BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030H04

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD50627.1|AF106569_1  alpha-tubulin                                 237   5e-76   Gossypium hirsutum [American cotton]
gb|AAD50625.1|AF106567_1  alpha-tubulin                                 237   5e-76   Gossypium hirsutum [American cotton]
gb|AFR42026.1|  alpha-tubulin                                           238   1e-75   Populus trichocarpa [western balsam poplar]
gb|AAN32997.1|  alpha-tubulin 1                                         236   1e-75   Gossypium hirsutum [American cotton]
gb|AFR42020.1|  alpha-tubulin                                           238   1e-75   Populus trichocarpa [western balsam poplar]
gb|AFR42035.1|  alpha-tubulin                                           238   2e-75   Populus alba [abele]
gb|AAD50626.1|AF106568_1  alpha-tubulin                                 235   2e-75   Gossypium hirsutum [American cotton]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               238   2e-75   Erythranthe guttata [common monkey flower]
gb|AFR42049.1|  alpha-tubulin                                           238   2e-75   Populus fremontii
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            238   2e-75   
gb|AFR42054.1|  alpha-tubulin                                           237   2e-75   Populus fremontii
gb|AFR42036.1|  alpha-tubulin                                           237   2e-75   Populus alba [abele]
gb|AFR42042.1|  alpha-tubulin                                           237   2e-75   Populus fremontii
gb|AFR42047.1|  alpha-tubulin                                           237   2e-75   Populus fremontii
emb|CAJ38386.1|  alpha tubulin                                          239   3e-75   Plantago major [cart-track plant]
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              237   5e-75   Solanum lycopersicum
gb|KJB58759.1|  hypothetical protein B456_009G224800                    241   5e-75   Gossypium raimondii
gb|AFR42124.1|  alpha-tubulin                                           234   6e-75   Populus alba [abele]
gb|ACN40714.1|  unknown                                                 234   8e-75   Picea sitchensis
gb|AFR42117.1|  alpha-tubulin                                           233   9e-75   Populus trichocarpa [western balsam poplar]
gb|AHM93474.1|  alpha-tubulin                                           240   1e-74   Camellia chekiangoleosa
dbj|BAH19954.1|  AT1G50010                                              237   2e-74   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 235   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ58481.1|  alpha-tubulin                                           235   2e-74   Syntrichia caninervis
emb|CAB76917.1|  alpha-tubulin 4                                        238   2e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA99561.1|  alpha-tubulin                                          233   2e-74   Chlorella vulgaris
gb|AAW57305.1|  alpha-tubulin                                           238   2e-74   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    240   3e-74   Gossypium raimondii
gb|ADD84794.1|  tubulin-like protein                                    234   3e-74   Cenchrus ciliaris [African foxtail grass]
gb|AAW57310.1|  alpha-tubulin                                           237   3e-74   Ceratopteris richardii
gb|AAW57309.1|  alpha-tubulin                                           236   4e-74   Ceratopteris richardii
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   239   4e-74   Citrus sinensis [apfelsine]
gb|KIY91712.1|  Tubulin alpha chain                                     236   5e-74   Monoraphidium neglectum
gb|AFR42125.1|  alpha-tubulin                                           231   5e-74   Populus fremontii
gb|AFR42123.1|  alpha-tubulin                                           231   6e-74   Populus trichocarpa [western balsam poplar]
gb|AHJ80819.1|  Tua1                                                    235   7e-74   Eragrostis tef [tef]
gb|ABR26014.1|  tubulin alpha-3 chain                                   231   7e-74   Oryza sativa Indica Group [Indian rice]
emb|CDY46272.1|  BnaC05g50610D                                          236   7e-74   Brassica napus [oilseed rape]
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              236   8e-74   
gb|AAW57306.1|  alpha-tubulin                                           235   9e-74   Ceratopteris richardii
gb|KDO25258.1|  hypothetical protein SPRG_09506                         233   9e-74   Saprolegnia parasitica CBS 223.65
ref|XP_008621874.1|  tubulin alpha                                      236   9e-74   Saprolegnia diclina VS20
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     233   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003886491.1|  unnamed protein product                            231   1e-73   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              233   1e-73   Camelina sativa [gold-of-pleasure]
emb|CAD20821.1|  alpha tubulin                                          235   1e-73   Zea mays [maize]
gb|EPS62716.1|  alpha-tubulin                                           239   1e-73   Genlisea aurea
gb|AAD11425.1|  alpha tubulin                                           238   1e-73   Mesembryanthemum crystallinum
emb|CAD20820.1|  alpha tubulin                                          233   1e-73   Zea mays [maize]
emb|CAC84108.1|  alpha-tubulin                                          230   2e-73   Gossypium hirsutum [American cotton]
gb|AAG28536.1|AF199019_1  alpha tubulin                                 233   2e-73   Leishmania major
ref|XP_002677064.1|  alpha-tubulin                                      232   2e-73   Naegleria gruberi strain NEG-M
gb|KJB58756.1|  hypothetical protein B456_009G224800                    239   2e-73   Gossypium raimondii
gb|AAO46127.1|  alpha-tubulin                                           234   2e-73   Streblomastix strix
gb|KJB33191.1|  hypothetical protein B456_006G002500                    232   2e-73   Gossypium raimondii
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       239   3e-73   Cucumis sativus [cucumbers]
gb|ABR25510.1|  tubulin alpha-1 chain                                   234   3e-73   Oryza sativa Indica Group [Indian rice]
emb|CDY35856.1|  BnaC09g37880D                                          230   3e-73   Brassica napus [oilseed rape]
gb|AAO46130.1|  alpha-tubulin                                           234   3e-73   Streblomastix strix
emb|CAL35827.1|  alpha-2 tubulin                                        234   3e-73   Plantago major [cart-track plant]
dbj|BAH20267.1|  AT5G19780                                              235   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482574.1|  PREDICTED: tubulin alpha chain-like                230   4e-73   
gb|AAD50628.1|AF106570_1  alpha-tubulin                                 229   4e-73   Gossypium hirsutum [American cotton]
emb|CAD20819.1|  alpha tubulin                                          229   4e-73   Zea mays [maize]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    238   4e-73   Gossypium raimondii
gb|ABL61201.1|  alpha-tubulin                                           235   4e-73   Oxymonadida environmental sample
emb|CAA52158.1|  alpha tubulin                                          233   5e-73   Zea mays [maize]
gb|AAB36609.1|  alpha-tubulin                                           237   5e-73   Eucalyptus globulus subsp. bicostata
gb|AAU10519.1|  alpha tubulin                                           233   5e-73   Leishmania donovani
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   239   5e-73   Citrus sinensis [apfelsine]
ref|XP_001777110.1|  predicted protein                                  236   6e-73   
ref|XP_002779346.1|  alpha-tubulin, putative                            231   6e-73   Perkinsus marinus ATCC 50983
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                238   6e-73   Erythranthe guttata [common monkey flower]
gb|AFR42118.1|  alpha-tubulin                                           229   6e-73   Populus trichocarpa [western balsam poplar]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     239   7e-73   Vitis vinifera
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             239   7e-73   Anemia phyllitidis
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   239   8e-73   Citrus sinensis [apfelsine]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         239   8e-73   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           239   8e-73   Betula pendula [white birch]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             239   8e-73   Citrus clementina [clementine]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              239   8e-73   Medicago truncatula
gb|ABX57816.1|  alpha tubulin                                           239   8e-73   Picea wilsonii
gb|AEQ75493.1|  alpha-tubulin                                           238   8e-73   Rosa multiflora [Japanese rose]
gb|ABC59068.2|  alpha tubulin 1                                         239   9e-73   Camellia sinensis [black tea]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                239   9e-73   Vitis vinifera
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     239   9e-73   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     239   9e-73   Pyrus x bretschneideri [bai li]
gb|KHG20487.1|  Tubulin alpha chain                                     239   9e-73   Gossypium arboreum [tree cotton]
ref|NP_001289660.1|  tubulin alpha chain-like                           239   9e-73   Eucalyptus grandis [rose gum]
gb|AIX10966.1|  tubulin                                                 239   9e-73   Ornithogalum longebracteatum [sea-onion]
gb|ABO47739.1|  alpha-tubulin                                           239   9e-73   Gossypium hirsutum [American cotton]
ref|XP_002510010.1|  tubulin alpha chain, putative                      239   9e-73   Ricinus communis
gb|ABV55999.1|  alpha-tubulin 7                                         239   9e-73   Populus tremuloides
gb|AAV92352.1|  alpha tubulin 1                                         239   9e-73   Pseudotsuga menziesii var. menziesii
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             239   9e-73   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                239   9e-73   Erythranthe guttata [common monkey flower]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             239   9e-73   Prunus persica
gb|ABL61224.1|  alpha-tubulin                                           234   9e-73   Oxymonadida environmental sample
gb|ADW83724.1|  alpha-tubulin                                           238   9e-73   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     239   9e-73   Eucalyptus grandis [rose gum]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              239   9e-73   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     239   9e-73   Nelumbo nucifera [Indian lotus]
gb|KHG18997.1|  Tubulin alpha chain                                     239   9e-73   Gossypium arboreum [tree cotton]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         239   9e-73   Jatropha curcas
gb|ACN40181.1|  unknown                                                 239   9e-73   Picea sitchensis
gb|ABO47740.1|  alpha-tubulin                                           239   9e-73   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                           239   9e-73   Gossypium hirsutum [American cotton]
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     239   9e-73   Vitis vinifera
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Elaeis guineensis
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          239   1e-72   Malus domestica [apple tree]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Phoenix dactylifera
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   239   1e-72   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          239   1e-72   Citrus sinensis [apfelsine]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    239   1e-72   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             239   1e-72   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              239   1e-72   Theobroma cacao [chocolate]
ref|WP_039310890.1|  hypothetical protein                               239   1e-72   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   239   1e-72   Fragaria vesca subsp. vesca
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             239   1e-72   Prunus persica
emb|CAD13176.1|  alpha-tubulin                                          239   1e-72   Nicotiana tabacum [American tobacco]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     239   1e-72   Populus euphratica
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     239   1e-72   Phoenix dactylifera
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABL61216.1|  alpha-tubulin                                           234   1e-72   Oxymonadida environmental sample
ref|XP_001764722.1|  predicted protein                                  239   1e-72   
emb|CDP02221.1|  unnamed protein product                                238   1e-72   Coffea canephora [robusta coffee]
gb|KJB34154.1|  hypothetical protein B456_006G050600                    231   1e-72   Gossypium raimondii
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Cucumis sativus [cucumbers]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Elaeis guineensis
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Elaeis guineensis
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Phoenix dactylifera
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              239   1e-72   Fragaria vesca subsp. vesca
gb|ABL61212.1|  alpha-tubulin                                           234   1e-72   Oxymonadida environmental sample
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        239   1e-72   Cucumis melo [Oriental melon]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                239   1e-72   Fragaria vesca subsp. vesca
ref|XP_002522104.1|  tubulin alpha chain, putative                      238   1e-72   Ricinus communis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                238   1e-72   Prunus dulcis [sweet almond]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 239   1e-72   Populus trichocarpa [western balsam poplar]
gb|AGG37285.1|  alpha-tubulin 3                                         239   1e-72   Salix arbutifolia
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     238   1e-72   Nicotiana tomentosiformis
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   239   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010093625.1|  Tubulin alpha chain                                239   1e-72   Morus notabilis
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             238   1e-72   Selaginella moellendorffii
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     238   1e-72   Nicotiana sylvestris
ref|NP_001291325.1|  tubulin alpha chain-like                           238   1e-72   Sesamum indicum [beniseed]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              238   1e-72   Cucumis sativus [cucumbers]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    238   1e-72   Gossypium hirsutum [American cotton]
emb|CBH08953.1|  alpha tubulin, (fragment)                              230   1e-72   Trypanosoma brucei gambiense DAL972
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             238   1e-72   Eutrema salsugineum [saltwater cress]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              238   1e-72   Theobroma cacao [chocolate]
gb|ABL61215.1|  alpha-tubulin                                           234   1e-72   Oxymonadida environmental sample
gb|ABK92520.1|  unknown                                                 238   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          238   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_002517492.1|  tubulin alpha chain, putative                      238   1e-72   Ricinus communis
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     238   1e-72   
gb|AGG37289.1|  alpha-tubulin 7                                         238   1e-72   Salix arbutifolia
ref|XP_010104543.1|  Tubulin alpha chain                                238   1e-72   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              238   1e-72   Medicago truncatula
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                238   1e-72   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     238   1e-72   Carthamus tinctorius
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              238   1e-72   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             238   1e-72   
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   238   1e-72   Populus euphratica
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                238   1e-72   Cicer arietinum [garbanzo]
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             238   1e-72   Prunus persica
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             238   1e-72   Selaginella moellendorffii
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               238   1e-72   Pisum sativum [garden pea]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     238   1e-72   Vitis vinifera
gb|ABQ59633.1|  alpha-tubulin 3                                         238   1e-72   Populus tremuloides
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   238   1e-72   Nicotiana tomentosiformis
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     238   1e-72   Cucumis melo [Oriental melon]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              238   1e-72   
gb|ABO47742.1|  alpha-tubulin                                           238   1e-72   Gossypium hirsutum [American cotton]
gb|EKF28172.1|  epsilon tubulin, putative                               232   1e-72   Trypanosoma cruzi marinkellei
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        238   1e-72   Glycine max [soybeans]
gb|EKF29047.1|  epsilon tubulin, putative                               232   1e-72   Trypanosoma cruzi marinkellei
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         238   1e-72   Jatropha curcas
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             238   1e-72   Prunus persica
gb|ABL61086.1|  alpha-tubulin                                           234   1e-72   Oxymonadida environmental sample
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   238   1e-72   Malus domestica [apple tree]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              238   1e-72   Solanum lycopersicum
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                238   1e-72   Tarenaya hassleriana [spider flower]
gb|ABB02631.1|  unknown                                                 238   1e-72   Solanum tuberosum [potatoes]
ref|XP_010099392.1|  Tubulin alpha chain                                239   1e-72   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     238   1e-72   Sesamum indicum [beniseed]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                238   1e-72   Solanum tuberosum [potatoes]
ref|NP_001275271.1|  alpha-tubulin-like protein                         238   1e-72   Solanum tuberosum [potatoes]
gb|EKG00833.1|  epsilon tubulin, putative                               228   1e-72   Trypanosoma cruzi
ref|XP_002959708.1|  alpha tubulin                                      232   1e-72   Volvox carteri f. nagariensis
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             238   1e-72   Populus trichocarpa [western balsam poplar]
gb|AGG37283.1|  alpha-tubulin 1                                         238   1e-72   Salix arbutifolia
ref|XP_002772835.1|  alpha-tubulin, putative                            228   1e-72   Perkinsus marinus ATCC 50983
gb|ABP65320.1|  alpha tubulin                                           238   1e-72   Capsicum annuum
emb|CCD11782.1|  unnamed protein product                                232   1e-72   Trypanosoma congolense IL3000
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             238   1e-72   Phaseolus vulgaris [French bean]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                238   1e-72   Solanum lycopersicum
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              238   2e-72   Nicotiana tomentosiformis
gb|KHN08201.1|  Tubulin alpha chain                                     238   2e-72   Glycine soja [wild soybean]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              238   2e-72   Populus euphratica
gb|ACH68563.1|  alpha-tubulin                                           238   2e-72   Solanum tuberosum [potatoes]
gb|ACK76232.1|  alpha-tubulin                                           238   2e-72   Dimocarpus longan [longan]
gb|EPY32266.1|  alpha tubulin                                           228   2e-72   Strigomonas culicis
emb|CBH08958.1|  alpha tubulin, (fragment)                              233   2e-72   Trypanosoma brucei gambiense DAL972
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                238   2e-72   Nicotiana tomentosiformis
gb|ABR26150.1|  tubulin alpha-3 chain                                   229   2e-72   Oryza sativa Indica Group [Indian rice]
gb|AIX10773.1|  alpha tubulin                                           238   2e-72   Panax notoginseng [san-qi]
gb|ABL61202.1|  alpha-tubulin                                           233   2e-72   Oxymonadida environmental sample
gb|ADJ00012.1|  tubulin alpha chain                                     231   2e-72   Chromera velia
gb|AFW67749.1|  alpha tubulin4                                          234   2e-72   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     238   2e-72   Sesamum indicum [beniseed]
emb|CDY66630.1|  BnaCnng51680D                                          237   2e-72   Brassica napus [oilseed rape]
gb|ABL61204.1|  alpha-tubulin                                           233   3e-72   Oxymonadida environmental sample
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   238   3e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY29334.1|  BnaA05g16010D                                          237   3e-72   Brassica napus [oilseed rape]
gb|AAO46128.1|  alpha-tubulin                                           231   3e-72   Streblomastix strix
ref|XP_001566612.1|  alpha tubulin                                      231   3e-72   Leishmania braziliensis MHOM/BR/75/M2904
gb|EPY40479.1|  tubulin alpha                                           231   3e-72   Angomonas deanei
gb|ABL61219.1|  alpha-tubulin                                           233   3e-72   Oxymonadida environmental sample
tpg|DAA41189.1|  TPA: alpha tubulin5                                    233   3e-72   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                238   3e-72   Eucalyptus grandis [rose gum]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    238   3e-72   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     237   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        237   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    233   3e-72   
gb|KJB29387.1|  hypothetical protein B456_005G097800                    237   3e-72   Gossypium raimondii
gb|ETM52928.1|  tubulin alpha chain                                     236   3e-72   Phytophthora parasitica
gb|ABR25378.1|  tubulin alpha 3 chain                                   229   3e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                237   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             237   4e-72   Capsella rubella
gb|EPY33355.1|  tubulin alpha                                           233   4e-72   Strigomonas culicis
gb|EPY39349.1|  tubulin alpha                                           233   4e-72   Angomonas deanei
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   237   4e-72   Brassica rapa
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    237   4e-72   Arabis alpina [alpine rockcress]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             237   4e-72   Phaseolus vulgaris [French bean]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              238   4e-72   
ref|NP_171974.1|  tubulin alpha-4 chain                                 237   4e-72   Arabidopsis thaliana [mouse-ear cress]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    237   4e-72   Gossypium hirsutum [American cotton]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    237   4e-72   Gossypium hirsutum [American cotton]
gb|ABL61217.1|  alpha-tubulin                                           233   4e-72   Oxymonadida environmental sample
ref|XP_011398411.1|  Tubulin alpha chain                                235   4e-72   Auxenochlorella protothecoides
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        237   4e-72   Camelina sativa [gold-of-pleasure]
gb|AAO73546.1|  alpha-tubulin                                           237   4e-72   Ceratopteris richardii
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              237   4e-72   Camelina sativa [gold-of-pleasure]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             237   4e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABU93324.1|  tubulin alpha subunit                                   237   4e-72   Monocercomonoides sp. PA
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    237   4e-72   Glycine max [soybeans]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          237   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193232.1|  tubulin alpha-6 chain                                 237   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010096739.1|  Tubulin alpha chain                                237   4e-72   
gb|ABL61213.1|  alpha-tubulin                                           233   4e-72   Oxymonadida environmental sample
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     237   5e-72   Glycine max [soybeans]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             237   5e-72   Selaginella moellendorffii
ref|XP_001427643.1|  hypothetical protein                               231   5e-72   Paramecium tetraurelia strain d4-2
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             237   5e-72   Phaseolus vulgaris [French bean]
gb|KEH43997.1|  tubulin beta-1 chain                                    237   5e-72   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                237   5e-72   Cicer arietinum [garbanzo]
dbj|BAJ06364.1|  alpha-tubulin                                          237   5e-72   Alopecurus aequalis
gb|ABU93323.1|  tubulin alpha subunit                                   237   5e-72   Monocercomonoides sp. PA
gb|ABL61226.1|  alpha-tubulin                                           233   5e-72   Oxymonadida environmental sample
gb|ABD92937.1|  alpha tubulin-4A                                        237   5e-72   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        237   5e-72   Triticum aestivum [Canadian hard winter wheat]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   237   5e-72   Glycine soja [wild soybean]
gb|ABL61227.1|  alpha-tubulin                                           233   5e-72   Oxymonadida environmental sample
gb|ETI53409.1|  tubulin alpha chain                                     227   5e-72   Phytophthora parasitica P1569
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    237   5e-72   Glycine max [soybeans]
gb|ABU93321.1|  tubulin alpha subunit                                   237   5e-72   Monocercomonoides sp. PA
dbj|BAB19779.1|  alpha tubulin                                          237   5e-72   Nicotiana tabacum [American tobacco]
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              237   6e-72   Brachypodium distachyon [annual false brome]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    237   6e-72   Brassica rapa
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              237   6e-72   Glycine max [soybeans]
gb|AFW67748.1|  alpha tubulin4                                          234   6e-72   
ref|XP_007515802.1|  alpha-tubulin                                      236   6e-72   Bathycoccus prasinos
gb|KJB83378.1|  hypothetical protein B456_013G244600                    235   6e-72   Gossypium raimondii
gb|ABL61203.1|  alpha-tubulin                                           232   7e-72   Oxymonadida environmental sample
gb|AEW46684.1|  beta-tubulin                                            236   7e-72   Ulva linza
ref|XP_002508010.1|  alpha tubulin 2                                    236   7e-72   Micromonas commoda
gb|AAO23139.1|  alpha tubulin                                           236   7e-72   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             236   8e-72   
ref|XP_003058621.1|  alpha tubulin                                      236   8e-72   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     234   8e-72   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            233   8e-72   
gb|ABL61214.1|  alpha-tubulin                                           232   8e-72   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              236   8e-72   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             236   8e-72   
gb|AHJ80821.1|  Tua3                                                    235   9e-72   
ref|XP_005651460.1|  tubulin alpha chain                                236   9e-72   
ref|XP_005643073.1|  tubulin alpha chain                                236   9e-72   
gb|ABL61228.1|  alpha-tubulin                                           232   1e-71   
dbj|BAC24800.1|  alpha tubulin                                          236   1e-71   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   234   1e-71   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              236   1e-71   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             236   1e-71   
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    236   1e-71   
ref|XP_002525416.1|  tubulin alpha chain, putative                      236   1e-71   
gb|ETM53002.1|  tubulin alpha chain                                     228   1e-71   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   236   1e-71   
emb|CAB66336.1|  alpha-tubulin                                          236   1e-71   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   236   1e-71   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   236   1e-71   
gb|KIZ03400.1|  Tubulin alpha chain                                     236   1e-71   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             235   1e-71   
gb|AHJ80823.1|  Tua1                                                    236   1e-71   
gb|ACN40824.1|  unknown                                                 236   1e-71   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         236   1e-71   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             236   1e-71   
emb|CDP17586.1|  unnamed protein product                                236   1e-71   
gb|AHJ80820.1|  Tua3                                                    234   1e-71   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              236   1e-71   
gb|AAO46126.1|  alpha-tubulin                                           229   1e-71   
gb|KHG26159.1|  Tubulin alpha-6 chain                                   236   1e-71   
gb|AEG74028.1|  alpha-tubulin                                           236   2e-71   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   236   2e-71   
ref|XP_007030078.1|  Tubulin alpha-5                                    236   2e-71   
gb|ABL61218.1|  alpha-tubulin                                           231   2e-71   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              236   2e-71   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              236   2e-71   
gb|AHJ80817.1|  Tua1                                                    236   2e-71   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   236   2e-71   
gb|AGG37284.1|  alpha-tubulin 2                                         236   2e-71   
dbj|BAJ06362.1|  alpha-tubulin                                          236   2e-71   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   236   2e-71   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              236   2e-71   
gb|AHJ80815.1|  Tua1                                                    236   2e-71   
emb|CAA06619.1|  alpha-tubulin 1                                        236   2e-71   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              235   2e-71   
ref|NP_001167663.1|  tubulin alpha-3 chain                              236   2e-71   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    236   2e-71   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              236   2e-71   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   236   2e-71   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          236   2e-71   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              235   2e-71   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        235   2e-71   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   235   2e-71   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          235   2e-71   
ref|XP_001777081.1|  predicted protein                                  235   2e-71   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   235   2e-71   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     235   2e-71   
gb|ACU20294.1|  unknown                                                 232   2e-71   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              235   2e-71   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             235   2e-71   
dbj|BAP59012.1|  alpha tubulin                                          235   2e-71   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   235   2e-71   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     235   2e-71   
gb|AAO63773.2|  alpha-tubulin 2                                         235   2e-71   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             235   2e-71   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              235   2e-71   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             235   2e-71   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             235   2e-71   
ref|XP_001770881.1|  predicted protein                                  235   2e-71   
emb|CCI45804.1|  unnamed protein product                                235   2e-71   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             235   2e-71   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             235   2e-71   
ref|XP_001782790.1|  predicted protein                                  235   2e-71   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   235   2e-71   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   235   2e-71   
gb|ABQ59634.1|  alpha-tubulin 5                                         235   2e-71   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           235   2e-71   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              235   2e-71   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   234   2e-71   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                235   2e-71   
emb|CDO97305.1|  unnamed protein product                                235   2e-71   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          235   2e-71   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              235   2e-71   
ref|XP_008877307.1|  tubulin alpha chain                                233   2e-71   
gb|AAZ23863.1|  alpha-tubulin                                           235   2e-71   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              235   2e-71   
emb|CCA20146.1|  alpha tubulin 1 putative                               235   2e-71   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           235   2e-71   
tpg|DAA51109.1|  TPA: alpha tubulin                                     235   2e-71   
gb|ACJ04933.1|  alpha tubulin                                           228   3e-71   
gb|EJY81124.1|  Alpha tubulin,putative                                  235   3e-71   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                235   3e-71   
gb|ABB16994.1|  unknown                                                 235   3e-71   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              235   3e-71   
emb|CDW82295.1|  alpha tubulin                                          235   3e-71   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   235   3e-71   
gb|AGG37287.1|  alpha-tubulin 5                                         235   3e-71   
gb|ABP65323.1|  alpha tubulin                                           235   3e-71   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    235   3e-71   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 235   3e-71   
gb|ETM30643.1|  tubulin alpha chain                                     234   3e-71   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                235   3e-71   
ref|XP_005851144.1|  alpha-tubulin                                      235   3e-71   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                235   3e-71   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                235   3e-71   
gb|ABO47737.1|  alpha-tubulin                                           235   3e-71   
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              235   3e-71   
gb|EWC76931.1|  tubulin alpha chain                                     231   3e-71   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  235   3e-71   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    234   3e-71   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   234   3e-71   
gb|ETM52951.1|  tubulin alpha chain                                     234   3e-71   
ref|XP_009842456.1|  tubulin alpha chain                                235   3e-71   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             234   3e-71   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              234   3e-71   
gb|ETO82054.1|  tubulin alpha chain                                     235   3e-71   
ref|XP_008900864.1|  tubulin alpha chain                                235   3e-71   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   234   4e-71   
ref|XP_002904195.1|  alpha-tubulin, putative                            234   4e-71   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             232   4e-71   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              234   4e-71   
dbj|BAJ06363.1|  alpha-tubulin                                          234   4e-71   
emb|CAD26886.1|  alpha-tubulin                                          234   4e-71   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   234   4e-71   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              234   4e-71   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             234   4e-71   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             234   4e-71   
gb|ABD92942.1|  alpha tubulin-1D                                        234   4e-71   
gb|ABL61205.1|  alpha-tubulin                                           234   4e-71   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   234   4e-71   
ref|NP_001105324.1|  tubulin alpha-5 chain                              234   4e-71   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    234   4e-71   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              233   4e-71   
emb|CAD24768.1|  alpha-tubulin                                          234   4e-71   
emb|CCI41153.1|  unnamed protein product                                234   4e-71   
dbj|BAG99724.1|  unnamed protein product                                233   4e-71   
ref|XP_008872990.1|  tubulin alpha chain                                234   4e-71   
gb|ABL61230.1|  alpha-tubulin                                           234   4e-71   
gb|ABL61209.1|  alpha-tubulin                                           234   4e-71   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              234   4e-71   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              234   4e-71   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                235   4e-71   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  234   4e-71   
gb|AGD80034.1|  alpha-tubulin 1                                         234   4e-71   
emb|CAD24765.1|  alpha-tubulin                                          234   4e-71   
gb|ABL61206.1|  alpha-tubulin                                           234   4e-71   
emb|CAD26887.1|  alpha-tubulin                                          234   4e-71   
gb|AAB08791.1|  alpha tubulin                                           234   4e-71   
gb|ETM53018.1|  tubulin alpha chain                                     228   4e-71   
ref|XP_007014666.1|  Tubulin alpha-5                                    234   5e-71   
ref|XP_002904194.1|  alpha-tubulin                                      234   5e-71   
gb|AGG37286.1|  alpha-tubulin 4                                         234   5e-71   
ref|NP_001105588.1|  tubulin alpha-6 chain                              234   5e-71   
gb|AGY80453.1|  tubulin                                                 234   5e-71   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   234   5e-71   
ref|XP_002532068.1|  tubulin alpha chain, putative                      234   5e-71   
gb|ABD92930.1|  alpha tubulin-2A                                        234   5e-71   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                234   5e-71   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           235   5e-71   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   234   5e-71   
gb|ABL61210.1|  alpha-tubulin                                           234   5e-71   
gb|KHN47983.1|  Tubulin alpha-3 chain                                   233   5e-71   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         234   5e-71   
emb|CAD26891.1|  alpha-tubulin                                          234   5e-71   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    234   5e-71   
ref|XP_001419217.1|  predicted protein                                  234   5e-71   
gb|ABO47735.1|  alpha-tubulin                                           234   5e-71   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   234   5e-71   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              234   5e-71   
ref|NP_001237301.1|  tubulin A                                          234   5e-71   
gb|ABL61208.1|  alpha-tubulin                                           234   5e-71   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              234   5e-71   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    234   5e-71   
gb|ABO47741.1|  alpha-tubulin                                           234   5e-71   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              234   5e-71   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     234   5e-71   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             230   5e-71   
emb|CCW60849.1|  unnamed protein product                                232   5e-71   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    234   5e-71   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              234   5e-71   
ref|NP_197478.1|  tubulin alpha-3                                       234   5e-71   
emb|CAD26890.1|  alpha-tubulin                                          234   5e-71   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             234   5e-71   
ref|NP_001060075.1|  Os07g0574800                                       234   5e-71   
emb|CDX88875.1|  BnaA03g07740D                                          234   5e-71   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   234   5e-71   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                234   6e-71   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     234   6e-71   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   234   6e-71   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              234   6e-71   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              234   6e-71   
gb|ETW27380.1|  tubulin alpha chain                                     230   6e-71   
gb|ACU19580.1|  unknown                                                 234   6e-71   
emb|CDY42294.1|  BnaC02g09000D                                          234   6e-71   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             234   6e-71   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               234   6e-71   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             234   6e-71   
gb|ABR67425.1|  alpha-tubulin 4                                         234   6e-71   
ref|XP_007512064.1|  alpha-tubulin                                      234   6e-71   
gb|AFK33477.1|  unknown                                                 231   6e-71   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              234   6e-71   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      230   7e-71   
gb|ACL53551.1|  unknown                                                 225   7e-71   
emb|CDP12358.1|  unnamed protein product                                234   7e-71   
emb|CDY44941.1|  BnaA02g04460D                                          234   7e-71   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           234   7e-71   
emb|CDJ60085.1|  tubulin alpha chain, putative                          233   7e-71   
gb|AAT09063.1|  alpha tubulin 1                                         234   7e-71   
ref|XP_001563163.2|  alpha tubulin                                      234   7e-71   
ref|XP_002675196.1|  alpha-tubulin                                      234   8e-71   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               230   8e-71   
gb|ABC97356.1|  alpha tubulin                                           233   8e-71   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              234   8e-71   
gb|AAX63396.1|  alpha-tubulin                                           233   8e-71   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              233   9e-71   
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              233   9e-71   
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               233   9e-71   



>gb|AAD50627.1|AF106569_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AAD50625.1|AF106567_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  81   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  140

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AAN32997.1| alpha-tubulin 1, partial [Gossypium hirsutum]
Length=132

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  1    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMIS  60

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  61   NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  113



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  81   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  140

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  80   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  139

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  140  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AAD50626.1|AF106568_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  87   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  146

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  147  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  81   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  140

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  87   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  146

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  147  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  80   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  139

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  140  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  79   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  138

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  139  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  78   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  137

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  138  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  78   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  137

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  138  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  140  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  199

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMIS
Sbjct  96   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMIS  155

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  156  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  210  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  269

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  270  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|AFR42124.1| alpha-tubulin, partial [Populus alba]
Length=133

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|ACN40714.1| unknown [Picea sitchensis]
Length=139

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  8    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  67

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N TSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  68   NLTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  120



>gb|AFR42117.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42119.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42120.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42121.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42122.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42129.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42130.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42131.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42132.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42133.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42134.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42135.1| alpha-tubulin, partial [Populus nigra]
Length=133

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  197  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  256

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  257  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  118  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  177

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  72   RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  131

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  132  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  71   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  130

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  131  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  158  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  217

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  218  NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>dbj|BAA99561.1| alpha-tubulin [Chlorella vulgaris]
Length=149

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  18   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  77

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  78   NSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  130



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMIS
Sbjct  176  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMIS  235

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  236  NSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  231  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  290

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  291  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  53   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  113  NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  136  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  195

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  196  NSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  135  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  194

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  195  NSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  224  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  283

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  284  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  118  RGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  177

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  NSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AFR42125.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42126.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42127.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42128.1| alpha-tubulin, partial [Populus fremontii]
Length=131

 Score =   231 bits (590),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = -2

Query  605  GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN  426
            GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN
Sbjct  1    GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN  60

Query  425  STSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            STSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  61   STSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  112



>gb|AFR42123.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   231 bits (590),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAXATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   235 bits (600),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  112  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  171

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  172  NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>gb|ABR26014.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=133

 Score =   231 bits (589),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMIS
Sbjct  2    RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>emb|CDY46272.1| BnaC05g50610D [Brassica napus]
Length=289

 Score =   236 bits (603),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  159  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  218

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  219  NSTSVAEVFSRIDHKFDLMYAKRAFFHWYVGEGMEEGEFSEAREDLAALEKDY  271



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  153  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  212

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  213  NNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   235 bits (600),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  126  RGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  185

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTS+AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  186  NSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   233 bits (593),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  53   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N++++AEVFSRIDHKFDLMY KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  113  NTSAIAEVFSRIDHKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  140  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMIS  199

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  NTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  53   RGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  113  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_003886491.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ41034.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
Length=151

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  20   RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  80   NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  53   RGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  113  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  144  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  203

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  204  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  274  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  333

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  334  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  235  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  294

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  295  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  347



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  70   RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  129

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  130  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>emb|CAC84108.1| alpha-tubulin, partial [Gossypium hirsutum]
Length=132

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/111 (99%), Positives = 110/111 (99%), Gaps = 0/111 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  20   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEK  276
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  80   NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  130



>gb|AAG28536.1|AF199019_1 alpha tubulin [Leishmania major]
Length=200

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  69   RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  128

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  129  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  181



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  62   RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  121

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  NSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  174



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  285  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  344

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  345  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  119  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMIS  178

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  179  NSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVV KDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  53   RGDVVRKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYV EGMEEGEFSEAREDLAALEKDY
Sbjct  113  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVSEGMEEGEFSEAREDLAALEKDY  165



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  285  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  344

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  345  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  125  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  184

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  185  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>emb|CDY35856.1| BnaC09g37880D [Brassica napus]
Length=149

 Score =   230 bits (587),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  19   RGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  78

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  79   NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  131



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  119  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMIS  178

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  179  NSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  119  RGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  178

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  179  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  154  RGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  213

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  214  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>ref|XP_006482574.1| PREDICTED: tubulin alpha chain-like [Citrus sinensis]
Length=150

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  20   RGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  80   NSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|AAD50628.1|AF106570_1 alpha-tubulin [Gossypium hirsutum]
Length=127

 Score =   229 bits (584),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/109 (99%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = -2

Query  596  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  417
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  1    VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  60

Query  416  VAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  61   VAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  109



>emb|CAD20819.1| alpha tubulin [Zea mays]
Length=146

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  15   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  74

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  75   NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  127



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  273  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  332

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  333  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  385



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  168  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  227

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  125  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  184

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  185  NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  250  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  309

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST +AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  310  NSTRLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  362



>gb|AAU10519.1| alpha tubulin, partial [Leishmania donovani]
Length=249

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATI+TKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  118  RGDVVPKDVNAAIATIETKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  177

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  301  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  360

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  361  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  215  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  274

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  275  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMIS
Sbjct  53   RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMIS  112

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  113  NSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  286  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  345

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  346  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>gb|AFR42118.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   229 bits (583),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPK  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  2    RGDVVPKXXNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  61

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  62   NSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  305  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  364

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  365  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  417



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  316  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  375

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  376  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  428



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  309  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  368

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  369  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  421



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  322  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  381

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  382  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  434



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  292  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  351

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  352  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  324  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  383

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  384  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  436



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB34154.1| hypothetical protein B456_006G050600 [Gossypium raimondii]
Length=229

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQR V MIS
Sbjct  99   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRVVFMIS  158

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  159  NSTGVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  211



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  59   RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  118

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  119  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  171



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  317  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  376

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  377  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  429



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  323  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  382

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  435



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  118  RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  177

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  109  RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  168

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  169  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  221



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61086.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  336  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  395

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  396  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  448



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  321  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  380

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  381  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>gb|EKG00833.1| epsilon tubulin, putative [Trypanosoma cruzi]
 gb|ESL09113.1| hypothetical protein TRSC58_03174 [Trypanosoma rangeli SC58]
 gb|ESL09781.1| hypothetical protein TRSC58_02494 [Trypanosoma rangeli SC58]
Length=151

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  20   RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  80   NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  124  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  183

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++ E+FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  184  NSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002772835.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER04651.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=153

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMIS
Sbjct  20   RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMIS  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  80   NSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  126  RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  185

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  186  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  238



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  325  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  384

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  437



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  319  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  378

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  379  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  431



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY32266.1| alpha tubulin [Strigomonas culicis]
 gb|EPY32660.1| alpha tubulin [Strigomonas culicis]
Length=150

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  20   RGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  79

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  80   NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  172  RGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  231

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  232  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  284



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  55   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  114

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  115  NSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  167



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  168  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  227

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KF+LMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  NSTAIAEVFSRIDRKFELMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RA CMIS
Sbjct  122  RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRACCMIS  181

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  182  NSTAIAEVFSRMDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  234



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  190  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  249

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  250  NSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61204.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  168  RGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  227

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  301  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  360

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  361  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>gb|AAO46128.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  119  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMIS  178

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRIDHKFD MY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  179  NSTAIAEVFSRIDHKFDSMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_001566612.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM40126.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
Length=259

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  128  RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  187

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  240



>gb|EPY40479.1| tubulin alpha [Angomonas deanei]
 gb|EPY41044.1| tubulin alpha [Angomonas deanei]
 gb|EPY41215.1| tubulin alpha [Angomonas deanei]
Length=248

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  118  RGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  177

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST+VAEVFSRID KFDLMY KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAVAEVFSRIDRKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  295



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  190  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  249

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  250  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  190  RGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  249

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  250  NNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMIS
Sbjct  265  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMIS  324

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            N++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  325  NTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  377



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMIS
Sbjct  76   RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMIS  135

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  136  NSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  188



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVA+VFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVADVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY33355.1| tubulin alpha [Strigomonas culicis]
 gb|EPY33584.1| tubulin alpha [Strigomonas culicis]
Length=315

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  185  RGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  244

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  245  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>gb|EPY39349.1| tubulin alpha, partial [Angomonas deanei]
Length=306

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAA+ATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+
Sbjct  185  RGDVVPKDVNAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIA  244

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVF+RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  245  NSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFV+WCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVEWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  370  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  430  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  482



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61217.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQ VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  183  RGDVVPKDVNAAVATIKTKRTIQLVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  242

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  243  NSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  264  RGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  323

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  324  NSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  376



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABU93324.1| tubulin alpha subunit [Monocercomonoides sp. PA]
Length=452

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  608  RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  429
            RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS
Sbjct  320  RGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIS  379

Query  428  NSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270
            NSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  NSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250