLLMLTITVLFLWSNASTFINKAPPKIPDVRIPEGPVLEIASALKYEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA LR+IASG+DLK FL VI GLWI SI+GSCC+FLTLFYI  V+LHT+PVLYEKYED
Sbjct  150  RGLASLREIASGKDLKKFLAVIAGLWIFSILGSCCNFLTLFYICFVMLHTLPVLYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VDAFAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK A
Sbjct  210  QVDAFAEKAMIEIKKQYIVFDAKVLSKIPRGPLKDKKAA  248



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL  VCH LI  LA+LFLWSNA++FI K  PHIPE H+ EEP+L+ ASALR ++N
Sbjct  105  LLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H L VLR+IASGRDLK FL VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED
Sbjct  165  HILHVLREIASGRDLKKFLAVIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD  AEKA+ E+KKQYAVFDA+VLSKIP+GPLKDKK A
Sbjct  225  KVDPLAEKAVQEIKKQYAVFDARVLSKIPKGPLKDKKKA  263



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALAVLFLWSNAS+FI KS P IPEV +PE+ VL  ASALR ++N
Sbjct  96   LLEYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPEVILPEDIVLGVASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEKYED
Sbjct  156  RALEILRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPLKDKK
Sbjct  216  QVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKK  252



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LA+LFLWSNA++FI K  PHIPEV IPE+PVL+FAS L +++N
Sbjct  104  LLEYHLLTLVCHVLILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +A LR+IASGRDLK FL+V+   W+ SIVGSCC+FLTLFYIA VLLHTVPVLYEKYED
Sbjct  164  QGIATLREIASGRDLKKFLLVVAVFWVFSIVGSCCNFLTLFYIAFVLLHTVPVLYEKYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKA  E+KKQYAVFD KVLSKIPRGPLKDKK
Sbjct  224  KVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPLKDKK  260



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LIL+LA+LFLWSNAS+FI K+ PHIPEV IPE+  +  A +LR ++N
Sbjct  97   LLEYHLLTLVGHCLILSLAILFLWSNASTFISKTPPHIPEVSIPEDLAVNVALSLRYEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRDIASGRDLK FL VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED
Sbjct  157  RAFAILRDIASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYIVFVTLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK
Sbjct  217  KVDPFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL+ VCH LIL+LA+LFLWSNAS+FI K+ P IPE  IPE+  +  A +LR ++N
Sbjct  96   LLEYHLLSLVCHCLILSLAILFLWSNASTFINKAPPRIPEASIPEDLAVNVALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IASGRDLK FL+VI GLW++SI+GSCC+FLTLFY  +V LHTVPVLYEKYED
Sbjct  156  RAFAVLREIASGRDLKKFLVVIAGLWVLSILGSCCNFLTLFYTMLVTLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+FAEKAM E+KKQY VFDAKVLSKIPR PLKDKK
Sbjct  216  KVDSFAEKAMAEIKKQYGVFDAKVLSKIPRSPLKDKK  252



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  629  EYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHC  450
            EYHLLT   H LIL LAVLFLWSNA +FI KS P IPEV IPEEPVLQFASALR ++N  
Sbjct  99   EYHLLTLAAHCLILTLAVLFLWSNAHAFIHKSPPRIPEVSIPEEPVLQFASALRLEINQA  158

Query  449  LAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEV  270
             AVLRDIASG+DLK FL+VI GLW++SI G+ C+FLTLFYI  VLLHTVPVLYEK+ED++
Sbjct  159  FAVLRDIASGKDLKKFLLVIAGLWLLSIAGNWCNFLTLFYIVFVLLHTVPVLYEKFEDKI  218

Query  269  DAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            D FAE+AM ELKKQYAVFDAKVLSKIP GPLKDKK A
Sbjct  219  DPFAERAMGELKKQYAVFDAKVLSKIPLGPLKDKKKA  255



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL+LA+LFLWSNA++FI KS P IPEVHIPE+P LQ  +ALR ++N
Sbjct  97   LLEYHLLTLVCHILILSLAILFLWSNATTFINKSPPRIPEVHIPEDPFLQAVNALRIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL++I GLW++SI+GSCC+FLTLFYI  VLLHTVPV+YEKYED
Sbjct  157  CGFAVLRDIASGRDLKKFLIIIAGLWVLSILGSCCNFLTLFYITFVLLHTVPVIYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
             +D FAEKA  E+KKQYAVFDAKVLSKIP+ PLK KK+A
Sbjct  217  RIDPFAEKATIEIKKQYAVFDAKVLSKIPKVPLKYKKMA  255



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  ILALAVLFLWSNAS+FI K+ P IP+VHIPEEPVLQ A+ALR ++N
Sbjct  97   LLEYHLLTLVCHLAILALAVLFLWSNASTFINKAPPKIPQVHIPEEPVLQIAAALRIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASG+DLK FL VI GLW++SIVGS  +FLTLFYIA VLLHTVPVLYEKYED
Sbjct  157  RVFAVLRDIASGKDLKKFLSVIAGLWVLSIVGSWANFLTLFYIAFVLLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
             VD+F EKA+ E KKQYAVFDAKVLSKIP+G LK+KK
Sbjct  217  RVDSFGEKALAEFKKQYAVFDAKVLSKIPKGALKNKK  253



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT V H L+L+LA+LFLWSNAS+FI K  PHIPEV IPE+  +  A +LR ++N
Sbjct  97   LLDYHLLTLVGHCLVLSLAILFLWSNASTFINKIPPHIPEVSIPEDVAINVALSLRYEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED
Sbjct  157  RAFAVLRDIASGRDLKKFLAVIAGLWVLSILGSCCNFLTLFYILFVTLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+FAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK
Sbjct  217  KVDSFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKK  253



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL  VCH LIL+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N
Sbjct  94   LMEYHLLALVCHCLILSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FLMVI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKYED
Sbjct  154  RGFAVLRDIASGRDLKKFLMVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD+FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  214  KVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  249



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNAS+FI KS P IPEVHIPEEPVLQ A+ALR ++N
Sbjct  96   LLEYHLLTLVCHCLILALALLFLWSNASTFINKSPPRIPEVHIPEEPVLQIAAALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED
Sbjct  156  QGFAVLRDIASGRDLKKFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  216  QVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LI+ALAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N
Sbjct  99   LLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED
Sbjct  159  RAFTLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
             VD+F+EKA  E+KKQYAVFDAKVLSKIPR  LKDKK A
Sbjct  219  RVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LI+ALAVLFLWSNAS+FI KS P IPEV+IPEEPVLQ ASALR ++N
Sbjct  99   LLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLHTVPV+YEKYED
Sbjct  159  RAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
             VD+F+EKA  E+KKQYAVFDAKVLSKIPR  LKDKK A
Sbjct  219  RVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKKA  256



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  608  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  429
            VCH LILALAVLFLWSNAS+FI KS P  PEV +PE+ VL  ASALR +VN  LA LR+I
Sbjct  107  VCHILILALAVLFLWSNASTFINKSPPQFPEVILPEDIVLGVASALRIEVNRALAALREI  166

Query  428  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  249
            ASGRDLK FL VI GLW+ SI+GSCC+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA
Sbjct  167  ASGRDLKKFLAVIAGLWVFSILGSCCNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKA  226

Query  248  MHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
              E+KKQYAVF+AKVLSKIPRGPLKDKK 
Sbjct  227  EAEIKKQYAVFNAKVLSKIPRGPLKDKKF  255



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT VCH LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N
Sbjct  97   LLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L V RDIASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED
Sbjct  157  RALEVFRDIASGKELKKFLGVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  217  QVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKL  254



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA++F+ KS P IPEV IP++PV++FA ALR ++N
Sbjct  92   MLEYHLLTLVCHLLILALALLFLWSNAATFVNKSPPRIPEVQIPKDPVMEFAQALRFEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLWI+SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  152  RAFAVLRDIASGRDLKKFLSVIAGLWILSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAMHE+KKQYAVFDAKVL KIPRGPLK+KK
Sbjct  212  KVDPFAEKAMHEIKKQYAVFDAKVLRKIPRGPLKEKK  248



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LA+LFLWSNAS+FI KS+PHIPEV IPE+  +  A +LR ++N
Sbjct  95   LMEYHLLTLVCHCLILSLAILFLWSNASTFINKSSPHIPEVSIPEDVAVDVALSLRYEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGR+LK FLMVI GLW++SI+G+CC+FLTLFYI  V LHTVPVLYEKYED
Sbjct  155  RGFAVLRDIASGRELKKFLMVIAGLWVLSIIGTCCNFLTLFYIVFVTLHTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEK M E+KK YA F AK LSKIPRGPLK+KK
Sbjct  215  KVDPFAEKVMAEIKKHYATFHAKCLSKIPRGPLKEKK  251



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  ILAL++LFLWSNA++FI K  PHIPEV +PE+P L+ AS LR ++N
Sbjct  100  LLEYHLLTLVCHVSILALSLLFLWSNATTFINKRPPHIPEVRLPEDPFLEVASVLRTEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IASGRDLK FLMV+ GLW +SIVGS C+FLTLFYI  +LLHTVPVLYEKY+D
Sbjct  160  RGFAVLREIASGRDLKKFLMVVVGLWALSIVGSFCNFLTLFYIVFILLHTVPVLYEKYDD  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAFAEKAM ++KKQYAVFDAKVLSKIPRGPL  K+
Sbjct  220  KIDAFAEKAMIQIKKQYAVFDAKVLSKIPRGPLGKKR  256



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   213 bits (541),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL  VCH LI  LA+LFLWSNA++FI K  PHIPEVH+PEEP+L+ ASALR ++N
Sbjct  105  LLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEVHLPEEPILEIASALRIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            + L VLR+IASGRDL  FL VI GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED
Sbjct  165  YTLRVLREIASGRDLTKFLSVIAGLWVLSVLGNCCNFLTLFYISFVLLHTVPVLYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD   EKA+ E+KKQYAVFDAKVLSKIP+GPL+DKK A
Sbjct  225  KVDPLVEKAVKEIKKQYAVFDAKVLSKIPKGPLRDKKKA  263



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT VCH LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N
Sbjct  97   LLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + RDIASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED
Sbjct  157  KALEIFRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPLKDKK 
Sbjct  217  QVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPLKDKKF  254



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA+ FI KS PHIPEV IP+EPVL+F  ALR ++N
Sbjct  94   LLEYHLLTLVCHLLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFVMALRFEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIA GRDLKMFL VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  154  RAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAMHE+KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  214  KVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPLKQKK  250



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL  VCH LI  LA+LFLWSNA++FI K  PHIPE H+ EEP+L+ ASALR ++N
Sbjct  105  LLEYHLLGLVCHLLIFTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMV----ITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYE  288
            H L VLR+IASGRDLK FL V    I GLW++S++G+CC+FLTLFYI+ VLLHTVPVLYE
Sbjct  165  HILHVLREIASGRDLKKFLAVNCSVIAGLWVLSMLGNCCNFLTLFYISFVLLHTVPVLYE  224

Query  287  KYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            KYED+VD  AEKA+ E+KKQYAVFDA+VLSKIP+GPLKDKK A
Sbjct  225  KYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIPKGPLKDKKKA  267



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL  VCH LIL+LA+LFLWSNAS+FI KS P IPEV IPE+  +  A +LR ++N
Sbjct  94   LMEYHLLALVCHCLILSLAILFLWSNASTFIHKSPPRIPEVSIPEDVAVNVALSLRYEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++SIVGSCC+FLTLFYIA V LHTVPVLYEKYED
Sbjct  154  RGFTVLRDIASGRDLKKFLVVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEK M E+KK YA F AK LSKIPRGPLK+KK
Sbjct  214  KVDPFAEKVMTEVKKHYATFHAKCLSKIPRGPLKEKK  250



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL+LA+LFLWSNAS FI K+ P I EV IP++  +  A +LR ++N
Sbjct  96   LLEYHLLTLVCHCLILSLAILFLWSNASIFINKAPPRILEVSIPKDLAVNVALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +AVLR+I SG+DLK FL VI GLW++ ++GSCC+F+TLFYI VV LHTVPVLYEKYED
Sbjct  156  RAIAVLREITSGQDLKKFLAVIAGLWVLLVLGSCCNFMTLFYIMVVTLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+FAEKAM E+KKQY VFDAKVLSKIPR PLKDKK
Sbjct  216  KVDSFAEKAMTEIKKQYKVFDAKVLSKIPREPLKDKK  252



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL+ VCH  ILALAVLFLWSNAS+FI K+ P IPEVHIPEE VLQ AS LR ++N
Sbjct  98   LLEYHLLSLVCHSSILALAVLFLWSNASTFIHKTPPRIPEVHIPEEHVLQLASGLRTEIN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LRDIASGRDLK FLMVI GLW++SI+GSCC+F+TLFYIA VLL T+PVLYEKYED
Sbjct  158  RGFAALRDIASGRDLKKFLMVIAGLWVLSILGSCCNFVTLFYIATVLLFTIPVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVL----SKIPRGPLKDKK  165
            +VDAF EKAM E+KKQY V D KVL    SKIPRG L  KK
Sbjct  218  KVDAFGEKAMKEIKKQYEVLDEKVLSKIMSKIPRGALSKKK  258



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T +CH LIL+LA+LFLWSNAS+FI KS P+IPEV +PE+ VL+ ASALR +VN
Sbjct  89   MLEYHLITLLCHTLILSLAILFLWSNASTFINKSPPNIPEVVLPEKCVLEVASALRIEVN  148

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L V+RDIASG DLK FL VI GLW +S+VG+CC+FLTLFYI  VLLHTVPV YE YED
Sbjct  149  RALDVVRDIASGNDLKKFLGVIVGLWALSLVGNCCNFLTLFYIVFVLLHTVPVFYEIYED  208

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+F+EKA+ E+KKQYA FD KVLSKIP+GPLK+KK
Sbjct  209  QVDSFSEKAIIEIKKQYAAFDEKVLSKIPKGPLKEKK  245



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ VCH LIL LA++FLWSNASSFI KS P IPEV + E+ V+  A+ALR + N
Sbjct  101  LIEYHLLSLVCHILILGLAIIFLWSNASSFINKSPPKIPEVVVREDIVIGVANALRIEFN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LRDI SG+DLK FL VI GLW++S++GSC +FLTLFYI  VLLHTVP+LYEKY+D
Sbjct  161  RAFAILRDIVSGKDLKKFLAVIAGLWVLSMLGSCFNFLTLFYICFVLLHTVPLLYEKYDD  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            ++DAFAEKA  ELKKQYAVFDAKVLSKIP+GPLKDKK 
Sbjct  221  QIDAFAEKAEAELKKQYAVFDAKVLSKIPKGPLKDKKF  258



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  I ALAVLFLWSNAS+FI K+ P IP VHIPEEPV+Q AS LR +VN
Sbjct  98   LLEYHLLTLVCHSSIFALAVLFLWSNASTFIHKTPPRIPHVHIPEEPVIQLASGLRFEVN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LRDIASGRDLK FL+VI+GLW++SI+GSCC+F+TLFYIA VLL TVPVLYEKYED
Sbjct  158  RGFTALRDIASGRDLKKFLVVISGLWVLSILGSCCNFVTLFYIATVLLFTVPVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KV+SKIPRG L  KK
Sbjct  218  QVDAFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGALTKKK  258



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA+ FI KS PHIPEV IP+EPVL+FA ALR ++N
Sbjct  94   LLEYHLLTLVCHLLILALALLFLWSNATQFINKSTPHIPEVQIPKEPVLEFAMALRFEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIA GRDLKMFL VI GLW++SIVGS C+FLTLFYI  V+LHTVPVLYEKYED
Sbjct  154  RAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGSWCNFLTLFYIVFVVLHTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAMHE+KKQYAVFDAKVLSKIP GPLK KK
Sbjct  214  KVDPFAEKAMHEIKKQYAVFDAKVLSKIPMGPLKQKK  250



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  IL LAVLFLWSNA +FI K+ P IP VHIPEEP+LQFASAL  ++N
Sbjct  156  LLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKAPPRIPVVHIPEEPILQFASALTIEIN  215

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR I SGRDLK FL+VI G WIISIVGS C+FLTLFYIA VLLHTVPVLY+KYED
Sbjct  216  RGFAALRAIGSGRDLKTFLIVIVGTWIISIVGSWCNFLTLFYIAFVLLHTVPVLYDKYED  275

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D  AEKA+ E KKQYAVFD KVLSKIP+GPLK+KKLA
Sbjct  276  KIDPLAEKALVEFKKQYAVFDEKVLSKIPKGPLKEKKLA  314



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT VCH LIL+LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  100  VMEYHLLTLVCHCLILSLAILFLWSNASTFINKSPPNIPEVKIPEDVAVNVALSLRYEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GRDLK FL+VI GLW++S++GSCC+FLTLFYI  V L+TVPVLYEKYED
Sbjct  160  RGFATLREIGHGRDLKKFLIVIAGLWLLSVLGSCCNFLTLFYIVFVALYTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+FD K LSKIP+GPLKDKK
Sbjct  220  KVDAFGEKAMTELKKYYAIFDEKCLSKIPKGPLKDKK  256



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL  VCHGLIL L  LFL+SNAS+FIKKS P IP V IPEEPVL FASALR  +N
Sbjct  96   LLEYHLLALVCHGLILGLVGLFLYSNASTFIKKSPPKIPVVSIPEEPVLNFASALRIGIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LRDIASG+DLK FL VI GLW++S  GSCCDFLTL Y   VLL TVP++Y+KYED
Sbjct  156  EGFATLRDIASGKDLKKFLSVIAGLWVLSFFGSCCDFLTLLYSITVLLFTVPLVYDKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAM E+KKQYAVF+ KVLSKIPRGPLK+KK
Sbjct  216  QVDCFAEKAMVEIKKQYAVFNTKVLSKIPRGPLKEKK  252



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+L+T VCH LILALA+LFLWSNAS+FI KS P IPEV IPEEPVLQ A+ALR ++N
Sbjct  96   LLEYNLVTLVCHCLILALALLFLWSNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               +VLRDIASGRDLK FL VI GLW++SIVGS C+F+TLFYIA VLLHTVPV YEKYED
Sbjct  156  QGFSVLRDIASGRDLKNFLTVIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  216  QVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKDKK  252



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  113  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEIN  172

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  I GLW++SI+G CC FLTL YIA+VLL TVP+LY+KYED
Sbjct  173  RGFSSLREIASGRDLKKFLSAIAGLWVLSILGGCCSFLTLSYIALVLLFTVPLLYDKYED  232

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD++ EKAM ELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  233  KVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPLKDKK  269



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYH LT +CH  + ALAV+FLWSNAS FI KS PHIP+VHIPE+PV++ ASALR ++N
Sbjct  99   LLEYHFLTLICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEDPVIEIASALRVEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +AVLRDIASGRDLK FL  I GLW++SI+GS  +FLTL YI V++L TVPV YEKY+D
Sbjct  159  RAIAVLRDIASGRDLKSFLYAIAGLWVLSILGSWFNFLTLLYIGVIVLFTVPVFYEKYDD  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VDAFAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK+A
Sbjct  219  KVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VC+ LI++LA+LFLWSNA +FI KS P IPEVHIPE+P LQ  SAL  ++N
Sbjct  97   LLEYHLLTLVCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSALTIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IASGRDLK FL+VI GLW++SIVGS  +FLTLFYI+VVLLHTVPVLYEKYED
Sbjct  157  QGFAALRSIASGRDLKKFLIVIAGLWVLSIVGSWANFLTLFYISVVLLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D  AEKA+ ELKKQY VFD KVLSKIP+GPLK KK A
Sbjct  217  KIDPLAEKALIELKKQYTVFDEKVLSKIPKGPLKGKKRA  255



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY L+  VCH LI  LAVLFLWSNA++FI K  PHIPEV +PEEP+L+ ASAL  ++N
Sbjct  97   LLEYFLVGLVCHLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L++LR+IA+G+DLK FL V+ GLWI+S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  157  RALSMLREIATGKDLKKFLAVVAGLWILSVVGNCCNFLTLFYILFVLLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD  AEKAM E+KKQYAVFDA+VLSKIP GPLKDKK A
Sbjct  217  KVDPLAEKAMQEIKKQYAVFDARVLSKIPIGPLKDKKNA  255



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT VCH LIL+LA+LFLWSNAS+FI KS P+IPEV I E+  +  A +LR ++N
Sbjct  100  VMEYHLLTLVCHCLILSLAILFLWSNASTFINKSPPNIPEVKISEDVAVNVALSLRYEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GRDLK FL+VI G W++S++GSCC+FLTLFYI  V+L+TVPVLYEKYED
Sbjct  160  RGFATLREIGHGRDLKKFLIVIAGFWLLSVLGSCCNFLTLFYIVFVVLYTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+FD K LSKIP+GPLKDKK
Sbjct  220  KVDAFGEKAMIELKKYYAIFDEKCLSKIPKGPLKDKK  256



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LI AL +LFLWSNA +FI KS   IPEVHIP++PV++FA ALR + N
Sbjct  90   LLEYHLLTLVCHVLIFALVILFLWSNAYAFINKSPLCIPEVHIPKDPVIEFAEALRFESN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIA GRDLK FL VI GLWI+SIVGS C+F+TLFY+  VLLH+VPVLYEKYED
Sbjct  150  LAFTVLRDIAPGRDLKKFLYVIAGLWILSIVGSWCNFVTLFYLVFVLLHSVPVLYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD FAEKAMHE+KKQ AVF+AKVLSKIPRGP K+K
Sbjct  210  KVDPFAEKAMHEIKKQCAVFNAKVLSKIPRGPSKEK  245



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LI+A+AVLFLWSNAS+FI  + P IPEV +P++ VL  ASALR ++N
Sbjct  96   LLEYHLLTLVCHILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASALRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASG+DLK FL+VI GLW++S++G+  +FLTLFYI  VLLHTVP+LYEKYED
Sbjct  156  RALEILRDIASGKDLKKFLVVIVGLWVVSVLGNIWNFLTLFYIVFVLLHTVPLLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKA  E+KK YAVFDA VLSKIPRGPLK KK
Sbjct  216  KVDAFAEKAEAEIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT VCH LILALAVLFLWSNAS+FI KS P IP+V +PE+ VL  A+ALR ++N
Sbjct  245  LLQYHLLTLVCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEIN  304

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + RDIASG++LK FL VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLYEK+ED
Sbjct  305  KALEIFRDIASGKELKKFLAVIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLYEKFED  364

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAE A  E+KKQYAVF+ KVLSKIPRGPLKDKK 
Sbjct  365  QVDAFAENAEAEIKKQYAVFNVKVLSKIPRGPLKDKKF  402



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ VCH LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR D+N
Sbjct  95   LMEYHLLSLVCHCLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL+VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED
Sbjct  155  RAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD+F EKAM E+KK YA   AK LSKIP+G LK+KK
Sbjct  215  KVDSFGEKAMAEIKKHYATVHAKCLSKIPKGALKEKK  251



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT VCH LI+A+ VLFLWSNAS+FI  + P IPEV +P + VL  ASALR ++N
Sbjct  102  LLQYHLLTLVCHILIVAITVLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASALRIEMN  161

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASG+DLK FL+VI GLW++SI+G+C +FLTLFYI  VLLHTVPVLY+KYED
Sbjct  162  RILEILRDIASGKDLKKFLVVILGLWVVSILGNCWNFLTLFYIVFVLLHTVPVLYDKYED  221

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VDAFAEKA  E+KK YAVF+ +VLSKIPRGPL+DK+LA
Sbjct  222  KVDAFAEKAEAEIKKHYAVFNDQVLSKIPRGPLRDKRLA  260



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ  S LR ++N
Sbjct  113  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLVSGLRIEIN  172

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  I GLW++SI+G CC FLTL YIA+VLL TVP+ Y+KYED
Sbjct  173  CGFSSLREIASGRDLKKFLSAIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLFYDKYED  232

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDA+ EKAM ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  233  KVDAYGEKAMAELKKQYAVFDAKVLSKIPRGPLKDKK  269



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYH LT +CH  + ALAV+FLWSNAS FI KS PHIP+VHIPE PV++ ASALR ++N
Sbjct  99   LLEYHFLTLICHIFMAALAVVFLWSNASFFINKSLPHIPQVHIPEGPVVEIASALRVEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +AVLR+IASGRDLK FL  I GLW++SIVGS  +FLTL YI V++L TVP+ YEKY+D
Sbjct  159  RAIAVLREIASGRDLKSFLYAIAGLWVLSIVGSWFNFLTLLYIGVIVLFTVPLFYEKYDD  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VDAFAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK+A
Sbjct  219  KVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKIA  257



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  629  EYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHC  450
            EYHLLT +CH LI  +AVLFLWSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N  
Sbjct  111  EYHLLTLLCHVLIAVIAVLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGLRIEINRA  170

Query  449  LAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEV  270
               LRDIASGRDLK FL  I GLW++SI+G CC+FLTL YIA+V+L T+PVLYEKYED+V
Sbjct  171  FTCLRDIASGRDLKKFLSAIAGLWVLSILGGCCNFLTLSYIAMVMLFTIPVLYEKYEDKV  230

Query  269  DAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            DA+ EKAM E+KKQYAV D KVLSKIPRGPLK KK
Sbjct  231  DAYGEKAMVEIKKQYAVLDEKVLSKIPRGPLKGKK  265



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY L+  VCH LI  LAVLFLWSNA++FI K  PHIPEV +PEEP+L+ ASAL  ++N
Sbjct  105  LLEYFLVGLVCHLLIFTLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L++LR+IA+G+D K FL V+TGLWI+S+VG+CC+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  165  RALSMLREIATGKDPKKFLAVVTGLWILSVVGNCCNFLTLFYILFVLLHTVPVLYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD  AEKA+ E+KKQYA+FDAKVLSKIP GPLKDKK A
Sbjct  225  KVDPLAEKAVQEIKKQYAIFDAKVLSKIPIGPLKDKKNA  263



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N
Sbjct  101  LLEYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LRDIASGRDLKMFL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ 
Sbjct  161  RAFHILRDIASGRDLKMFLGVIAVLWIVSLVGKWFNFLTLFYITFVLLHTLPVIYEKYDV  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF+EKA+ E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  221  QIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPLKEKK  257



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT  CH LIL+LAVLFLWSNA +FI K+ P IP++H+PEEP L  ASAL  ++N
Sbjct  97   LIEYHLLTLACHILILSLAVLFLWSNAHTFINKTPPRIPQIHLPEEPFLLVASALTLEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLRDIASG+DLK FL+VI  LW++SIVGS C+FLTLFYI+ VLLHTVPVLYEKYED
Sbjct  157  RGLAVLRDIASGKDLKKFLIVIAALWVVSIVGSWCNFLTLFYISFVLLHTVPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKA  E+KKQYAVFDAKVLSKIP G LK K++
Sbjct  217  KVDPFAEKATIEIKKQYAVFDAKVLSKIPVGALKAKRV  254



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +++YHLLT  CH LI+ LAVLFLWSNAS FI KS P IPEVHIPEE +LQ AS LR ++N
Sbjct  109  LMQYHLLTLFCHILIVVLAVLFLWSNASIFINKSPPKIPEVHIPEEHILQLASGLRIEIN  168

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LRDIASGRDLK FL  I GLW++S++GS C+FLTL YIA+V+L TVPV+YEKYED
Sbjct  169  RAFTCLRDIASGRDLKKFLSAIAGLWVLSVIGSWCNFLTLSYIAMVMLFTVPVMYEKYED  228

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D KV SKIPRGPLKDKK
Sbjct  229  KVDAFGEKAMVEIKKQYAVLDEKVFSKIPRGPLKDKK  265



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI +L +LFLWSNASSFI KS+P IPEV IPE+ V+  A + R ++N
Sbjct  92   LLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSSPRIPEVVIPEDLVVNIALSTRYEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED
Sbjct  152  RAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLLYIVFVVLHTVPILYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  212  QIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPLKDKK  248



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR ++N
Sbjct  93   LMEYHLLTLVCHCLILSLAILFLWSNATTFINKSPPHIPEVIIPEDLSVNIALSLRYEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IA+GRD+K FL VI GLW++S++G+CC+FLTLFYIA V LHTVP LY+KYED
Sbjct  153  RGFAVLREIAAGRDVKKFLAVIVGLWVLSVIGNCCNFLTLFYIAFVTLHTVPFLYDKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD+FAEKA  E KK YAV  AK LSKIPRGPLKDKK+
Sbjct  213  QVDSFAEKATVEFKKHYAVIHAKYLSKIPRGPLKDKKV  250



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            LEYHLLT VCH LI+A+AVLFLWSNAS+FI  + PHIPEV +P++ VL  ASALR ++N 
Sbjct  97   LEYHLLTLVCHILIVAVAVLFLWSNASAFINTAPPHIPEVVLPKDIVLSVASALRIEINR  156

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
             L +LRDIASG+DLK FL+VI GLWI+SI+G+  +FLTLFYI  VLLHTVPVLYEK+ED+
Sbjct  157  ALEILRDIASGKDLKKFLVVIVGLWIVSILGNIWNFLTLFYIVFVLLHTVPVLYEKHEDK  216

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            VDA AEKA  E+KK YAVFDA VLSKIPRGPLK KK
Sbjct  217  VDAVAEKAEAEIKKHYAVFDANVLSKIPRGPLKGKK  252



>ref|NP_001042463.1| Os01g0226300 [Oryza sativa Japonica Group]
 dbj|BAF04377.1| Os01g0226300, partial [Oryza sativa Japonica Group]
Length=178

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N
Sbjct  21   LLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEIN  80

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED
Sbjct  81   RAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYED  140

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  141  QIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  177



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH  IL LA+LFLWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N
Sbjct  98   LIEYHLLTLICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASGR+LK FLMVI   W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  158  QGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKA  E+KKQYAVFDAKVLSKIP GPLK KK+
Sbjct  218  KVDPFAEKAAIEVKKQYAVFDAKVLSKIPMGPLKAKKV  255



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N
Sbjct  95   LLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLR+IASGRDLK FL VI GLW++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED
Sbjct  155  RALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  168
            ++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  215  KIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N
Sbjct  95   LLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLR+IASGRDLK FL VI GLW++SIVG+ C+F+TLFYI  VLLHTVPV+YEKYED
Sbjct  155  RALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIVFVLLHTVPVIYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  168
            ++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  215  KIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  254



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N
Sbjct  103  LLEYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEIN  162

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D
Sbjct  163  KGFYVLRDIASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDD  222

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  E+KKQYAVFDAKVLSKIPRGP+K+KK
Sbjct  223  QIDAFGEKAWIEIKKQYAVFDAKVLSKIPRGPVKEKK  259



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N
Sbjct  122  LLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEIN  181

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED
Sbjct  182  RAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYED  241

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  242  QIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPLKDKK  278



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA++FI KS P IPEV IP++PVL+FA ALR ++N
Sbjct  93   LLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW+ SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  153  RGFAVLRDIASGRDLKKFLSVIVGLWVSSIVGSWCNFLTLFYIVFVLLHTVPVLYEKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKA HE+KKQYAVFDAKVLSKIP+ PLK+KK
Sbjct  213  KVDPLAEKAWHEIKKQYAVFDAKVLSKIPKRPLKEKK  249



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LA++FLWSNAS+FI KS P IPEV IPE+  +  A +LR ++N
Sbjct  100  LMEYHLLTFVCHSLILSLAIMFLWSNASTFINKSPPRIPEVSIPEDMAVNIALSLRYEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LRDIA GRDLK FL VI GLW+ SI+G+ C+FLTLFYIA V LHTVP LYEKYED
Sbjct  160  WAFAALRDIALGRDLKKFLSVIAGLWVFSIIGNFCNFLTLFYIAFVTLHTVPPLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  E KK Y+V  AK LSKIP+GPLKDKK 
Sbjct  220  KVDAFAEKAQTEFKKHYSVIHAKYLSKIPKGPLKDKKF  257



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV +LWSNAS+FI KS P IP V IPE+ VL+ ASALR ++N
Sbjct  93   LLEYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASALRIELN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D
Sbjct  153  KGFYVLRBIASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDD  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  213  QIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LA+LFLWSNA++ I KS PHIP V IPE+  +  + +L  ++N
Sbjct  93   LMEYHLLTLVCHCLILSLAILFLWSNATTLINKSPPHIPVVSIPEDLAVNISRSLTYEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               +VLR+IA+GR+LK FL VI GLWI+SI+GSCC+FLTLFYIA V LHTVP LY+KYED
Sbjct  153  RGFSVLREIATGRELKKFLAVIAGLWILSIIGSCCNFLTLFYIAFVTLHTVPFLYDKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
             VD FAEKA  E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  213  RVDTFAEKATVEFKKHYAVFHAKCLSKIPRGPLKDKKF  250



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VLEYH LT +CHGLIL L  +FL SNAS+F+KK+ P IPEV +PEEPVL+FASALR ++N
Sbjct  99   VLEYHFLTLICHGLILGLVAMFLLSNASTFVKKAPPRIPEVVLPEEPVLKFASALRIEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LRDIASG+DLK FL VI GLW++S+VG  CDF+TL +   +LL TVP LYEK ED
Sbjct  159  RVFADLRDIASGKDLKKFLYVIGGLWVLSVVGGICDFMTLIFSITLLLFTVPFLYEKNED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD +AEKA+ ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  219  QVDCYAEKAIAELKKQYAVFDAKVLSKIPRGPLKDKK  255



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N
Sbjct  126  LLGYHLLTFVCHGLIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEIN  185

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRDLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED
Sbjct  186  RAFANLRQIALGRDLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYED  245

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAVFD KVLSK+PRGP KDKK
Sbjct  246  QIDSYGEKGWAEIKKQYAVFDEKVLSKVPRGPAKDKK  282



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV FLWS AS+FI KS P IP+V IPE+ VL+ ASALR ++N
Sbjct  92   LLEYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D
Sbjct  152  KGFYVLRDIASGRDLKTFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDD  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  212  QIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  248



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 142/194 (73%), Gaps = 5/194 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ VCH LIL+LA+LFLWSNA++FI KS PHIPEV IPE+  +  A +LR D+N
Sbjct  95   LMEYHLLSLVCHCLILSLAILFLWSNATTFINKSPPHIPEVSIPEDVAVSVALSLRYDIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL+VI GLW++SI+GSCC+FLTLFYI  V LHTVPVLYEKYED
Sbjct  155  RAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGSCCNFLTLFYIVFVTLHTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA*DCNSVWCHYVRMCN*SLKNL  96
            +VD+F EKAM E+KK YA   AK LSKIP+G LK +     C   +C +V  C      +
Sbjct  215  KVDSFGEKAMAEIKKHYATVHAKCLSKIPKGALKRRS---SCR--FCQFVASCGFLCVVV  269

Query  95   CFSVIYQQTCWICH  54
              S++ + + W  H
Sbjct  270  TLSILLRTSTWCMH  283



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ VCH LILAL+VLFLWSNA SFI KS P IPE+H+ EE  L  ASALRN+VN
Sbjct  96   LVEYHLLSLVCHILILALSVLFLWSNAHSFINKSPPQIPEIHLHEEHFLLVASALRNEVN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIA GRDLK FLMV+ GLW+IS+VGS C FLTL YI  VLLHTVPVLYEK+ED
Sbjct  156  QAFTVLRDIALGRDLKKFLMVVAGLWVISVVGSWCHFLTLIYICFVLLHTVPVLYEKHED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKA  ELKKQY V D KVLSKIP GPLK K
Sbjct  216  KVDPMAEKAFVELKKQYGVLDEKVLSKIPIGPLKAK  251



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLL  +CHGLI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N
Sbjct  129  LLGYHLLAFLCHGLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNVALSTRHEIN  188

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+IA GRD+K FL+VI GLW++SI+GSCC+FLTL YI  V+LHTVPVLYEKYED
Sbjct  189  RAFANLREIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLVYIVFVVLHTVPVLYEKYED  248

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQY+VFDAKVLSK+PRGPLKDKK
Sbjct  249  QIDSYGEKGWVEVKKQYSVFDAKVLSKVPRGPLKDKK  285



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL  +CH  IL LA+LFLWSNA +FI KS P IPE+H+PEEP LQ ASAL  ++N
Sbjct  98   LIEYHLLALICHISILCLALLFLWSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASGR+LK FLMVI   W++SIVGS C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  158  QGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGSWCNFLTLFYICFVLLHTVPVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKA  E+KKQYAVFDAKVLSKIP GPLK KK+
Sbjct  218  KVDPFAEKAAIEIKKQYAVFDAKVLSKIPMGPLKAKKV  255



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV FLWSNAS+FI KS P IP+V + E  VL  ASALR ++N
Sbjct  107  LLEYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELN  166

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LRDIASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+ 
Sbjct  167  RAFHILRDIASGRDLKTFLGVIAILWILSVVGKWFNFLTLFYITFVLLHTLPVIYEKYDV  226

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF+EKA+ E KKQYAVFDAKVLSKIP+GPLK+KK
Sbjct  227  QIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPLKEKK  263



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  107  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEIN  166

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRD+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED
Sbjct  167  RGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIYDKYED  226

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EKAM ELKKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  227  KIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  263



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  IL LAVLFLWSNA +FI K+ P IP VH+PEEP+ QFASAL  ++N
Sbjct  84   LLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASALTIEIN  143

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A L  I SGRDLK FL++I G WIISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED
Sbjct  144  RGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYED  203

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D  AEKA+ E KKQYAVFD KVL+KIP+GPLK KKLA
Sbjct  204  KIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  242



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N
Sbjct  109  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEIN  168

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRDLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED
Sbjct  169  RGFSSLHEIASGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYED  228

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD++ EKAM ELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  229  KVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH  IL LA+LFLWSNA +FI K+ P IP+VHIPEEPVLQ ASAL  ++N
Sbjct  96   LIEYHLLTLVCHISILTLAILFLWSNAHTFINKTPPRIPQVHIPEEPVLQVASALTMEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H  AVLR IASG+DLK FL+VI   W +SIVG  C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  156  HGFAVLRSIASGKDLKKFLVVIAAFWALSIVGCWCNFLTLFYITFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKAM E+KKQYA+FDAKVLSKIP G LK K++
Sbjct  216  KVDPFAEKAMIEIKKQYAMFDAKVLSKIPVGALKAKRV  253



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  626  YHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCL  447
            YHLLT VCHGLIL+L +LFLWS A +FI KS P IPEV IPE+  +Q A  LR ++N  L
Sbjct  98   YHLLTFVCHGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRAL  157

Query  446  AVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVD  267
            AVLR++A GRD+K FL VI GLW++S+VGS  +FLTL YI  V LHTVPVLYEKYED+VD
Sbjct  158  AVLREVALGRDVKKFLTVIAGLWLLSMVGSSVNFLTLVYILFVTLHTVPVLYEKYEDKVD  217

Query  266  AFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            A AEKAM E+KKQYAV D KVLSKIPRGPLKDKK
Sbjct  218  AAAEKAMAEIKKQYAVLDDKVLSKIPRGPLKDKK  251



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI AL VLFLWSNASSFI K+ P IPEV IPE+ V+  A + R ++N
Sbjct  126  LLGYHLLTFVCHGLIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEIN  185

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRDLK FLMVI G W++S++GSCC+FLTL YI  V+LHTVPVLYEKYED
Sbjct  186  RAFANLRQIALGRDLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYED  245

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAVFD KVLSK+PRGP KDKK
Sbjct  246  QIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  282



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA++FI KS P IPEV + EEP LQ A+A+R ++N
Sbjct  105  LLEYHLLTLVCHILILALAILFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAVRFEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVLR+IASGRDLK FL V++GLW  SI+GS C+FLTLFYI  VLLHT+PVLYEKYED
Sbjct  165  RALAVLREIASGRDLKKFLAVVSGLWFFSILGSYCNFLTLFYITFVLLHTLPVLYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            +VD+FAEKAM E++K+YAVFD KVLSKIPRGP KDKK A
Sbjct  225  KVDSFAEKAMIEIRKKYAVFDEKVLSKIPRGPSKDKKRA  263



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LE HLLT VC+ LILAL +LFLWSNAS+FI KS PHIPEV IPEEPVLQ A+AL  ++N
Sbjct  92   LLECHLLTLVCYFLILALVLLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALTTEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               +VLRDIASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLLHTVPV YEKYED
Sbjct  152  WAFSVLRDIASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  212  QVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPLKGKK  248



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLL+ VCH LIL LA+LFLWSNAS+FI KS P  PEV I E  V+  ASAL  + N
Sbjct  98   LLEYHLLSLVCHFLILGLAILFLWSNASTFISKSRPKFPEVIISENVVVSVASALTIEFN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+LR++ASG+DLK FL VI GLW++S++GSC +FLTLFY   VLLHTVPVLYEKYED
Sbjct  158  RAFAILREVASGKDLKKFLAVIAGLWVLSVLGSCFNFLTLFYTCFVLLHTVPVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA HE+KKQYAVFD KVLSK+P+  LK KK 
Sbjct  218  QVDAFAEKAEHEIKKQYAVFDVKVLSKLPKAILKYKKF  255



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH  IL LAVLFLWSNA +FI K+ P IP VH+PEEP+ QFASAL  ++N
Sbjct  98   LLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAPPCIPTVHLPEEPIRQFASALTIEIN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A L  I SGRDLK FL++I G WIISIVGS C+FLTLFYI  VLLHTVPV+Y+KYED
Sbjct  158  RGFAALHAIGSGRDLKTFLIIIVGTWIISIVGSWCNFLTLFYIVFVLLHTVPVIYDKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D  AEKA+ E KKQYAVFD KVL+KIP+GPLK KKLA
Sbjct  218  KIDPLAEKALIEFKKQYAVFDEKVLNKIPKGPLKGKKLA  256



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPE+HIPE+P+LQ AS LR ++N
Sbjct  110  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEIHIPEDPLLQLASGLRIEIN  169

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRD+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED
Sbjct  170  RGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLIYDKYED  229

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EKAM ELKKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  230  KIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  266



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LIL+LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N
Sbjct  93   LLEYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK FL VI  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D
Sbjct  153  KGFYVLRNIASGRDLKAFLGVIAVLWILSVVGKWFNFLTLFYIIFVLLHTLPVIYEKYDD  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  213  QIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  249



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH  IL+LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N
Sbjct  100  LIEYHLLTLLCHISILSLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASGR+LK FL+V+   W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED
Sbjct  160  QALELLRDIASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  220  KVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  257



>gb|ABK23818.1| unknown [Picea sitchensis]
Length=164

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            L Y+LLT +CH LIL + +LF+WSNAS+FI K    IP++   E+     ASALR ++N 
Sbjct  8    LGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASALRFEINR  67

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
               V+ D+ASGRDLK FLMV+ GLWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+
Sbjct  68   LFTVIHDVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQ  127

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            VDAF  KAM E KK Y  FDAKVLSKIPRGPLKDKK 
Sbjct  128  VDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  164



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            L YHLLT VCHGLI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N 
Sbjct  122  LGYHLLTFVCHGLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINR  181

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
                LR IA GRD+K FLMVI GLW++S++GSCC+FLTL YI  V+LHTVPVLYEKYED+
Sbjct  182  AFVNLRQIALGRDIKKFLMVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQ  241

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +D++ EK   E+KKQYAVFD KVLSK+PRGP KDKK
Sbjct  242  IDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  277



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N
Sbjct  122  LLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEIN  181

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL YI  V+LHTVP+LYEKYED
Sbjct  182  RAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYED  241

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D++ EK   E+KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  242  QIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  278



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VLEYHLLT +CHG IL L +LFLWSNAS+F+ K  P+IPEV IPE+  +  A +LR ++N
Sbjct  90   VLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR I  GRDLK FL+V+ GLWI+S +GSCC+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  150  RGFASLRAIGQGRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKAM ELKK YA+FD K LSKIP+GP KDKK
Sbjct  210  KIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  246



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  113  LMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEIN  172

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              ++ LR+IASGRD+K FL  I GLW++SI+G C  FLTL YIA+VLL TVP+ Y+KYED
Sbjct  173  RGISSLREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYED  232

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD++ EKAM ELKKQYAV DAKV SKIPRGPLKDKK
Sbjct  233  KVDSYGEKAMAELKKQYAVLDAKVFSKIPRGPLKDKK  269



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VLEYHLLT +CHG IL L +LFLWSNAS+F+ K  P+IPEV IPE+  +  A +LR ++N
Sbjct  67   VLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEIN  126

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR I  GRDLK FL+V+ GLWI+S +GSCC+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  127  RGFASLRAIGQGRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLYEKYED  186

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKAM ELKK YA+FD K LSKIP+GP KDKK
Sbjct  187  KIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  223



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL  +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  115  LMEYHLLAVLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEIN  174

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRD+K FL  I GLW++SI+G CC FLTL YIA+VLL TVP++Y+KYED
Sbjct  175  RGFSSLHEIASGRDIKKFLSAIFGLWVLSILGGCCSFLTLAYIALVLLFTVPLVYDKYED  234

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EKAM ELKKQYAVFDAKVLSKIPRGPLK+KK
Sbjct  235  KIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPLKNKK  271



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT +CH LI +LAVLFLW+NAS+FI KS PHIPEV +PE+P+L+  + LR+++N
Sbjct  127  LLEYHLLTLICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGLRHELN  186

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+L DIA G+DLK FL VI GLWI+SIVG  C F+TLFYI  VLLHT+P+LYEKYED
Sbjct  187  RGLAMLHDIAMGKDLKKFLAVIAGLWILSIVGKSCGFITLFYINFVLLHTIPILYEKYED  246

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E KK Y V + K +SKIPRGPLK+KK
Sbjct  247  KVDAFAEKAMAEAKKHYGVINEKYISKIPRGPLKNKK  283



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 130/161 (81%), Gaps = 2/161 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeep--VLQFASALRND  462
            +LEYH LT VCH LIL+L++LFLWSNA++FI KS        +      VLQFASALR +
Sbjct  95   LLEYHFLTLVCHCLILSLSLLFLWSNATTFINKSQSPPRIPEVYIPEDPVLQFASALRIE  154

Query  461  VNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKY  282
            +N   +VLRDIASGRDLK FL+VI GLW++SIVGS C+FLTLFYI  VLLHTVPV YEKY
Sbjct  155  INSGFSVLRDIASGRDLKKFLVVIAGLWVLSIVGSWCNFLTLFYIVFVLLHTVPVFYEKY  214

Query  281  EDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ED+VD+FAEKAM E+KKQY VFDAKVLSKIPRGPLKDKK A
Sbjct  215  EDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPRGPLKDKKRA  255



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT VCHGLI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R ++N
Sbjct  122  LLGYHLLTFVCHGLIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEIN  181

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FLMVI GLW++S++GSCC+ LTL YI  V+LHTVPVLYEKYED
Sbjct  182  RAFANLRRIALGRDIKKFLMVIAGLWLLSVLGSCCNLLTLVYIVFVVLHTVPVLYEKYED  241

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EK   E+KKQYAVFD KVLSK+PRGP KDKK
Sbjct  242  QIDTYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKK  278



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH  IL LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N
Sbjct  94   LIEYHLLTLLCHISILCLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASGR+LK FL+V+   W++S+VGS C+FLTLFY + VLLHTVPVLYEKYED
Sbjct  154  QALKLLRDIASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTSFVLLHTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD FAEKA+ E+KKQYAVFDAKVL KIP GPLK KK+
Sbjct  214  KVDPFAEKAVIEIKKQYAVFDAKVLGKIPTGPLKTKKV  251



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  96   IMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GRDLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED
Sbjct  156  RGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  ELKK YA+F+ K LSKIP+GPLKDKK
Sbjct  216  KIDAFGEKAEIELKKYYALFEEKCLSKIPKGPLKDKK  252



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LE HLLT VC+ LILALA+LFLWSNAS+FI KS PHIPEV IPEEPVLQ A+ALR ++N
Sbjct  92   LLECHLLTLVCYFLILALALLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALRIEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               +VLRDIASGRDLK FL VI GLW++SIVGS C+FLTLFYIA VLL+TVPV YEKYED
Sbjct  152  WAFSVLRDIASGRDLKKFLTVIAGLWVLSIVGSWCNFLTLFYIAFVLLYTVPVFYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E+KKQYAVFDAKVLSKIP GPLK KK
Sbjct  212  QVDAFAEKAMIEIKKQYAVFDAKVLSKIPMGPLKGKK  248



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EY+LLT VCH  IL+LA++FLWSNA +FI KS P IPEVH+PEEP LQ A+AL  ++N
Sbjct  98   LIEYNLLTLVCHISILSLALMFLWSNAHTFIHKSPPRIPEVHLPEEPFLQVAAALTFELN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LRDIASGR+LK FLMVI   W++SIVGS C+FLTLFYI+ VLLHTV VLYEKYED
Sbjct  158  QALKLLRDIASGRNLKKFLMVIAAFWVLSIVGSWCNFLTLFYISFVLLHTVLVLYEKYED  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VD  AEKAM E+KKQYAVFDAKVLSKIP+GPLK KK+
Sbjct  218  KVDPCAEKAMIEIKKQYAVFDAKVLSKIPKGPLKTKKV  255



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YHLLT +CH +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  94   VMDYHLLTLLCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSLRFEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  G DLK FL+V+ GLW++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  154  RGFATLREIGQGHDLKKFLIVVVGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKAM ELKK YA+FD K LSKIP+GPLK+KK
Sbjct  214  QIDAFGEKAMIELKKYYAIFDEKCLSKIPKGPLKNKK  250



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT  CH LIL+LA++FLWSNA+  I KS PHIP V IPE  V+  A +LR ++N
Sbjct  94   LMEYHLLTLFCHCLILSLAIIFLWSNATFLINKSPPHIPVVSIPENLVVDIALSLRYEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IA+GRDLK FL+VI GLW++S VG CC+FLTLFYI  V LHT+P LY+KYED
Sbjct  154  RGFAVLREIATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  214  KVDAFAEKASVEFKKHYAVFQAKYLSKIPRGPLKDKKF  251



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            LEYH +T +CH LIL LA+LFLWSN ++FI KS PHIPEV IPE+     A +LR ++N 
Sbjct  135  LEYHFVTLLCHCLILTLALLFLWSNGTAFINKSPPHIPEVKIPEDVATNIALSLRYEINR  194

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
              +VLRDIASGRDLKMFL V+ GLW++SI+GSCC+FLTLFYI  V+LHTVPVLYEKYED+
Sbjct  195  AFSVLRDIASGRDLKMFLTVVAGLWVLSILGSCCNFLTLFYITFVVLHTVPVLYEKYEDQ  254

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            VD+F+EKAM E+KKQYAVFDAKVLSKIPRGPLK KK
Sbjct  255  VDSFSEKAMIEIKKQYAVFDAKVLSKIPRGPLKSKK  290



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH LI  LAV +LWSNAS+FI KS P IP+V IPE+ VL+ ASALR ++N
Sbjct  106  LLEYHLITLVCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELN  165

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL V+  LWI+S+VG   +FLTLFYI  VLLHT+PV+YEKY+D
Sbjct  166  KGFYVLRDIASGRDLKAFLGVVAVLWILSVVGKWFNFLTLFYILFVLLHTLPVIYEKYDD  225

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+K+KK
Sbjct  226  QIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPVKEKK  262



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 132/185 (71%), Gaps = 29/185 (16%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL  VCH LIL+LA+LFLWSNA++FI KS P IPEV IPE+  + FA +LR ++N
Sbjct  94   LMEYHLLALVCHCLILSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMV-----------------------------ITGLWIISIV  363
               AVLRDIASGRDLK FLMV                             I GLW++SIV
Sbjct  154  RGFAVLRDIASGRDLKKFLMVCCSVFLSNVSGSWSISMGVILFGILVFQVIAGLWVLSIV  213

Query  362  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  183
            GSCC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSKIPRG
Sbjct  214  GSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRG  273

Query  182  PLKDK  168
            PLK K
Sbjct  274  PLKKK  278



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  96   IMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GRDLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED
Sbjct  156  RGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKA  E KK YA+F+ K LSKIP+GPLKDKK
Sbjct  216  KVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPLKDKK  252



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT + H +IL LAVLFLWSNA+ FI KS P IP++HIPEEP+LQ AS LR ++N
Sbjct  101  LMEYHLLTLLSHVMILLLAVLFLWSNATMFIHKSPPKIPQLHIPEEPLLQLASGLRIEIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRDLK FL VI GLW++SI+G CC FLTL YIA+VLL TVP+LY+KYED
Sbjct  161  RGFSSLHEIASGRDLKKFLSVIAGLWVLSILGGCCSFLTLAYIALVLLFTVPLLYDKYED  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD + EKAM ELKKQYAVFDAKVLSKIP GPLK+KK
Sbjct  221  KVDPYGEKAMLELKKQYAVFDAKVLSKIPMGPLKNKK  257



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  96   IMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GRDLK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED
Sbjct  156  RGFATLREIGHGRDLKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKA  E KK YA+F+ K LSKIP+GPLKDKK
Sbjct  216  KVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPLKDKK  252



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   198 bits (503),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            L Y+LLT +CH LIL + +LF+WSNAS+FI K    IP++   E+     ASALR ++N 
Sbjct  103  LGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASALRFEINR  162

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
               V+ D+ASGRDLK FLMV+ GLWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+
Sbjct  163  LFTVIHDVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQ  222

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            VDAF  KAM E KK Y  FDAKVLSKIPRGPLKDKK 
Sbjct  223  VDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLL  + H LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N
Sbjct  129  LLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPKIPEVIIPEDLVVNIALSTRHEIN  188

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED
Sbjct  189  RAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYED  248

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  249  QIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  285



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLL  + H LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N
Sbjct  133  LLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEIN  192

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR IA GRD+K FL+VI GLW++SI+GSCC+FLTLFYI  V+LHTVPV+YEKYED
Sbjct  193  RAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIVFVVLHTVPVIYEKYED  252

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  253  QIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  289



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT VCH LIL+LAVLFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  96   VMEYHLLTLVCHCLILSLAVLFLWSNASTFINKSPPNIPEVKIPEDLTVNIALSLRYEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  GR+LK FL+VI GLWI+S++GS C+FLTLFYI  V L+TVPVLYEKYED
Sbjct  156  RGFATLREIGHGRELKKFLIVIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDA  EKA  ELKK YA+F+ K LSKIP+GPLKDKK
Sbjct  216  KVDALGEKAEIELKKYYALFEEKCLSKIPKGPLKDKK  252



>gb|KCW46475.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=158

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            +EYHL+T VCH LI  LA++FLW++AS+ I KS P+IPEV +PE+ VL+ AS LR + N 
Sbjct  1    MEYHLITLVCHILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANR  60

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
             LA+LR+IASGR+LK FL  I GLW++S+VGS  + +TLFYI  VLLHTVPV YEKYED+
Sbjct  61   GLALLREIASGRELKKFLAFIAGLWVLSMVGSWFNSVTLFYITFVLLHTVPVFYEKYEDQ  120

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            VD FAEKAM E+KKQ+AVF+ KVLSK+PRGPLKDKK
Sbjct  121  VDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPLKDKK  156



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VLEYHLLT +CHG IL L +LFLWSNAS+F+ K  P+IPEV IPE+  +  A +LR ++N
Sbjct  99   VLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR I  GRDLK FL+V+ GLWI+S +GS C+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  159  RGFASLRAIGQGRDLKKFLIVVAGLWILSALGSSCNFLTLFYIVFMVLYTVPVLYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKAM ELKK YA+FD K LSKIP+GP KDKK
Sbjct  219  KIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPSKDKK  255



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            L Y+LLT +CH LIL + +LF+WSNAS+FI K    IP++   E+     ASALR ++N 
Sbjct  103  LGYYLLTLICHVLILGITILFVWSNASAFINKQPVRIPQISFSEQLFQDVASALRFEINR  162

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
               V+ ++ASGRDLK FLMV+ GLWI+S++GS  +FLTLFY+A V  HTVPVLYEKYED+
Sbjct  163  LFTVIHNVASGRDLKKFLMVVAGLWILSVIGSWANFLTLFYVAFVFAHTVPVLYEKYEDQ  222

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            VDAF  KAM E KK Y  FDAKVLSKIPRGPLKDKK 
Sbjct  223  VDAFTFKAMDEAKKHYGTFDAKVLSKIPRGPLKDKKF  259



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA++FLWSNAS+FI KS P IPE+ +PE+ VL  A+A R + N
Sbjct  100  LLEYHLLTLVCHILILALALIFLWSNASTFINKSPPKIPEIIVPEDIVLGIAAAFRIEFN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+LRDIASGR+LK FL VI GLW++SI+G+  +FLTLFY   VLLHTVPVLYEKYED
Sbjct  160  RALAILRDIASGRELKKFLAVIAGLWVLSILGNYFNFLTLFYTCFVLLHTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDAFAEKA  ELKKQYAVF+ KVLSKIPRGPLKDKKL
Sbjct  220  QVDAFAEKAEAELKKQYAVFNTKVLSKIPRGPLKDKKL  257



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT VCH LI++LA+LFLWSNASSFI KS P+IPEV IPE+  +  A  LR ++N
Sbjct  52   VMEYHLLTLVCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEIN  111

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  G DLK FL+VI GLW+ S++GSCC+FLTLFYI  V L+T+PVLYEKYED
Sbjct  112  RGFATLREIGHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYED  171

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+FD K LSKIP+G LKDKK
Sbjct  172  KVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-LKDKK  207



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N
Sbjct  101  LLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL DIASGR+LK FL+VI GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED
Sbjct  161  WAFAVLHDIASGRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYED  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D FAEKA  E KK YAVFDAKVLSKIP+G LK+K+
Sbjct  221  KIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-LKNKR  256



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N
Sbjct  96   LLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL DIASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED
Sbjct  156  RGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  +EKA  ++KKQYAV D K +SKIPRGP K+KK
Sbjct  216  QVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPFKEKK  252



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N
Sbjct  105  LLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEIN  164

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL DIASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED
Sbjct  165  RGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYED  224

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  +EKA  ++KKQYAV D K +SKIPRGP K+KK
Sbjct  225  QVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPFKEKK  261



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT +CH  IL L +LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  87   VMEYHLLTLLCHCFILTLGILFLWSNASAFINKSPPNIPEVRIPEDLAVNVARSLRYEIN  146

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LRDI  GRDLK FL+VI GLW +S +GS C+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  147  RGFASLRDIGQGRDLKKFLIVIAGLWTLSALGSSCNFLTLFYIVFMVLYTVPVLYEKYED  206

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DA+ EKAM ELKK YA+FD K LSKIP+GP KDKK
Sbjct  207  KIDAYGEKAMIELKKYYAIFDEKCLSKIPKGPSKDKK  243



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT VCH LI++LA+LFLWSNASSFI KS P+IPEV IPE+  +  A  LR ++N
Sbjct  97   VMEYHLLTLVCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  G DLK FL+VI GLW+ S++GSCC+FLTLFYI  V L+T+PVLYEKYED
Sbjct  157  RGFATLREIGHGHDLKKFLIVIAGLWLFSVLGSCCNFLTLFYIVFVALYTIPVLYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+FD K LSKIP+G LKDKK
Sbjct  217  KVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-LKDKK  252



>gb|KJB24288.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=233

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA++FI KS P IPEV IP++PVL+FA ALR ++N
Sbjct  71   LLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEIN  130

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SIVG+ C+FLTLFYI  VLLHT+PVLYEKYED
Sbjct  131  RGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGNWCNFLTLFYIVFVLLHTLPVLYEKYED  190

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  177
            +VD   EKA HE+KKQYAVFDAKVLSKIP+ PL
Sbjct  191  KVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRPL  223



>dbj|BAH20346.1| AT4G11220 [Arabidopsis thaliana]
Length=153

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  617  LTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVL  438
            LT +CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N  ++ L
Sbjct  1    LTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSL  60

Query  437  RDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFA  258
            R+IASGRD+K FL  I GLW++SI+G C  FLTL YIA+VLL TVP+ Y+KYED+VD++ 
Sbjct  61   REIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLGYIALVLLFTVPLFYDKYEDKVDSYG  120

Query  257  EKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            EKAM ELKKQYAV DAKV SKIPRGPLKDKK
Sbjct  121  EKAMAELKKQYAVLDAKVFSKIPRGPLKDKK  151



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLLT + H LIL LA+LFLWSNAS+FI KS P IP+V IPE+PVLQ ASA+  ++N
Sbjct  100  LLGYHLLTLMAHCLILVLAMLFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAITIEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IASG+DLK FL VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D
Sbjct  160  RAFVILREIASGKDLKQFLSVIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDD  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAFAEKAM E+KKQYAVFDAKVLSK+P+G +KDKK
Sbjct  220  QVDAFAEKAMIEIKKQYAVFDAKVLSKVPKGQMKDKK  256



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  608  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  429
            VCH LILALA+LFLWSNA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDI
Sbjct  103  VCHLLILALAILFLWSNATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDI  162

Query  428  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  249
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKA
Sbjct  163  ASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKA  222

Query  248  MHELKKQYAVFDAKVLSKIPRGPLK  174
            MHE+KKQYAVFDAKVLSKIPRGPL 
Sbjct  223  MHEIKKQYAVFDAKVLSKIPRGPLN  247



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LILALA+LFLWSNA++FI KS P IPEV IP++PVL+FA ALR ++N
Sbjct  93   LLEYHLLTLVCHLLILALALLFLWSNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLRDIASGRDLK FL VI GLW++SIVG+ C+FLTLFYI  VLLHT+PVLYEKYED
Sbjct  153  RGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGNWCNFLTLFYIVFVLLHTLPVLYEKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  177
            +VD   EKA HE+KKQYAVFDAKVLSKIP+ PL
Sbjct  213  KVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRPL  245



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIK-KSAphipevhipeepVLQFASALRNDV  459
            ++EYHLLT  CH LIL+LA++FLWSNA+  I  +S PHIP V IPE  V+  A +LR ++
Sbjct  94   LMEYHLLTLFCHCLILSLAIIFLWSNATFLINNRSPPHIPVVSIPENLVVDIALSLRYEI  153

Query  458  NHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYE  279
            N   AVLR+IA+GRDLK FL+VI GLW++S VG CC+FLTLFYI  V LHT+P LY+KYE
Sbjct  154  NRGFAVLREIATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYE  213

Query  278  DEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            D+VDAFAEKA  E KK YAVF AK LSKIPRGPLKDKK 
Sbjct  214  DKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGPLKDKKF  252



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  608  VCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDI  429
            VCH LILALA+LFLWSNA++FI KS P IPEV IP+EPVL+FA ALR ++N   AVLRDI
Sbjct  103  VCHLLILALAILFLWSNATTFINKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDI  162

Query  428  ASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKA  249
            ASGRDLK FL VI GLW++SIVGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKA
Sbjct  163  ASGRDLKKFLSVIAGLWVLSIVGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKA  222

Query  248  MHELKKQYAVFDAKVLSKIPRGPLK  174
            MHE+KKQYAVFDAKVLSKIPRGPL 
Sbjct  223  MHEIKKQYAVFDAKVLSKIPRGPLN  247



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLLT V H LIL +A LFLWSNAS+FI KS PHIP+V IPE+ VLQ AS +  ++N
Sbjct  101  LFEYHLLTLVSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKLVLQIASVITLEIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IASG+DLK FL VI GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D
Sbjct  161  RAFVILREIASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIAVVLLFTLPVFYEKYDD  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDA AEKA+ E+KKQYAVFDAKV+SKIPRG LKDKK 
Sbjct  221  QVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH +I  L++LFLWSN + FI K  P IP V + EEP +  A ALRN++N
Sbjct  101  LLEYHLLTLVCHIVIFTLSMLFLWSNVTIFINKRPPPIPVVSLSEEPFVGVALALRNEIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVLR+IASGRDLK FL+V+  LW  SIVGSCC+FLTLFY+  VLLHTVPVLYEKY +
Sbjct  161  RTCAVLREIASGRDLKKFLVVVAVLWFFSIVGSCCNFLTLFYLVFVLLHTVPVLYEKYNE  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++DAF EKA  E+KKQYAVFDAK L KIP+GP  DKK A
Sbjct  221  KIDAFTEKATVEIKKQYAVFDAKFLCKIPKGPF-DKKRA  258



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHL+T VCH LI  LA++FLW++AS+ I KS P+IPEV +PE+ VL+ AS LR + N
Sbjct  97   LMEYHLITLVCHILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEAN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+LR+IASGR+LK FL  I GLW++S+VGS  + +TLFYI  VLLHTVPV YEKYED
Sbjct  157  RGLALLREIASGRELKKFLAFIAGLWVLSMVGSWFNSVTLFYITFVLLHTVPVFYEKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKAM E+KKQ+AVF+ KVLSK+PRGPLKDKK
Sbjct  217  QVDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPLKDKK  253



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  117  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  176

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  177  RGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  236

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  237  KVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKK  273



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YHLLT +CH +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A ++R ++N
Sbjct  94   VMDYHLLTLLCHCIILTLAMLFLWSNASTFINKSPPNIPEVKIPEDLAVNVARSVRFEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  G DLK FL+V+ GLW++S++GSCC+FLTLFYI  ++L+TVPVLYEKYED
Sbjct  154  RGFATLREIGLGHDLKKFLIVVAGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKA+ ELKK YA+FD K LSKIP+GP K+KK
Sbjct  214  QIDAFGEKAVIELKKYYAIFDEKCLSKIPKGPSKNKK  250



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EY+LLT VCH LIL+LA+ FLWSNA SFI KS P IP+VH+PEEPVLQ ASAL  ++N
Sbjct  94   LVEYNLLTLVCHILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASALCVEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR IA+G+DLK FL+VI GLW++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED
Sbjct  154  GAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            ++D  AEKAM E+K+QYAVFDAKVLSKIP   LK KK+
Sbjct  214  KIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAALKAKKV  251



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS LR  +N
Sbjct  183  LLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQIN  242

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL DIASGR+LK FL+VI GLW++SIVG+ C+FLTLFYI+ VLLHTVPV+YEKYED
Sbjct  243  WAFAVLHDIASGRELKKFLIVIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIYEKYED  302

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D FAEKA  E KK YAVFDAKVLSKIP+G LK+K+
Sbjct  303  KIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-LKNKR  338



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLLT V H LIL +A LFLWSNAS+FI KS PHIP+V IPE+PVLQ AS +  ++N
Sbjct  101  LFEYHLLTLVSHLLILGIASLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASVITMEIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IASG+DLK FL VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D
Sbjct  161  RAFVILREIASGKDLKQFLSVIAGLWVVSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDD  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDA AEKA+ E+KKQYAVFDAKV+SKIPRG LKDKK 
Sbjct  221  QVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQLKDKKF  258



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EY+LLT VCH LIL+LA+ FLWSNA SFI KS P IP+VH+PEEPVLQ ASAL  ++N
Sbjct  94   LVEYNLLTLVCHILILSLALSFLWSNAHSFINKSPPRIPQVHLPEEPVLQVASALCVEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR IA+G+DLK FL+VI GLW++SIVGS C FLTLFYI  VLLHTVPVLYEK+ED
Sbjct  154  GAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLYEKFED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            ++D  AEKAM E+K+QYAVFDAKVLSKIP   LK KK+
Sbjct  214  KIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAALKAKKV  251



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  114  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  173

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  174  RGFSTLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  233

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKA+ ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  234  KVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  270



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLL  +CH  I ALA LFLWSNA +FI K++PHIPEV+IPE+PVLQ  S LR ++N
Sbjct  96   LFEYHLLAFLCHFAIFALAALFLWSNACTFIHKASPHIPEVNIPEDPVLQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L VLR+IASG+D+K F++VI GLW++SI+GSC +FLTLFYIA VLL T+PVLYEKYED
Sbjct  156  RGLTVLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYIATVLLFTIPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KVLSKIPRG L  KK
Sbjct  216  KVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  116  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  175

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL+ I GLW++SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  176  RGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  235

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKA+ ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  236  KVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  272



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLL  VCH LIL+LA LFLWSNA +FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  100  VMEYHLLNLVCHCLILSLATLFLWSNACTFINKSPPNIPEVKIPEDLTVNIALSLRYEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LRDI  GRDLK FL+VI  LW++S++G+CC+FLTL YI  V+L+TVPVLYEKYED
Sbjct  160  RGFSTLRDIGHGRDLKKFLIVIASLWVLSVLGNCCNFLTLSYIVFVVLYTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+F+ K LSKIP+G LK+KK
Sbjct  220  KVDAFGEKAMIELKKYYAIFEEKCLSKIPKGHLKNKK  256



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VC+  I +LAVLFLWSNAS+F+ KS P IPEV +PE+ V + AS LR ++N
Sbjct  96   LLEYHLITLVCYLSIFSLAVLFLWSNASNFLNKSPPKIPEVLLPEKCVREVASGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              +AVL DIASGRDLK FL VI GL ++S+VGSCC+FLTL YI+ VLLHTVPVLYEKYED
Sbjct  156  RGVAVLHDIASGRDLKKFLAVIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  +EK+  ++KKQYA+ D K LSKIPRGP K+KK
Sbjct  216  QVDGCSEKSWIQIKKQYALLDEKYLSKIPRGPFKEKK  252



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LI+ + +LFLWSNAS+FI KS PHIP+V IPE+PVLQ ASA+ +++N
Sbjct  101  LLEYHLLTLVSHLLIIGIVMLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAITSEIN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                ++R+IASG+DLK FL  I GLW++SI+G   +FLTL YIAVVLL T+PV YEKY+D
Sbjct  161  RAFVIVREIASGKDLKQFLSAIAGLWVVSILGKYYNFLTLVYIAVVLLFTLPVFYEKYDD  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            +VDA AEKA+ E+KKQYAVFDAKVLSKIPRG  K KK 
Sbjct  221  QVDAVAEKALTEMKKQYAVFDAKVLSKIPRGQTKAKKF  258



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  118  LMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  177

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  178  RGFSTLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  237

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKA+ ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  238  KVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY L+T VCH LI+ LA+ FLWS A++FI K+ P IP+V +PE+ +LQ  ++LR ++N
Sbjct  92   LLEYQLITLVCHILIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSLRIEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              ++ LRD+ASGRDL+ FL    GLWI+SI GS C+FLTL Y+  +LLHTVPVLYEKYED
Sbjct  152  RIISTLRDVASGRDLRKFLSAFLGLWILSIAGSWCNFLTLLYMCFILLHTVPVLYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FAEKA+ ELKKQYA FDAKVLSKIP GPL++KK
Sbjct  212  QVDPFAEKALIELKKQYAEFDAKVLSKIPLGPLQEKK  248



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  107  LIEYHLLTLLCHVMIVLLAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEIN  166

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR IASGRDLK FL  I GLW++S++G CC FLTL YIA+VLL T+P+LY+KYED
Sbjct  167  RGFSSLRQIASGRDLKKFLSAIVGLWVLSVLGGCCSFLTLAYIALVLLFTLPLLYDKYED  226

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD++ EKAM ELKKQYAVFDAKVLSKIPRGPLKDKK
Sbjct  227  KVDSYGEKAMAELKKQYAVFDAKVLSKIPRGPLKDKK  263



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YHLLT +CH +IL LA+LFLWSNAS+FI KS P+IPEV IPE+  +  A +LR ++N
Sbjct  90   VMDYHLLTLLCHCVILTLAILFLWSNASTFINKSPPNIPEVRIPEDLAVNVARSLRFEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A LR+I  G DLK FL+V+ GLWI+S++GSCC+FLTLFYI  + L+TVPVLYEKY+D
Sbjct  150  RGFATLREIGQGHDLKKFLIVVAGLWILSVLGSCCNFLTLFYIVFMALYTVPVLYEKYDD  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++DAF EKAM ELKK  A+FD K L+KIP+GP K+KK
Sbjct  210  KIDAFGEKAMIELKKYCAIFDEKCLAKIPKGPSKNKK  246



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  118  LMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  177

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  178  RGFSSLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  237

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKA+ ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  238  KVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPE+HIPEEP+LQ AS LR ++N
Sbjct  117  LMEYHLLTLICHVMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGLRIEIN  176

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGR+LK FL+ I GLWI+SI+G C +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  177  RGFSSLREIASGRELKKFLIAIFGLWILSILGGCFNFLTLAYIALVLLFTVPLAYDKYED  236

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKA+ ELKKQYAV D KVLSKIP GPLK+KK
Sbjct  237  KVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPLKNKK  273



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  117  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  176

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L+ LR+IASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  177  RGLSSLREIASGRDLKKFLCAIVGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYED  236

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  237  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  273



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LI A+ + FLWSN   FI KS P IPE+ IPE+ +LQ  S++  ++N
Sbjct  89   LLEYHLLTLVAHVLIAAITLFFLWSNGLGFINKSPPKIPEIQIPEKTLLQIVSSITFEIN  148

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L V+RDIASG+DLK FL VI GLW++SI+G  C+FLTL YIA+VLL +VPV YEKY+ 
Sbjct  149  RALVVIRDIASGKDLKQFLSVIAGLWVVSILGKSCNFLTLLYIAIVLLFSVPVFYEKYDH  208

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
            ++D  AEKAM E+KKQYAVFDAKVLSKIPRG LK KK+
Sbjct  209  KIDPLAEKAMFEIKKQYAVFDAKVLSKIPRGALKAKKI  246



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  605  CHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIA  426
            CH +I+ALAVLFLWSNA+ FI KS P IPEVHIPE+P+LQ AS LR ++N   + L +IA
Sbjct  119  CHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIA  178

Query  425  SGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAM  246
            SGRDLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM
Sbjct  179  SGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAM  238

Query  245  HELKKQYAVFDAKVLSKIPRGPLKDKK  165
             ELKKQYAV DAKVLSKIPRGPLKDKK
Sbjct  239  AELKKQYAVLDAKVLSKIPRGPLKDKK  265



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ + H LI+ LAVLF+WSNAS FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  109  LMEYHLLSLLSHVLIVVLAVLFIWSNASMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  168

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LRDIASGRDLK FL  I GLW++SIVG CC+FLTL YI +V+L T+PVLYEK+ED
Sbjct  169  RAFTCLRDIASGRDLKKFLTAIAGLWVLSIVGGCCNFLTLSYIGMVMLFTIPVLYEKHED  228

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDA+ EKAM E+KKQYAV D KVLSKIPRGPLK KK
Sbjct  229  KVDAYGEKAMVEMKKQYAVLDEKVLSKIPRGPLKGKK  265



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  IL LA+LFLWSNAS+F+ KS P IP++ +PE+ VL+ ASALR ++N
Sbjct  90   LLEYHLITLVCHISILTLAILFLWSNASTFVNKSPPEIPQIVLPEKYVLEIASALRIEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LAVL DIA+GRD+K FL VI  LW++SI+GS  +FLTL YI  VLLHTVP+ YEKYED
Sbjct  150  RALAVLHDIAAGRDVKTFLTVIASLWVLSIIGSWFNFLTLLYIVFVLLHTVPLAYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AEKA  E+KKQY VFD KVLSKIP G LK+ K
Sbjct  210  QIDPIAEKAWIEIKKQYVVFDEKVLSKIPVGLLKELK  246



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  118  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  177

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L+ LR+IASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  178  RGLSSLREIASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYED  237

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  238  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  118  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  177

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L+ LR+IASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  178  RGLSSLREIASGRDLKKFLCAIFGLWVLSIMGGWFNFLTLAYIALVLLFTVPLVYDKYED  237

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  238  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPLKNKK  274



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  605  CHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIA  426
            CH LI  LAVLFLWSNAS+FI K+ P IP+VHIP+  +L+F S LR ++N  L+VLRDIA
Sbjct  138  CHILIFTLAVLFLWSNASAFIHKAPPRIPDVHIPDNALLEFISVLRFEINRALSVLRDIA  197

Query  425  SGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAM  246
            SG++LK F  VI GLW++S+VGS  +FLTL Y+  VLLHTVPVLYEKYED VDAFAEKA 
Sbjct  198  SGKELKKFFGVIAGLWVVSVVGSWFNFLTLVYLLFVLLHTVPVLYEKYEDHVDAFAEKAA  257

Query  245  HELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
             ELKKQYAV D K LSKIPRGPLKDKK A
Sbjct  258  IELKKQYAVADEKFLSKIPRGPLKDKKSA  286



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  ILALA LFLWS+A +FI K+ PHIPE+HIPEE VLQ AS LR ++N
Sbjct  95   LLEYNLLTLFGHITILALACLFLWSSAITFIHKTPPHIPEIHIPEEVVLQLASGLRIEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LRDIASGRDLK FL+VI GLW++SIVGS C+FLTL YIA +LL TVPVLYEKYED
Sbjct  155  RGFTTLRDIASGRDLKKFLLVIAGLWLLSIVGSSCNFLTLIYIATILLFTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQYAVFD    +KV+SKIPRG    KK
Sbjct  215  KVDDFGEKAMKEIKKQYAVFDEKVLSKVMSKIPRGAFNKKK  255



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V+EYHLLT V H LIL+LA LFLWSN   FI KS P+IPEV IPE+  +  A +LR+++N
Sbjct  98   VMEYHLLTLVGHCLILSLATLFLWSNVCIFIHKSPPNIPEVKIPEDLTVNIALSLRHEIN  157

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L  LR+I  GRDLK FL+VI GLW++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D
Sbjct  158  RGLFTLREIGHGRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDD  217

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+F+ KVLSKIP+G LK+KK
Sbjct  218  KVDAFGEKAMIELKKYYAIFEEKVLSKIPKGALKNKK  254



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  117  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  176

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  177  RGFSSLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYED  236

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  237  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  117  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEIN  176

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  + GLW++S++G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  177  RGFSSLREIASGRDLKKFLSAVAGLWVLSVLGGWFNFLTLAYIALVLLFTVPIVYDKYED  236

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  237  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  273



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  112  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEIN  171

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  I GLW++SI+G   +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  172  RGFSSLREIASGRDLKKFLTAIAGLWVMSILGGWFNFLTLAYIALVLLFTVPLAYDKYED  231

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  232  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  268



>ref|XP_004965478.1| PREDICTED: reticulon-like protein B2-like [Setaria italica]
Length=257

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL YHLLT + H LI  LA+LFL S A++FIKKS P+IP V IPE+ V+  + ALRND+N
Sbjct  99   VLGYHLLTLISHVLIGVLAILFLLSKATTFIKKSPPNIPLVEIPEDLVVNVSQALRNDIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + R+IA G DLK FL VI GLWI+S VGSCCDFLTL YIAV++LHTVP+LY+KY+D
Sbjct  159  RALHLFREIAMGHDLKKFLGVIVGLWILSSVGSCCDFLTLIYIAVLMLHTVPILYDKYQD  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA +A  E +KQY V DAKVLSKIPRGP K KK
Sbjct  219  KVDHFAGRAHTEARKQYEVLDAKVLSKIPRGPAKPKK  255



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLL  +CH  I ALA LFLWSNA +FI KS PHIPEVHIPE+P+LQ  S LR ++N
Sbjct  96   LFEYHLLAFLCHFAIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IASG+D+K F++VI GLW++SI+GSC +FLTLFY A VLL T+PVLYEKYED
Sbjct  156  RGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVL----SKIPRGPLKDKK  165
            +VDA+ EKAM E+KKQYAV D KVL    SKIPRG L  KK
Sbjct  216  KVDAYGEKAMREIKKQYAVLDEKVLRKVISKIPRGALNKKK  256



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT VCH LILALA+LFLWSNAS+FI KS P +P+V+IPE+PVLQ A+ALR ++N
Sbjct  99   LVEYHLLTLVCHLLILALALLFLWSNASTFINKSPPRLPDVYIPEDPVLQVAAALRIEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              LA+LR+IASGRDLK FL VI GLW++S+ G+  +FLTLFY A VLL TVPV+YEKYED
Sbjct  159  RGLAILREIASGRDLKKFLSVIAGLWVLSVAGNLFNFLTLFYTAFVLLFTVPVIYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLK  174
            +VD FAEKA+ E+KKQY VFDAKVLSK+PRGPLK
Sbjct  219  KVDPFAEKAIIEIKKQYKVFDAKVLSKLPRGPLK  252



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+Y+LLT   H  ILALAVLFLWS+A++FI K+ PHIPEVHIPE+ VLQ AS LRN++N
Sbjct  90   LLQYNLLTLFGHISILALAVLFLWSSATTFIHKTPPHIPEVHIPEDVVLQLASGLRNEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IA GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL TVPVLYEKYED
Sbjct  150  RGFTLLRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVLYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQYAV D    +KV+SKIPRG    KK
Sbjct  210  KVDDFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEP+LQ AS LR ++N
Sbjct  110  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEIN  169

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK FL  I GLW +SI+G   +FLTL YIA+VLL TVP+ Y+KYED
Sbjct  170  RGFSSLREIASGRDLKKFLAAIAGLWFVSILGGWFNFLTLAYIALVLLFTVPLAYDKYED  229

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  230  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  266



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            LEYHL+T  CH +IL LAV FLWSN SSFI K+ P IP+V IPE+ VL  ASALR ++N 
Sbjct  118  LEYHLITLFCHIMILFLAVFFLWSNGSSFINKAPPEIPKVQIPEKCVLDIASALRIELNK  177

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
               VLR+IASGRDLK FL VI  LWI+S++G C  FLTLFY+  VLLH+ P++YEK+ED+
Sbjct  178  GFHVLREIASGRDLKTFLGVIAVLWIVSVIGKCFSFLTLFYLTFVLLHSAPLIYEKHEDQ  237

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +DA AEKA  E KKQYAVF+ KVLSKIP+GP+K+KK
Sbjct  238  IDAVAEKAWIEFKKQYAVFNEKVLSKIPKGPVKEKK  273



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL++ +LFLWSNA + + K+ P IP  H+PEEP L+ ASALR ++N
Sbjct  97   LLEYHLLTLVCHILILSITLLFLWSNAHTLLHKAPPRIPVFHLPEEPFLEIASALRIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H  A LRDI +G+D+K FL+ I GLWI+SIVGS C+FLTLFYI  VLL T+P LY+KYED
Sbjct  157  HGFAALRDIGTGKDVKKFLIAIVGLWILSIVGSWCNFLTLFYINFVLLLTIPFLYDKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  168
            ++D  AEKA HE+KKQY VFDA    KVLSKIP+G LK K
Sbjct  217  KIDPLAEKAAHEIKKQYVVFDAKVLSKVLSKIPKGLLKGK  256



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLLT VCH LILALA+LFLW+NA +FIKK+ P IPEVH+PEEP LQ ASA R ++N
Sbjct  95   LFEYHLLTLVCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H  AVLR IASGRDLK FLM I  LW++S+VGS C+FLTLFYIA+VLLH VPVLYEKYED
Sbjct  155  HAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHIVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIP  189
            ++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  215  KIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FI K++P IPE+H+PEE  L  AS+LRN++N
Sbjct  96   LVEYHLLSLLCHISILALGGLFLWSNAHTFINKTSPQIPEIHVPEEAFLVIASSLRNELN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED
Sbjct  156  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKAM EL+KQY VFD KVLSKIP   LK K
Sbjct  216  KVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  251



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 132/192 (69%), Gaps = 36/192 (19%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N
Sbjct  95   LLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIA----------------  324
              LAVLR+IASGRDLK FL VI GLW++SIVG+ C+F+TLFYI                 
Sbjct  155  RALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIV  214

Query  323  ----------------VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KV  204
                             VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KV
Sbjct  215  FLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKV  274

Query  203  LSKIPRGPLKDK  168
            LS+IP+G LK K
Sbjct  275  LSRIPKGALKKK  286



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LA LFLWSNA+ FI+KS P IPEVHIPE+P+LQ AS LR ++N
Sbjct  155  LMEYHLLTLLCHVMIVTLAALFLWSNATMFIRKSPPKIPEVHIPEDPLLQLASGLRIEIN  214

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + L +IASGRDLK FL  + GLWI+SI+G CC FLTL YIA+VLL TVP++Y+KYED
Sbjct  215  RGFSSLHEIASGRDLKKFLSALFGLWILSILGGCCSFLTLAYIALVLLFTVPLVYDKYED  274

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD++ EKAM ELK QYAV DAKVLSKIPR   K+KK
Sbjct  275  KVDSYGEKAMAELKNQYAVLDAKVLSKIPRWTSKNKK  311



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 132/192 (69%), Gaps = 36/192 (19%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHL+T VCH  IL+LAVLFLWSNAS+FI KS P IP V +PE+ VL+FASALR ++N
Sbjct  95   LLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIA----------------  324
              LAVLR+IASGRDLK FL VI GLW++SIVG+ C+F+TLFYI                 
Sbjct  155  RALAVLREIASGRDLKKFLGVIAGLWLLSIVGNWCNFVTLFYIGKKHSLVLMAYFLKWIV  214

Query  323  ----------------VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KV  204
                             VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KV
Sbjct  215  FLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKV  274

Query  203  LSKIPRGPLKDK  168
            LS+IP+G LK K
Sbjct  275  LSRIPKGALKKK  286



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V + LI ALA+LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N
Sbjct  104  LLEYHLLTLVGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L DIASGRDLK FL VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YEKYED
Sbjct  164  CGFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYEKYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AEKA  E KKQYAVFDAKVLSKIP G LK K+
Sbjct  224  KIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FIKKS P IPE+H+PEE  L  AS+LRN+VN
Sbjct  92   LVEYHLLSLLCHISILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMVI GLWIIS+VG+  +FLTL YI  V+LHTVP++YEK+ED
Sbjct  152  QAFVILRSIALGRDLKKFLMVIVGLWIISVVGNWFNFLTLVYICFVVLHTVPMMYEKHED  211

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD FAEKAM EL+KQY VFD KV+SKIP   LK K
Sbjct  212  KVDPFAEKAMKELQKQYLVFDEKVISKIPIASLKAK  247



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT V H LI ALA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N
Sbjct  104  LLQYHLLTLVGHILIGALAILFLWSNAHAFIHKTPPRIPEVRLPEEPFLQVASELRVQIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L DIASGRDLK FL VI GLW++S+VG  C+FLTLFYI  V+LHTVPV+YEKYED
Sbjct  164  CAFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVVLHTVPVIYEKYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AE+A  E KKQYA FDAKVLSKIP G LK+K+
Sbjct  224  KIDPLAERATIEFKKQYAXFDAKVLSKIPHG-LKNKR  259



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N
Sbjct  77   LLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEIN  136

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED
Sbjct  137  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYED  196

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRG  183
            +VD F EKAM E+KKQY  FD    +KV+SKIP+G
Sbjct  197  KVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG  231



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LAVLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N
Sbjct  93   LLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L  I SGRDLK FL++I G+WI+SIVG+ C+FLTLFYI  VLLHTVPVLYEKYED
Sbjct  153  RGFAILHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLLHTVPVLYEKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            ++D  AEKA+ E+KKQY VFDAKVLSKIP GPLK K
Sbjct  213  KIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPLKAK  248



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N
Sbjct  96   LVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED
Sbjct  156  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKAM EL+KQY VFD KVLSKIP   LK K
Sbjct  216  KVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  251



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSN + FI KS P IP+VHIPEEPVLQ AS LR ++N
Sbjct  118  LMEYHLLTLLCHVMIVVLAVLFLWSNVTRFIHKSPPKIPQVHIPEEPVLQLASGLRIEIN  177

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               + LR+IASGRDLK F+  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  178  RGFSSLREIASGRDLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYED  237

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  238  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  274



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N
Sbjct  106  LLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEIN  165

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D
Sbjct  166  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDD  225

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  226  KVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  266



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEPVLQ AS LR ++N
Sbjct  116  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGLRIEIN  175

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LR+IASGRDLK F+  I GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  176  RGFYSLREIASGRDLKKFISAIAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYED  235

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  236  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  272



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N
Sbjct  93   LLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D
Sbjct  153  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDD  212

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  213  KVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  253



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N
Sbjct  97   LVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED
Sbjct  157  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKAM EL+KQY VFD KVLSKIP   LK K
Sbjct  217  KVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  252



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FI K+ P IPEVH+PE+  L  AS+LRN++N
Sbjct  96   LVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP+LYEK+ED
Sbjct  156  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVILHTVPMLYEKHED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKAM EL+KQY VFD KVLSKIP   LK K
Sbjct  216  KVDPLAEKAMKELQKQYVVFDEKVLSKIPVASLKAK  251



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  IL LAVLFLWS+AS+FI K+ PHIPEVHIPEE VLQ AS LR ++N
Sbjct  94   LLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEIN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKY+D
Sbjct  154  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYDD  213

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQY VFD    +KV+SKIP+G    KK
Sbjct  214  KVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIPKGAFYKKK  254



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N
Sbjct  92   LLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEIN  151

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED
Sbjct  152  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYED  211

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRG  183
            +VD F EKAM E+KKQY  FD    +KV+SKIP+G
Sbjct  212  KVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG  246



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V + LI ALA+LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS LR  +N
Sbjct  104  LLEYHLLTLVGYILICALAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L DIASGRDLK FL VI GLW++S+VG  C+FLTLFYI  VLLHTVPV+YE+YED
Sbjct  164  CGFALLHDIASGRDLKKFLAVIAGLWVLSVVGKWCNFLTLFYICFVLLHTVPVIYERYED  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AEKA  E KKQYAVFDAKVLSKIP G LK K+
Sbjct  224  KIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-LKSKR  259



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 131/189 (69%), Gaps = 31/189 (16%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH  IL+LAVLFLWSN  +FI K+ P IP+VH+PEEP LQ ASAL  ++N
Sbjct  100  LIEYHLLTLLCHISILSLAVLFLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYI-----------------  327
              L +LRDIASGR+LK FL+V+   W++S+VGS C+FLTLFY                  
Sbjct  160  QALELLRDIASGRNLKKFLVVVAAFWVLSVVGSWCNFLTLFYTCNDTGLLFLVPSSFIYT  219

Query  326  --------------AVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  189
                          A VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSKIP
Sbjct  220  NFILNFDPSSLWKSAFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIP  279

Query  188  RGPLKDKKL  162
             GPLK KK+
Sbjct  280  TGPLKSKKV  288



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 126/189 (67%), Gaps = 32/189 (17%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHLL  + H LI +L VLFLWSNASSFI KS P IPEV IPE+ V+  A + R+++N
Sbjct  48   LLGYHLLAFLGHALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEIN  107

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIA----------------  324
               A LR IA GRD+K FL+VI GLW++SI+GSCC+FLTLFYI                 
Sbjct  108  RAFANLRQIALGRDIKKFLIVIAGLWLLSILGSCCNFLTLFYIGEGSQLSIPFLAPLLPN  167

Query  323  ----------------VVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  192
                             V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+
Sbjct  168  VDLVFTVDLSLLCQTVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKV  227

Query  191  PRGPLKDKK  165
            PRGPLKDKK
Sbjct  228  PRGPLKDKK  236



>ref|XP_009109295.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=269

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH +I+ LAVLFLWSNA+ FI KS P IPEVHIPEEPVLQ AS LR ++N
Sbjct  111  LMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGLRIEIN  170

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LR+IASGRDLK F+  + GLW++SI+G   +FLTL YIA+VLL TVP++Y+KYED
Sbjct  171  RGFHSLREIASGRDLKKFISAVAGLWVLSILGGWFNFLTLAYIALVLLFTVPLVYDKYED  230

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD   EKAM E+KKQYAV D KVLSKIP GPLK+KK
Sbjct  231  KVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPLKNKK  267



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            + EYHLLT VCH LILALA+LFLW+NA +FIKK+ P IPEVH+PEEP LQ ASA R ++N
Sbjct  95   LFEYHLLTLVCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
            H  AVLR IASGRDLK FLM I  LW++S+VGS C+FLTLFYIA+VLLH +PVLYEKYED
Sbjct  155  HAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIP  189
            ++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  215  KIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LAVLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN
Sbjct  102  LLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVN  161

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL  I SGRDLK FL+VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D
Sbjct  162  RGFAVLHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDD  221

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            ++D  AEKA+ E+KKQYAVFDAKVLSKIP GPLK K
Sbjct  222  KIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGPLKAK  257



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LAVLFLWSNA +FI KS P IPE H+PEEP LQ ASALR +VN
Sbjct  102  LLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVN  161

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL  I SGRDLK FL+VI  +WI+SIVG+ C+FLTLFYI  +LLHTVPVLYEKY+D
Sbjct  162  RGFAVLHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDD  221

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            ++D  AEKA+ E+KKQYAVFDAKVLSKIP GPLK K
Sbjct  222  KIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGPLKAK  257



>gb|EMT25698.1| Reticulon-like protein B2 [Aegilops tauschii]
Length=258

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I  LA+LF+WS A +FIKKS P IP V IPE+  L  + ALRNDVN
Sbjct  101  VLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLALNVSRALRNDVN  160

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IA G DLK FL VI GLW++S VGSCCDFLTL YIAV+++HTVP+LY+KY+D
Sbjct  161  RSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILYDKYQD  220

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  E  K Y V D KVLSKIPRGP K KK
Sbjct  221  KVDHFAGKAHTEACKHYQVLDQKVLSKIPRGPAKTKK  257



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  ILALAVLFLWS+AS+FI KS  HIPEVHIPE+ VLQ AS LR ++N
Sbjct  108  LLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEIN  167

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED
Sbjct  168  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYED  227

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRG  183
            +VD F EKAM E+KKQY  FD    +KV+SKIP+G
Sbjct  228  KVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG  262



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N
Sbjct  99   LLEYNLLTLVAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L +IASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVPV+YEKYED
Sbjct  159  CAFALLHNIASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPVIYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AEK   E KKQYAVFDAKVL+KIPRG LK+K+
Sbjct  219  KIDPLAEKVTIEFKKQYAVFDAKVLNKIPRG-LKNKR  254



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYH LT +CH  + ALA LFLWSNA +FI KS PHIPEVHIPE+PVLQ  S LR ++N
Sbjct  96   LIEYHFLTFLCHFAMAALAALFLWSNACTFIHKSTPHIPEVHIPEDPVLQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK F++VI GLW++SI+GSCC+FLTLFYIA VLL T+PV+YEKYED
Sbjct  156  RGFTVLRNIASGRDLKKFILVIAGLWVLSIIGSCCNFLTLFYIATVLLFTIPVVYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KVLSKIPRG L  KK
Sbjct  216  KVDAFGEKAMKEIKKQYAVLDEKVFSKVLSKIPRGALNKKK  256



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+YHLLT V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS LR  +N
Sbjct  103  LLQYHLLTLVAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVIN  162

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L  IASG+DLK FL VI GLW++S+VG  C+FLTLFYI+ VLLHTVP +YEKYED
Sbjct  163  CAFALLHSIASGKDLKKFLAVIAGLWVLSVVGKWCNFLTLFYISFVLLHTVPFIYEKYED  222

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            ++D  AEK + E KKQYAVFDAKVLSKIPRG LK+K+
Sbjct  223  KIDPLAEKVIIEFKKQYAVFDAKVLSKIPRG-LKNKR  258



>gb|ABK22748.1| unknown [Picea sitchensis]
Length=248

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  632  LEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNH  453
            +EYH LT VCH LIL+LA+LF+W N+++F+K+S PHIPE+ I E  +   AS LR +VN 
Sbjct  91   MEYHFLTFVCHVLILSLAILFIWINSAAFLKRSPPHIPEIAISEVAIHNVASELRVEVNR  150

Query  452  CLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  273
              +VL ++A+GRD K +L+V+ GLW +S++GS CDFLTL YI +V+ HTVPVLYEKY+D+
Sbjct  151  AFSVLHEVATGRDFKKYLLVVAGLWFLSVIGSWCDFLTLAYIVLVVTHTVPVLYEKYQDQ  210

Query  272  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            VD+FA KA  + K QY V DAK+L KIPRGPLKDKK
Sbjct  211  VDSFAHKATVKAKDQYKVIDAKILKKIPRGPLKDKK  246



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FI K+ P IPEVH+PEE  L  AS+LRN++N
Sbjct  96   LVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPPQIPEVHVPEEAFLTIASSLRNELN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  V+LHTVP++YEK+ED
Sbjct  156  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVVLHTVPMMYEKHED  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEKAM EL+KQY VFD KV+SKIP   LK K
Sbjct  216  KVDPLAEKAMKELQKQYLVFDEKVISKIPIASLKAK  251



>ref|XP_006656127.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=262

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I ALA+LFLWS A++FIKKS P IP V IPE+  +  + ALRND+N
Sbjct  104  VLDYHLLTLLSHVMIGALAILFLWSKATTFIKKSPPDIPVVQIPEDVAVNVSRALRNDIN  163

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + R+IA G DLK FL VI  LW++S VGSCCDFLTL Y+AV++LHTVP+LY+KY+D
Sbjct  164  RALHLFREIALGHDLKKFLGVIVALWVLSEVGSCCDFLTLIYVAVLMLHTVPILYDKYQD  223

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA +A  E  K Y V DAKVLSKIPRGP K KK
Sbjct  224  KVDHFAGRAHSEACKHYEVLDAKVLSKIPRGPSKPKK  260



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT +CH LI ALAV+FLWSNA +   K+APHIPEV +PEEP LQ AS LR  +N
Sbjct  100  LVEYHLLTLICHILIGALAVMFLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASELRLQIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L +IASGR+LK FL+VI GLW++SIVGS C+FLTLFYI  VLLHTVPVLYEKYE 
Sbjct  160  WAFALLHNIASGRELKKFLIVIAGLWVLSIVGSWCNFLTLFYITFVLLHTVPVLYEKYEH  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD  AEKA  E+KKQY VFDAKV++K+    LK+K+
Sbjct  220  KVDPLAEKATIEMKKQYGVFDAKVVTKVRETVLKNKR  256



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYH LT +CH  + ALA LFLWSNA +FI K+ PHIPEVHIPE+PVLQ  S LR ++N
Sbjct  96   LIEYHFLTFLCHFAMAALAALFLWSNACTFIHKATPHIPEVHIPEDPVLQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK F++VI GLWI+SI+GSCC+FLTLFYIA VLL T+PV+YEKYED
Sbjct  156  RGFTVLRNIASGRDLKKFILVIAGLWILSILGSCCNFLTLFYIATVLLFTIPVIYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KVLSKIPRG L  KK
Sbjct  216  KVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>gb|ABB51093.1| reticulon [Hordeum vulgare]
Length=204

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I  LA+LF+WS A +FIKKS P IP V IPE+  +  + ALRNDVN
Sbjct  47   VLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRALRNDVN  106

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + R+IA G DLK FL VI GLW++S VGSCCDFLTL YIAV+++HTVP+LY+KY+D
Sbjct  107  RSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILYDKYQD  166

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  E  K Y V D KVLSKIPRGP K KK
Sbjct  167  KVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  203



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEY+LLT   H  ILALAVLFLWS+A++FI KS PHIPEVHIPEE VL+ AS LR ++N
Sbjct  93   LLEYNLLTLFGHISILALAVLFLWSSATTFIHKSPPHIPEVHIPEEVVLELASGLRIEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLRDIASGRDLK FL+VI GLW++S +GS C+FLTL YIA VLL T+PVLYEKYED
Sbjct  153  RGFTVLRDIASGRDLKKFLLVIAGLWVLSKLGSSCNFLTLIYIATVLLFTIPVLYEKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQY  FD    +KV+SKIP+G    KK
Sbjct  213  KVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKGAFYKKK  253



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+Y+LLT   H  ILALAVLFLWS+A++FI K+ PHIPEVHIPEE VLQ AS LR ++N
Sbjct  90   LLQYNLLTLFGHVSILALAVLFLWSSATTFIHKTPPHIPEVHIPEEVVLQLASGLRIEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IA GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL TVPV YEKYED
Sbjct  150  RGFTILRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTVPVFYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VD F EKAM E+KKQYAV D    +KV+SKIPRG    KK
Sbjct  210  KVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKKK  250



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ +CH  ILAL  LFLWSNA +FIKKS P IPE+H+PEEP L  AS+LRN++N
Sbjct  94   LVEYHLLSLLCHVSILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSLRNELN  153

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+ C+FLTL YI  VLLHTVP++YEK+ED
Sbjct  154  QGFVILRSIALGRDLKKFLMVVVGLWIISVVGNWCNFLTLVYICFVLLHTVPMMYEKHED  213

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD FAEKA  EL K Y VFD KV+SKIP   LK K
Sbjct  214  KVDPFAEKAFKELHKHYLVFDEKVVSKIPIASLKAK  249



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT VCH LIL LAVLFLWSNA +FI KS P IPEVH+PEEP  Q ASALR ++N
Sbjct  100  LLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEIN  159

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A+L  I SGRDLK FL++I G+WI+SIVG+ C+FLTLFYI  VL HTVPVLYEKYED
Sbjct  160  RGFAILHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLSHTVPVLYEKYED  219

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            ++D  AEKA+ E+KKQY VFDAKVLSKIP GPLK K
Sbjct  220  KIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPLKAK  255



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLLT V H LIL+LA LFL+SN   F+ KS P+IPEV IPE+  +  A +LR+++N
Sbjct  96   IMEYHLLTLVGHCLILSLATLFLYSNVCIFVHKSPPNIPEVKIPEDMTVNIALSLRHEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                 LR+I  GRDLK FL+VI GLW++S++GSCC+FLTL YI  V+L+TVPVLYEKY+D
Sbjct  156  RGFFTLREIGHGRDLKKFLIVIGGLWVLSVLGSCCNFLTLSYIVFVVLYTVPVLYEKYDD  215

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDAF EKAM ELKK YA+F+ KVLSKIP+G LK+KK
Sbjct  216  KVDAFGEKAMIELKKYYAIFEEKVLSKIPKGALKNKK  252



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYHLLT V H LIL LAVLFLWSNA +FI K+ P IP VH+PEEP LQFASAL  ++N
Sbjct  97   LLEYHLLTLVGHILILLLAVLFLWSNAHTFIHKAPPRIPVVHLPEEPFLQFASALTIEIN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               A L  I SGRDLK FL+VI G WI+SIVGS  +F+TLFYI  VLLHTVPVLY+KYED
Sbjct  157  RGFAALHAIGSGRDLKTFLVVIVGTWILSIVGSWVNFMTLFYIVFVLLHTVPVLYDKYED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKLA  159
            ++D  AEKA+ E KKQYAVFD KVLSKIP+GPLK KKLA
Sbjct  217  KIDPLAEKALIEFKKQYAVFDEKVLSKIPKGPLKYKKLA  255



>ref|NP_001046501.1| Os02g0265900 [Oryza sativa Japonica Group]
 dbj|BAD27895.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF08415.1| Os02g0265900 [Oryza sativa Japonica Group]
 gb|EAZ22509.1| hypothetical protein OsJ_06173 [Oryza sativa Japonica Group]
 dbj|BAG96495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YH LT + H LI  LA+LFLWS A+ FIKKS P+IPEV I E+  +  A ALR D+N
Sbjct  72   VVDYHFLTLISHVLIGVLAILFLWSKATIFIKKSPPNIPEVKISEDLAVNVALALRTDIN  131

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+I+ G DL  FL VI  LWI+S +GS CDFLTLFY+AV++LHTVP+LY KY+D
Sbjct  132  QALHLLREISLGHDLMKFLGVIVALWILSEIGSLCDFLTLFYVAVLMLHTVPILYHKYQD  191

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  EL +QY+V DAKVLSKIPRGP KDKK
Sbjct  192  KVDHFAGKAHVELSRQYSVLDAKVLSKIPRGPAKDKK  228



>ref|NP_001057713.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAD45275.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF19627.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAG93532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I ALA+LFLWS A++FIKKS P IP V IPE+  +  + ALR+D+N
Sbjct  108  VLDYHLLTLLSHVMIGALAILFLWSKATTFIKKSPPDIPVVQIPEDVAVNVSRALRSDIN  167

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + R+IA G DLK FL VI  LW++S VGSCCDFLTL Y+AV++LHTVP+LY+KY+D
Sbjct  168  RALHLFREIALGHDLKKFLGVIVALWVLSEVGSCCDFLTLIYVAVLMLHTVPILYDKYQD  227

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA +A  E  K Y V DAKVLSKIPRGP+K KK
Sbjct  228  KVDHFAGRAHSEACKHYEVLDAKVLSKIPRGPVKPKK  264



>ref|XP_006647139.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=232

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YH LT + H LI  LA+LFLWS A+ FIKKS P IPEV I E+  +    ALR D+N
Sbjct  74   VVDYHFLTLISHVLIGVLAILFLWSKATIFIKKSPPDIPEVKISEDLAVNVVLALRTDIN  133

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IA G DL  FL VI GLWI+S +GS CDFLTLFY+AV++LHTVP+LY KY+D
Sbjct  134  QALHLLREIALGHDLMKFLGVIVGLWILSEIGSLCDFLTLFYVAVLMLHTVPILYHKYQD  193

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  EL +QY+V D KVLSKIPRGP KDKK
Sbjct  194  KVDHFAGKAHVELSRQYSVLDEKVLSKIPRGPAKDKK  230



>dbj|BAJ94514.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I  LA+LF+WS A +FIKKS P IP V IPE+  +  + ALRNDVN
Sbjct  103  VLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRALRNDVN  162

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L + R+IA G DLK FL VI GLW++S VGSCCDFLTL YIAV+++HTVP+LY+KY+D
Sbjct  163  RSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILYDKYQD  222

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  E  K Y V D KVLSKIPRGP K KK
Sbjct  223  KVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  259



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHL+T VCHGLIL+LA++FLW NA++FI KS PH+PEV I E+  L    +LR  +N
Sbjct  95   LMEYHLITLVCHGLILSLAIIFLWCNATTFISKSRPHVPEVSISEDLALNVVLSLRYVIN  154

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L  LRDIASGRDLK FL     LW++SI+ +CC FL LFYIA V L+TVPVLYEKYED
Sbjct  155  RGLVALRDIASGRDLKKFLAAAAALWVLSIIANCCSFLMLFYIAFVALYTVPVLYEKYED  214

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  162
             VDAFAEKA  E KK Y V   K LSKIP GPLKDKK 
Sbjct  215  RVDAFAEKAEAEFKKHYVVIHVKYLSKIPMGPLKDKKF  252



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EY  LT +CH  + ALA LFLWSNA +FI KS P IPEVHIPE+PVLQ  S LR ++N
Sbjct  96   LIEYRFLTFLCHFAMAALAALFLWSNACTFIHKSTPRIPEVHIPEDPVLQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK F++VI GLW++SI+GSCC+FLTLFYIA VLL T+PV+YEKYED
Sbjct  156  RGFTVLRNIASGRDLKKFILVIAGLWVLSIIGSCCNFLTLFYIATVLLFTIPVVYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KVLSKIPRG L  KK
Sbjct  216  KVDAFGEKAMKEIKKQYAVLDDKVFSKVLSKIPRGALNKKK  256



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYHLL+ VCH LI +LA +FLWSNA +F+KKS P IPEVH+ EE  L  ASALRN++N
Sbjct  97   LVEYHLLSLVCHILIFSLAAMFLWSNAHAFMKKSPPKIPEVHVKEEHFLLIASALRNELN  156

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR IA GRDLK FLMV+ GLWIIS+VG+  +FLTL YI  V+LHTVP+LYEK+ED
Sbjct  157  QAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHED  216

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            +VD  AEK + ELKK Y VFD KVLSKIP   LK K
Sbjct  217  KVDPVAEKTLKELKKHYMVFDEKVLSKIPLASLKAK  252



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 4/160 (3%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L+Y+LLT   H  ILALAVLFLWS+A++FI K  PHIPEVHIPEE VLQ AS LR ++N
Sbjct  90   LLQYNLLTLFGHVSILALAVLFLWSSATTFIHKKPPHIPEVHIPEEVVLQLASGLRIEIN  149

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                +LR+IA GRDLK FLMV+ GLW++S VGS C+FLTL YIA VLL T+PVLYEKYED
Sbjct  150  RGFTILRNIALGRDLKKFLMVVAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYED  209

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDK  168
            +VD F EKAM E+KKQYAV D    +KV+SKIPRG    K
Sbjct  210  KVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIPRGAFNKK  249



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +L YHL+T VC+  I  LAVLFLWSN S F+ K  P IPEV +PE+ V + ASALR ++N
Sbjct  93   LLGYHLITLVCYLSIFFLAVLFLWSNTSDFLNKPPPKIPEVVLPEQCVREVASALRIEIN  152

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL DIASGRDLK  L VI GLW++S++GSC + LTL YI+ VLLHTVPVLYEKYED
Sbjct  153  RGFAVLHDIASGRDLKKVLAVIAGLWVLSLIGSCINILTLLYISFVLLHTVPVLYEKYED  212

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VDA++EK   E+KKQYAVFD K LSKIP+G LK +K
Sbjct  213  QVDAYSEKTWIEIKKQYAVFDEKYLSKIPKGALKGEK  249



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            ++EYH LT +CH  + ALA LFLWSNA +FI K+ PH+PEVHIPE+PVLQ  S LR ++N
Sbjct  96   LIEYHFLTFLCHFAMAALAALFLWSNACTFIHKATPHLPEVHIPEDPVLQLVSGLRIEIN  155

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
                VLR+IASGRDLK F++VI GLW +SI+GSCC+FLTLFYIA VLL T+PV+YEKYED
Sbjct  156  RGFTVLRNIASGRDLKKFILVIAGLWALSIIGSCCNFLTLFYIATVLLFTIPVVYEKYED  215

Query  275  EVDAFAEKAMHELKKQYAVFD----AKVLSKIPRGPLKDKK  165
            +VDAF EKAM E+KKQYAV D    +KVLSKIPRG L  KK
Sbjct  216  KVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIPRGALNKKK  256



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            +LEYH LT VCH LIL LAVLFLWSNA +FI KS P IP+VH+PEEP+LQ AS LR ++N
Sbjct  99   LLEYHFLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPDVHLPEEPILQVASVLRIEIN  158

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
               AVL  I SGRDLK FLMVI G+WI+SIVG+ C+FLTLFYI  +LLHT PVLYEKYED
Sbjct  159  RGFAVLHSIGSGRDLKKFLMVIAGVWILSIVGNWCNFLTLFYITFILLHTTPVLYEKYED  218

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  168
            ++D  AEKA+ E+KKQYAVFDAKVLSKIP G LK K
Sbjct  219  KIDPLAEKAVIEIKKQYAVFDAKVLSKIPVGLLKAK  254



>ref|XP_008239009.1| PREDICTED: reticulon-like protein B2 [Prunus mume]
Length=257

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  605  CHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIA  426
             H LIL LA+LFLWSNAS+FI KS P IP+V IPE+PVLQ ASA+  ++N    +LR+IA
Sbjct  110  SHCLILGLAMLFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIA  169

Query  425  SGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAM  246
            SG+DLK FL VI GLW++SI+G   +FLTL YI VVLL T+PV YEKY+D+VDA AEKAM
Sbjct  170  SGKDLKQFLSVIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDALAEKAM  229

Query  245  HELKKQYAVFDAKVLSKIPRGPLKDKK  165
             E+KKQYAVFDAKVLSK+P+G +KDKK
Sbjct  230  IEIKKQYAVFDAKVLSKVPKGQMKDKK  256



>gb|EMS50148.1| Reticulon-like protein B2 [Triticum urartu]
Length=235

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            VL+YHLLT + H +I  LA+LF+WS A +FIKKS P IP V IPE+  +  + ALR+DVN
Sbjct  78   VLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKSPPDIPVVEIPEDLAVNVSRALRSDVN  137

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+IA G DLK FL VI GLW++S VGSCCDFLTL YIAV+++HTVP+LY+KY+D
Sbjct  138  RSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGSCCDFLTLIYIAVLMIHTVPILYDKYQD  197

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  E  K Y V D KVLSKIPRGP K KK
Sbjct  198  KVDHFAGKAHTEACKHYEVLDQKVLSKIPRGPAKTKK  234



>gb|EAY85291.1| hypothetical protein OsI_06662 [Oryza sativa Indica Group]
Length=230

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  635  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipevhipeepVLQFASALRNDVN  456
            V++YH LT + H LI  LA+LFLWS A+ FIKKS P+IPEV I E+  +  A ALR D+N
Sbjct  72   VVDYHFLTLISHVLIGVLAILFLWSKATIFIKKSPPNIPEVKISEDLAVNVALALRTDIN  131

Query  455  HCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYED  276
              L +LR+I+ G DL  FL VI  LWI+S +GS CDFLTLFY+AV++LHTVP+ Y KY+D
Sbjct  132  QALHLLREISLGHDLMKFLGVIVALWILSEIGSLCDFLTLFYVAVLMLHTVPIFYHKYQD  191

Query  275  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  165
            +VD FA KA  EL +QY+V DAKVLSKIPRGP KDKK
Sbjct  192  KVDHFAGKAHVELSRQYSVLDAKVLSKIPRGPAKDKK  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125