BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030D12

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            191   3e-53   Solanum tuberosum [potatoes]
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            190   4e-53   Solanum tuberosum [potatoes]
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    189   4e-53   Nicotiana tomentosiformis
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    189   1e-52   Nicotiana tomentosiformis
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       188   3e-52   Nicotiana sylvestris
emb|CDP10398.1|  unnamed protein product                                185   3e-51   Coffea canephora [robusta coffee]
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    184   1e-50   Nicotiana tomentosiformis
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       184   1e-50   Nicotiana sylvestris
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    184   1e-50   Nicotiana tomentosiformis
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       182   3e-50   Solanum lycopersicum
ref|XP_002524480.1|  oligopeptide transporter, putative                 178   1e-48   Ricinus communis
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       176   6e-48   Sesamum indicum [beniseed]
gb|KJB07736.1|  hypothetical protein B456_001G041900                    176   9e-48   Gossypium raimondii
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    174   3e-47   Citrus sinensis [apfelsine]
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    174   4e-47   Citrus sinensis [apfelsine]
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            174   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    173   6e-47   Citrus sinensis [apfelsine]
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             173   6e-47   Citrus clementina [clementine]
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       172   1e-46   
gb|KGN60671.1|  hypothetical protein Csa_2G006170                       172   2e-46   
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            172   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like            172   2e-46   
gb|AFR11354.1|  nitrate transporter                                     172   2e-46   Cucumis sativus [cucumbers]
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like            172   2e-46   
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            170   1e-45   Cucumis melo [Oriental melon]
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    169   2e-45   Vitis vinifera
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    169   2e-45   Vitis vinifera
gb|KJB64772.1|  hypothetical protein B456_010G064200                    167   3e-45   Gossypium raimondii
gb|KJB64773.1|  hypothetical protein B456_010G064200                    167   7e-45   Gossypium raimondii
gb|KJB64774.1|  hypothetical protein B456_010G064200                    167   1e-44   Gossypium raimondii
gb|KJB64775.1|  hypothetical protein B456_010G064200                    167   2e-44   Gossypium raimondii
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    165   6e-44   
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    165   7e-44   
emb|CAD33927.1|  nitrate transporter                                    156   1e-43   Cicer arietinum [garbanzo]
gb|KDP32393.1|  hypothetical protein JCGZ_13318                         164   2e-43   Jatropha curcas
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    163   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    163   4e-43   Eucalyptus grandis [rose gum]
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       162   1e-42   Eucalyptus grandis [rose gum]
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     161   1e-42   Eucalyptus grandis [rose gum]
emb|CDX71495.1|  BnaC04g17300D                                          161   2e-42   
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            160   4e-42   Brassica rapa
emb|CDY45207.1|  BnaA07g12830D                                          160   4e-42   Brassica napus [oilseed rape]
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             160   4e-42   Phaseolus vulgaris [French bean]
emb|CDY30787.1|  BnaC07g16870D                                          159   2e-41   Brassica napus [oilseed rape]
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            157   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010093242.1|  Nitrate transporter 1.4                            157   5e-41   
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            156   1e-40   Cicer arietinum [garbanzo]
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       155   1e-40   Cucumis melo [Oriental melon]
gb|AAB95302.1|  putative nitrate transporter                            155   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850084.1|  nitrate transporter 1.4                               155   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    155   3e-40   Arabis alpina [alpine rockcress]
gb|KHN34550.1|  Nitrate transporter 1.4                                 149   4e-40   Glycine soja [wild soybean]
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             154   4e-40   
gb|AAM20651.1|  putative nitrate transporter                            154   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    154   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       154   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       153   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760          153   1e-39   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...    152   2e-39   Citrus sinensis [apfelsine]
gb|AGA60121.1|  nitrate transporter NRT1.4B                             152   2e-39   Cucumis sativus [cucumbers]
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like            152   3e-39   
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...    152   3e-39   Citrus sinensis [apfelsine]
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                   152   4e-39   Citrus sinensis [apfelsine]
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             151   5e-39   
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             151   5e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    151   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006450457.1|  hypothetical protein CICLE_v10008198mg             150   8e-39   
ref|XP_003609313.1|  Nitrate transporter                                150   9e-39   Medicago truncatula
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                150   1e-38   Erythranthe guttata [common monkey flower]
gb|KHN15097.1|  Nitrate transporter 1.4                                 149   2e-38   Glycine soja [wild soybean]
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg             148   5e-38   
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like            148   8e-38   Glycine max [soybeans]
ref|XP_002880817.1|  nitrate transporter                                147   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_011458172.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            147   2e-37   Fragaria vesca subsp. vesca
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    146   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    146   3e-37   Nelumbo nucifera [Indian lotus]
gb|KHN47160.1|  Nitrate transporter 1.4                                 145   5e-37   Glycine soja [wild soybean]
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       144   2e-36   
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       144   2e-36   
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    141   2e-35   Phoenix dactylifera
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    141   2e-35   
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       141   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...    139   8e-35   Setaria italica
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            137   1e-33   Brachypodium distachyon [annual false brome]
emb|CCN27382.1|  low affinity nitrate transporter                       127   3e-33   Triticum aestivum [Canadian hard winter wheat]
gb|EMS53820.1|  Nitrate transporter 1.4                                 132   2e-32   Triticum urartu
gb|EMT23542.1|  Nitrate/chlorate transporter                            133   2e-32   
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       131   8e-32   Phoenix dactylifera
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       131   1e-31   Zea mays [maize]
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2    130   1e-31   
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ90833.1|  predicted protein                                      129   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...    130   4e-31   
gb|EPS59108.1|  hypothetical protein M569_15702                         127   2e-30   Genlisea aurea
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       126   4e-30   
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                   126   6e-30   Gossypium arboreum [tree cotton]
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       125   6e-30   Elaeis guineensis
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       125   8e-30   
ref|XP_010093702.1|  Nitrate transporter 1.1                            121   8e-30   
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                    125   9e-30   
ref|NP_001169613.1|  uncharacterized protein LOC100383494               125   1e-29   Zea mays [maize]
gb|EAY74514.1|  hypothetical protein OsI_02405                          122   1e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001043326.1|  Os01g0556700                                       122   1e-28   
gb|EAZ12317.1|  hypothetical protein OsJ_02208                          122   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KJB82816.1|  hypothetical protein B456_013G215400                    122   1e-28   Gossypium raimondii
dbj|BAD87491.1|  putative dicarboxylate transporter                     122   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       121   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303512.2|  nitrate transporter family protein                 121   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006645998.1|  PREDICTED: nitrate transporter 1.4-like            120   1e-27   
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    119   1e-27   
ref|XP_011033951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       118   2e-27   Populus euphratica
ref|XP_007155636.1|  hypothetical protein PHAVU_003G218500g             117   2e-27   Phaseolus vulgaris [French bean]
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    119   2e-27   
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like            117   7e-27   Glycine max [soybeans]
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             117   7e-27   Phaseolus vulgaris [French bean]
ref|XP_003611284.1|  Nitrate transporter                                117   1e-26   Medicago truncatula
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       117   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN42706.1|  Nitrate transporter 1.1                                 116   2e-26   Glycine soja [wild soybean]
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            116   2e-26   Glycine max [soybeans]
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       116   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       116   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...    116   2e-26   
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       115   4e-26   Phoenix dactylifera
gb|KHN09796.1|  Nitrate transporter 1.1                                 115   5e-26   Glycine soja [wild soybean]
ref|XP_003611286.1|  Nitrate transporter                                115   6e-26   Medicago truncatula
ref|NP_001275529.1|  nitrate transporter 1.1-like                       115   6e-26   Cucumis sativus [cucumbers]
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       115   7e-26   Nelumbo nucifera [Indian lotus]
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       114   9e-26   Populus euphratica
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       114   1e-25   Phoenix dactylifera
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g             114   1e-25   Phaseolus vulgaris [French bean]
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       114   1e-25   Cucumis melo [Oriental melon]
gb|ACR34962.1|  unknown                                                 113   2e-25   Zea mays [maize]
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    113   3e-25   
ref|NP_001145735.1|  uncharacterized protein LOC100279242               113   3e-25   Zea mays [maize]
emb|CDP09929.1|  unnamed protein product                                113   4e-25   Coffea canephora [robusta coffee]
ref|XP_006440345.1|  hypothetical protein CICLE_v10019412mg             111   4e-25   
gb|KHG27943.1|  Uncharacterized protein F383_15837                      112   5e-25   Gossypium arboreum [tree cotton]
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       112   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1                 112   8e-25   Glycine max [soybeans]
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    111   1e-24   
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    111   1e-24   Solanum lycopersicum
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    111   1e-24   
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    111   1e-24   
ref|XP_011463731.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    110   1e-24   Fragaria vesca subsp. vesca
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    111   1e-24   Setaria italica
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       110   2e-24   Sesamum indicum [beniseed]
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg             111   2e-24   Citrus clementina [clementine]
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       110   2e-24   Brachypodium distachyon [annual false brome]
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                   110   2e-24   Citrus sinensis [apfelsine]
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    110   2e-24   Elaeis guineensis
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like            110   2e-24   Citrus sinensis [apfelsine]
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          110   2e-24   Sorghum bicolor [broomcorn]
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            110   2e-24   Eucalyptus grandis [rose gum]
emb|CDY21035.1|  BnaA08g24900D                                          110   3e-24   Brassica napus [oilseed rape]
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            110   3e-24   Brassica rapa
ref|XP_004298652.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    110   3e-24   Fragaria vesca subsp. vesca
gb|KHN34951.1|  Nitrate transporter 1.1                                 109   4e-24   Glycine soja [wild soybean]
gb|KJB46719.1|  hypothetical protein B456_008G2375002                   109   6e-24   Gossypium raimondii
dbj|BAJ98569.1|  predicted protein                                      109   7e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY31242.1|  BnaC08g15370D                                          108   9e-24   Brassica napus [oilseed rape]
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like            108   9e-24   Solanum tuberosum [potatoes]
gb|KDP25643.1|  hypothetical protein JCGZ_20799                         108   9e-24   Jatropha curcas
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       108   9e-24   Sesamum indicum [beniseed]
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                    108   1e-23   Arabis alpina [alpine rockcress]
gb|KHG24776.1|  Uncharacterized protein F383_04224                      108   2e-23   Gossypium arboreum [tree cotton]
gb|KJB20885.1|  hypothetical protein B456_003G170300                    108   2e-23   Gossypium raimondii
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   2e-23   Brassica rapa
emb|CAC07206.1|  nitrate transporter                                    107   2e-23   Brassica napus [oilseed rape]
emb|CDY26539.1|  BnaA09g47380D                                          107   2e-23   Brassica napus [oilseed rape]
gb|AEA35415.1|  nitrate transporter                                     107   3e-23   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    107   3e-23   Cucumis melo [Oriental melon]
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   3e-23   Solanum lycopersicum
ref|XP_004147617.1|  PREDICTED: nitrate transporter 1.1-like            107   3e-23   Cucumis sativus [cucumbers]
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   3e-23   Nicotiana tomentosiformis
emb|CDY15967.1|  BnaC08g41560D                                          107   3e-23   Brassica napus [oilseed rape]
gb|AAA80582.1|  RCH2 protein                                            107   3e-23   Brassica napus [oilseed rape]
emb|CCN27378.1|  low affinity nitrate transporter                       102   3e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   3e-23   Elaeis guineensis
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like            107   3e-23   
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   4e-23   Elaeis guineensis
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            107   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002889915.1|  NRT1.1                                             107   4e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   5e-23   Nicotiana tomentosiformis
emb|CAD32549.1|  dicarboxylate transporter                              106   6e-23   Alnus glutinosa
ref|XP_006366745.1|  PREDICTED: nitrate transporter 1.1-like            106   6e-23   Solanum tuberosum [potatoes]
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       106   8e-23   Nicotiana sylvestris
emb|CAC00544.1|  putative low-affinity nitrate transporter              106   9e-23   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090          106   9e-23   Sorghum bicolor [broomcorn]
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       106   9e-23   Tarenaya hassleriana [spider flower]
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   1e-22   Solanum lycopersicum
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   1e-22   Brachypodium distachyon [annual false brome]
gb|KHG03840.1|  Uncharacterized protein F383_26454                      105   1e-22   Gossypium arboreum [tree cotton]
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like            105   1e-22   Cicer arietinum [garbanzo]
gb|EMT27348.1|  Nitrate/chlorate transporter                            103   1e-22   
emb|CCN27377.1|  low affinity nitrate transporter                       100   1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   2e-22   Sesamum indicum [beniseed]
dbj|BAG91755.1|  unnamed protein product                                103   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470          105   2e-22   Sorghum bicolor [broomcorn]
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg             105   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_002529778.1|  oligopeptide transporter, putative                 105   2e-22   Ricinus communis
ref|XP_004242006.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   2e-22   Solanum lycopersicum
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       105   2e-22   Nicotiana sylvestris
gb|AFK33709.1|  unknown                                                 103   3e-22   Lotus japonicus
ref|NP_001061020.1|  Os08g0155400                                       104   3e-22   
gb|ACU17848.1|  unknown                                                 100   5e-22   Glycine max [soybeans]
ref|XP_006307075.1|  hypothetical protein CARUB_v10008661mg             104   5e-22   Capsella rubella
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       104   5e-22   Nelumbo nucifera [Indian lotus]
ref|NP_563899.1|  nitrate transporter 1.1                               103   5e-22   Arabidopsis thaliana [mouse-ear cress]
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter         104   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KJB20886.1|  hypothetical protein B456_003G170400                    103   5e-22   Gossypium raimondii
dbj|BAC99394.1|  putative nitrate transporter                           103   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ACF86161.1|  unknown                                                 103   6e-22   Zea mays [maize]
gb|EMT09323.1|  Nitrate/chlorate transporter                            104   7e-22   
gb|ACG29230.1|  peptide transporter PTR2                                103   7e-22   Zea mays [maize]
ref|NP_001281186.1|  peptide transporter PTR2                           103   8e-22   Zea mays [maize]
gb|EMT10378.1|  Nitrate/chlorate transporter                            103   8e-22   
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like            103   8e-22   Solanum tuberosum [potatoes]
gb|AAL16907.1|AF420016_1  putative low-affinity nitrate transporter   97.4    8e-22   Narcissus pseudonarcissus
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like            103   9e-22   Oryza brachyantha
emb|CCN27450.1|  low affiniy nitrate transporter                      99.8    9e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       103   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            103   9e-22   Brachypodium distachyon [annual false brome]
gb|EYU24743.1|  hypothetical protein MIMGU_mgv1a003354mg                103   1e-21   Erythranthe guttata [common monkey flower]
dbj|BAJ90348.1|  predicted protein                                      103   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             103   1e-21   
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              103   1e-21   
gb|EYU18566.1|  hypothetical protein MIMGU_mgv1a020825mg                103   1e-21   Erythranthe guttata [common monkey flower]
gb|EAY94439.1|  hypothetical protein OsI_16210                          101   1e-21   Oryza sativa Indica Group [Indian rice]
gb|EAY88182.1|  hypothetical protein OsI_09629                          103   1e-21   Oryza sativa Indica Group [Indian rice]
gb|ABF93501.1|  Nitrate/chlorate transporter, putative, expressed       103   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            102   1e-21   
ref|XP_006648788.1|  PREDICTED: nitrate transporter 1.3-like            101   1e-21   
ref|XP_007039888.1|  Nitrate transporter 1.1 isoform 1                  102   1e-21   
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                102   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_007039889.1|  Nitrate transporter 1.1 isoform 2                  102   2e-21   
ref|XP_009763469.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       102   2e-21   Nicotiana sylvestris
dbj|BAC56915.1|  nitrate transporter                                    102   2e-21   Nicotiana tabacum [American tobacco]
ref|XP_002992556.1|  hypothetical protein SELMODRAFT_135528             101   2e-21   
emb|CBI28188.3|  unnamed protein product                                102   2e-21   Vitis vinifera
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            102   2e-21   
gb|EYU27205.1|  hypothetical protein MIMGU_mgv1a025825mg              99.4    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    102   3e-21   Elaeis guineensis
gb|EEC73483.1|  hypothetical protein OsI_07814                          102   3e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       101   3e-21   Zea mays [maize]
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like            101   4e-21   Cicer arietinum [garbanzo]
ref|XP_003545571.1|  PREDICTED: nitrate transporter 1.3-like            101   4e-21   Glycine max [soybeans]
ref|XP_009800593.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    101   5e-21   Nicotiana sylvestris
ref|XP_009598780.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       101   5e-21   Nicotiana tomentosiformis
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       101   5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047240.1|  Os02g0580900                                       101   5e-21   
dbj|BAC56916.1|  nitrate transporter                                    101   5e-21   Nicotiana tabacum [American tobacco]
gb|KHM99092.1|  Nitrate transporter 1.3                                 101   5e-21   Glycine soja [wild soybean]
ref|NP_001065341.2|  Os10g0554200                                       100   6e-21   
gb|EMT27347.1|  Nitrate/chlorate transporter                            100   6e-21   
ref|XP_010476167.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       100   6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like            100   6e-21   Setaria italica
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       100   7e-21   Brachypodium distachyon [annual false brome]
emb|CAC00545.1|  putative low-affinity nitrate transporter              100   7e-21   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EAY94442.1|  hypothetical protein OsI_16213                        99.4    7e-21   Oryza sativa Indica Group [Indian rice]
gb|ACJ85754.1|  unknown                                               97.8    8e-21   Medicago truncatula
ref|XP_002972328.1|  hypothetical protein SELMODRAFT_97590              100   8e-21   
emb|CAN71417.1|  hypothetical protein VITISV_004658                     100   9e-21   Vitis vinifera
ref|XP_002984329.1|  hypothetical protein SELMODRAFT_119835             100   9e-21   
ref|XP_007013427.1|  Major facilitator superfamily protein, putative    100   9e-21   
gb|EAZ16929.1|  hypothetical protein OsJ_32411                          100   9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like            100   9e-21   Solanum tuberosum [potatoes]
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            100   9e-21   Vitis vinifera
ref|XP_002972498.1|  hypothetical protein SELMODRAFT_97655              100   1e-20   
gb|EEC67416.1|  hypothetical protein OsI_34598                          100   1e-20   Oryza sativa Indica Group [Indian rice]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                  100   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22500.1|  hypothetical protein F775_42780                       98.2    1e-20   
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed       100   1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            100   1e-20   
ref|XP_003519455.1|  PREDICTED: nitrate transporter 1.3                 100   1e-20   Glycine max [soybeans]
gb|EMS61581.1|  Nitrate transporter 1.3                               99.4    1e-20   Triticum urartu
ref|XP_006650950.1|  PREDICTED: nitrate transporter 1.1-like          99.8    1e-20   
emb|CCN27389.1|  low affinity nitrate transporter                     94.4    1e-20   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260        99.8    2e-20   
ref|XP_008367434.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  99.8    2e-20   
ref|NP_001173970.1|  Os04g0464400                                     99.8    2e-20   
ref|XP_010913451.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          99.4    2e-20   
ref|XP_010663912.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     94.0    2e-20   
gb|KHN38482.1|  Nitrate transporter 1.3                               99.4    2e-20   
gb|EYU29794.1|  hypothetical protein MIMGU_mgv1a003534mg              99.0    3e-20   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like          99.0    3e-20   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          98.6    4e-20   
gb|AFG61758.1|  hypothetical protein 0_7737_01                        93.2    5e-20   
gb|AAM47310.1|AF377946_12  putative peptide transporter protein       96.3    5e-20   
gb|KHG00259.1|  Uncharacterized protein F383_18798                    98.2    5e-20   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     98.2    5e-20   
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     98.2    5e-20   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     98.2    6e-20   
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like          98.2    6e-20   
dbj|BAJ97468.1|  predicted protein                                    97.4    6e-20   
gb|EMS68423.1|  Peptide transporter PTR2                              97.8    7e-20   
gb|KJB25600.1|  hypothetical protein B456_004G199600                  95.9    8e-20   
ref|XP_007141630.1|  hypothetical protein PHAVU_008G212300g           97.8    8e-20   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     97.8    9e-20   
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like         97.4    9e-20   
dbj|BAJ97409.1|  predicted protein                                    97.4    9e-20   
dbj|BAJ95092.1|  predicted protein                                    97.4    1e-19   
ref|XP_004952902.1|  PREDICTED: nitrate transporter 1.3-like          97.4    1e-19   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     97.4    1e-19   
gb|EMS63066.1|  Nitrate transporter 1.1                               95.1    1e-19   
ref|XP_009391232.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          97.4    1e-19   
gb|ABR32183.1|  peptide transporter                                   97.1    1e-19   
ref|XP_009589428.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     97.1    1e-19   
gb|KDP30797.1|  hypothetical protein JCGZ_13740                       97.1    1e-19   
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     97.1    1e-19   
ref|XP_009376056.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     97.1    1e-19   
ref|XP_009333673.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     97.1    1e-19   
ref|XP_008238567.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          97.1    1e-19   
ref|XP_003616931.1|  Nitrate transporter                              97.1    1e-19   
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like         97.1    1e-19   
gb|KDP32502.1|  hypothetical protein JCGZ_14705                       93.6    2e-19   
ref|XP_003608752.1|  Nitrate transporter                              97.1    2e-19   
ref|XP_009779307.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     96.7    2e-19   
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg           95.5    2e-19   
ref|XP_008381222.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     94.0    2e-19   
dbj|BAK05363.1|  predicted protein                                    96.7    2e-19   
ref|XP_002970753.1|  hypothetical protein SELMODRAFT_94418            96.3    2e-19   
ref|XP_002969419.1|  hypothetical protein SELMODRAFT_91962            96.3    2e-19   
gb|EPS69660.1|  hypothetical protein M569_05105                       96.3    2e-19   
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     96.3    2e-19   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     97.1    3e-19   
ref|XP_008798046.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...  95.9    3e-19   
gb|KJB25603.1|  hypothetical protein B456_004G199600                  95.9    3e-19   
ref|XP_009333599.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     95.9    3e-19   
ref|XP_010256203.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like    95.9    4e-19   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     95.9    4e-19   
dbj|BAD22820.1|  nitrate transporter                                  95.9    4e-19   
ref|XP_002532260.1|  conserved hypothetical protein                   90.9    4e-19   
ref|XP_007210870.1|  hypothetical protein PRUPE_ppa003177mg           95.9    4e-19   
dbj|BAC81420.1|  nitrate transporter                                  95.9    4e-19   
gb|KJB25604.1|  hypothetical protein B456_004G199600                  95.5    4e-19   
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          95.5    4e-19   
gb|KJB25599.1|  hypothetical protein B456_004G199600                  95.5    4e-19   
ref|NP_001051098.1|  Os03g0719900                                     95.5    4e-19   
gb|EEE59822.1|  hypothetical protein OsJ_12376                        95.5    4e-19   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg           95.5    4e-19   
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     95.5    5e-19   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     95.5    5e-19   
ref|NP_001136757.1|  hypothetical protein                             94.0    5e-19   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106           95.5    5e-19   
gb|ACF22756.1|  nitrate transporter                                   95.5    5e-19   
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340        95.1    5e-19   
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285           95.1    6e-19   
gb|EYU35700.1|  hypothetical protein MIMGU_mgv1a0209461mg             92.0    6e-19   
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  95.1    7e-19   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373           95.1    7e-19   
ref|XP_008367055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     90.1    7e-19   
ref|XP_002521890.1|  peptide transporter, putative                    95.1    7e-19   
gb|AFW77995.1|  hypothetical protein ZEAMMB73_297742                  90.5    9e-19   
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900        94.7    9e-19   
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like         94.7    9e-19   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  94.7    1e-18   
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like         94.7    1e-18   
ref|XP_006848110.1|  hypothetical protein AMTR_s00029p00215100        94.4    1e-18   
gb|KCW46954.1|  hypothetical protein EUGRSUZ_K00766                   94.0    1e-18   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                       94.4    1e-18   
ref|XP_002970258.1|  hypothetical protein SELMODRAFT_231570           94.4    1e-18   
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     94.0    1e-18   
gb|EMT12147.1|  Nitrate/chlorate transporter                          91.7    1e-18   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like         94.0    1e-18   
ref|XP_010035531.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          94.0    2e-18   
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     94.0    2e-18   
ref|XP_008358135.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     94.0    2e-18   
ref|XP_010548886.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          94.0    2e-18   
gb|KFK39483.1|  hypothetical protein AALP_AA3G250100                  94.0    2e-18   
emb|CDP11323.1|  unnamed protein product                              94.4    2e-18   
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173            94.0    2e-18   
ref|XP_002973408.1|  hypothetical protein SELMODRAFT_232069           93.6    2e-18   
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  93.6    2e-18   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1       93.6    2e-18   
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  93.6    2e-18   
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...  93.6    2e-18   
ref|XP_002269955.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          91.3    2e-18   
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like         93.6    2e-18   
gb|KDP44129.1|  hypothetical protein JCGZ_05596                       90.5    2e-18   
ref|XP_002970902.1|  hypothetical protein SELMODRAFT_94322            93.6    2e-18   
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  93.2    3e-18   
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890        93.2    3e-18   
emb|CDM81075.1|  unnamed protein product                              92.8    3e-18   
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  93.2    3e-18   
gb|ACG41138.1|  peptide transporter PTR2                              93.2    3e-18   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          92.8    4e-18   
ref|XP_006841166.1|  hypothetical protein AMTR_s00086p00160300        92.8    4e-18   
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  92.8    4e-18   
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     92.8    4e-18   
dbj|BAJ91042.1|  predicted protein                                    92.0    4e-18   
gb|EMT07041.1|  Peptide transporter PTR2                              93.6    4e-18   
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  92.8    4e-18   
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     92.4    5e-18   
ref|XP_010466420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     92.4    5e-18   
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          92.4    5e-18   
ref|XP_010502212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     92.4    5e-18   
dbj|BAJ91595.1|  predicted protein                                    90.9    5e-18   
ref|XP_009785350.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     92.4    5e-18   
emb|CDP09152.1|  unnamed protein product                              92.4    6e-18   
ref|XP_006297285.1|  hypothetical protein CARUB_v10013300mg           92.4    6e-18   
ref|XP_002274227.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          92.4    6e-18   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790        92.4    6e-18   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like         92.0    6e-18   
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg              92.0    6e-18   
ref|XP_006447628.1|  hypothetical protein CICLE_v10014744mg           92.0    7e-18   
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg              92.0    7e-18   
dbj|BAJ96711.1|  predicted protein                                    92.0    7e-18   
dbj|BAJ91141.1|  predicted protein                                    92.0    7e-18   
dbj|BAJ94405.1|  predicted protein                                    92.0    7e-18   
dbj|BAK08097.1|  predicted protein                                    92.0    7e-18   
gb|EMT02211.1|  Peptide transporter PTR1                              92.0    8e-18   
ref|XP_006447629.1|  hypothetical protein CICLE_v10014744mg           92.0    8e-18   
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g           91.7    8e-18   
ref|XP_002969637.1|  hypothetical protein SELMODRAFT_91845            92.0    8e-18   
emb|CDP05420.1|  unnamed protein product                              92.0    9e-18   
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708            91.3    9e-18   
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...  91.7    1e-17   
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     91.7    1e-17   
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...  91.7    1e-17   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...  91.7    1e-17   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...  91.7    1e-17   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg           91.7    1e-17   
gb|EMS66305.1|  Peptide transporter PTR2                              92.0    1e-17   
emb|CDY03084.1|  BnaC07g21430D                                        91.7    1e-17   
ref|XP_010510466.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     91.7    1e-17   
ref|XP_001771110.1|  predicted protein                                91.7    1e-17   
ref|XP_008342128.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     91.3    1e-17   
gb|KDO54285.1|  hypothetical protein CISIN_1g008231mg                 91.3    1e-17   
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606  92.4    1e-17   
ref|XP_010488187.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          91.3    1e-17   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176           91.3    1e-17   
gb|KDO54284.1|  hypothetical protein CISIN_1g008231mg                 91.3    1e-17   
emb|CBI28855.3|  unnamed protein product                              92.0    1e-17   
ref|NP_001130581.1|  uncharacterized protein LOC100191680             90.9    1e-17   
ref|XP_011100362.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          91.3    1e-17   
gb|AAO64143.1|  putative oligopeptide transporter protein             90.9    1e-17   
gb|EMT07614.1|  Peptide transporter PTR2                              88.6    1e-17   
gb|EMT28633.1|  Peptide transporter PTR5                              90.5    1e-17   
ref|XP_002976499.1|  hypothetical protein SELMODRAFT_105638           90.9    1e-17   
dbj|BAF00365.1|  oligopeptide transporter - like protein              90.9    2e-17   
ref|XP_003597144.1|  Nitrate/chlorate transporter                     90.9    2e-17   
ref|XP_002962950.1|  hypothetical protein SELMODRAFT_165561           90.9    2e-17   
ref|XP_010244160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          90.9    2e-17   
gb|AFK35387.1|  unknown                                               90.9    2e-17   
ref|NP_195738.1|  peptide transporter PTR5                            90.9    2e-17   
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...  90.9    2e-17   
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  90.9    2e-17   
ref|NP_178313.1|  peptide transporter PTR2                            90.9    2e-17   
emb|CAA54634.1|  oligopeptide transporter 1-1                         90.9    2e-17   
dbj|BAJ85008.1|  predicted protein                                    90.9    2e-17   
gb|ACN26865.1|  unknown                                               90.9    2e-17   
ref|NP_001131161.1|  uncharacterized protein LOC100192469             90.9    2e-17   
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     90.9    2e-17   
ref|XP_011028220.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...  90.9    2e-17   
ref|XP_001774221.1|  predicted protein                                90.9    2e-17   
gb|EMS66817.1|  Peptide transporter PTR5                              90.5    2e-17   
dbj|BAJ95903.1|  predicted protein                                    90.9    2e-17   
ref|XP_011028221.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...  90.9    2e-17   
gb|AAC32034.1|  peptide transporter                                   90.9    2e-17   
ref|XP_002978416.1|  hypothetical protein SELMODRAFT_418286           90.5    2e-17   
ref|XP_010276259.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...  90.5    2e-17   
ref|XP_004506528.1|  PREDICTED: nitrate transporter 1.5-like          90.9    2e-17   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     90.9    2e-17   
ref|XP_009374284.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  90.5    2e-17   
ref|XP_008379664.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     90.9    2e-17   
ref|XP_004297798.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     90.9    2e-17   
ref|XP_008340555.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     88.2    2e-17   
ref|XP_008647800.1|  PREDICTED: peptide transporter PTR2 isoform X1   90.1    2e-17   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     90.9    2e-17   
gb|ABD33073.1|  TGF-beta receptor, type I/II extracellular region     90.5    2e-17   
gb|KJB55776.1|  hypothetical protein B456_009G093900                  90.5    2e-17   
ref|XP_002441094.1|  hypothetical protein SORBIDRAFT_09g020300        90.5    2e-17   
gb|KJB55777.1|  hypothetical protein B456_009G093900                  90.5    2e-17   
ref|XP_009374282.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  90.5    2e-17   
ref|XP_003597183.1|  Peptide transporter PTR1                         90.5    2e-17   
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     90.5    2e-17   
ref|XP_008340338.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like    90.5    2e-17   
dbj|BAK03852.1|  predicted protein                                    90.5    2e-17   
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     90.5    3e-17   
ref|XP_008242854.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     85.1    3e-17   
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg           90.1    3e-17   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     90.5    3e-17   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    90.1    3e-17   
dbj|BAJ86984.1|  predicted protein                                    90.1    3e-17   
ref|XP_002443661.1|  hypothetical protein SORBIDRAFT_08g023060        90.1    3e-17   
gb|KFK43704.1|  hypothetical protein AALP_AA1G162300                  90.1    3e-17   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812            90.1    3e-17   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     90.1    4e-17   
ref|XP_008388132.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     89.7    4e-17   
ref|XP_002875108.1|  ATPTR2-B                                         90.1    4e-17   
gb|ADQ43190.1|  peptide transporter                                   89.7    4e-17   
ref|NP_001147810.1|  peptide transporter PTR2                         89.7    4e-17   
ref|XP_008801152.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...  89.4    4e-17   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     89.7    4e-17   
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like         89.7    4e-17   
ref|XP_002962329.1|  hypothetical protein SELMODRAFT_78769            89.7    5e-17   
ref|XP_009101283.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          89.7    5e-17   



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL  A S GR+ STL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQS
Sbjct  419  IGMAAAALAEQKRLTVAKSVGRNTSTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQS  478

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SSFLVSV+ K T ++   Q WLADNINYGRLD FYWLL
Sbjct  479  PKGMKTMSTGLFLTTLSLGFFISSFLVSVINKTTKSNATAQGWLADNINYGRLDFFYWLL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            A LGVINF +YL C+ W+KPRK KSA+ MET+ NG G E+KC
Sbjct  539  AALGVINFAIYLNCATWYKPRKPKSAIPMETLHNGYGAEDKC  580



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM ++A +E KRL+ A S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQS
Sbjct  415  MGMGIAALVEMKRLSVAKSTGRNISTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQS  474

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  + K  + S+GG DWLADNINYGRLD FY LL
Sbjct  475  PKGMKTM-STGLFLTTLALGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLL  533

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A LGVINFV+YL C+ WFKPRK KSA+ MET+ NGN  E+KC
Sbjct  534  AILGVINFVLYLFCATWFKPRKAKSAINMETINNGNVVEDKC  575



>ref|XP_009608738.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=533

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA++A ++ KRL+ A S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQS
Sbjct  373  MGMAIAALVDLKRLSVAKSVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQS  432

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SSFLVS++KKVT  S+GG  WLADNINY RLD FY LL
Sbjct  433  PKGMKTMSTGLFLTTLSLGFFFSSFLVSIIKKVTR-SNGGDGWLADNINYARLDCFYGLL  491

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A LGVINF +YLIC+IWFKPRK+KSA++METV NGN  ++KC
Sbjct  492  AILGVINFALYLICAIWFKPRKSKSAIQMETVKNGNAADDKC  533



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA++A ++ KRL+ A S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQS
Sbjct  418  MGMAIAALVDLKRLSVAKSVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQS  477

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SSFLVS++KKVT  S+GG  WLADNINY RLD FY LL
Sbjct  478  PKGMKTMSTGLFLTTLSLGFFFSSFLVSIIKKVTR-SNGGDGWLADNINYARLDCFYGLL  536

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A LGVINF +YLIC+IWFKPRK+KSA++METV NGN  ++KC
Sbjct  537  AILGVINFALYLICAIWFKPRKSKSAIQMETVKNGNAADDKC  578



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA++A ++ KRL+ A S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQS
Sbjct  416  IGMAIAALVDLKRLSVAKSVGRNMSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQS  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  + K  + S+GG  WLADNINY RLD FY LL
Sbjct  476  PKGMKTM-STGLFLTTLSLGFFFSSFLVSIIKKVTGSNGGDGWLADNINYARLDCFYGLL  534

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A LGVINF +YLI +IWFKPRK+KSAV+METV NGN  ++KC
Sbjct  535  AILGVINFALYLIAAIWFKPRKSKSAVQMETVKNGNAADDKC  576



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A +E KRL+ A S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  418  IGMAAAALVEMKRLSVAKSAGRTTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  477

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SS LVS+VK  T  SH G+ WLAD INYGRLDLFY LL
Sbjct  478  PKGMKTMSTGLFLTTLSLGFFFSSMLVSIVKGATR-SHRGEGWLADKINYGRLDLFYALL  536

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            A LGVINFVVY IC++W+KP+K   AVEM  V NG G EEKC
Sbjct  537  AVLGVINFVVYSICAVWYKPKKPNPAVEMGNVANGAGAEEKC  578



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  EKKRL  A S GRHNS+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  413  IGMAAAALAEKKRLTVAKSMGRHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFIT  472

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYW
Sbjct  473  QSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYW  532

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            LLA LGVIN V+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  533  LLAVLGVINIVIYLICATWYKPRKPKSAIQMENPHTKNAAEEKC  576



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  EKKRL  A S GRH+S+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  424  IGMAAAALAEKKRLTVAKSVGRHSSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFIT  483

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYW
Sbjct  484  QSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYW  543

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            LLA LGVINFV+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  544  LLAVLGVINFVIYLICATWYKPRKAKSAIQMENPHTKNAAEEKC  587



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  EKKRL  A S GRHNS+  L +SVF+LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  420  IGMAAAALAEKKRLTVAKSMGRHNSSTNLPISVFFLIPQFFLVGAGEAFIYTGQLDFFIT  479

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLADNIN GRLDLFYW
Sbjct  480  QSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLADNINNGRLDLFYW  539

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            LLA LGVIN V+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  540  LLAVLGVINIVIYLICATWYKPRKPKSAIQMENPHTKNAAEEKC  583



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM ++A +E KRL+ A S GR+ STL +SVFYLIPQFFLVG+GE F+YTGQLDFF+TQS
Sbjct  417  MGMGIAALVEMKRLSVAKSTGRNLSTLPISVFYLIPQFFLVGAGEGFIYTGQLDFFITQS  476

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  + K  + S+GG DWLADNINYGRLD FY LL
Sbjct  477  PKGMKTM-STGLFLTTLALGFFVSSFLVSIIKKVTGSNGGHDWLADNINYGRLDCFYGLL  535

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A LGVINFV+Y+IC+ WFKPRK+K    MET+ NGN  E+KC
Sbjct  536  AILGVINFVLYIICATWFKPRKDK---YMETINNGNVVEDKC  574



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 3/164 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A +E+KRL+ A + G    TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQS
Sbjct  418  LGMAAAALVERKRLSVAKAVGGDTLTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQS  477

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFFVSSFLV VVK+VT ++ GGQ WLADNINYGRLD FY LL
Sbjct  478  PKGMKTMSTGLFLTTLSLGFFVSSFLVMVVKRVTGSNGGGQGWLADNINYGRLDCFYGLL  537

Query  285  AGLGVINFVVYLICSIWFKPRKN--KSAVEMETVMNGN-GEEKC  163
            A LGV+NFVVYLIC++W+KPR +   +A++ME V NG+  EEKC
Sbjct  538  AVLGVVNFVVYLICALWYKPRNSAKSAALQMENVGNGSLAEEKC  581



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGM V+   E KRL+ A S  R +S L +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQS
Sbjct  421  VGMGVATLAEMKRLSVAKSVSRSSSNLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  ++S+GGQ WLADNINYGRLD FY LL
Sbjct  481  PKGMKTM-STGLFLTTLSLGFFVSSFLVSVIKKVTSSNGGQGWLADNINYGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPR---KNKSAVEMETVMNGNGEEKC  163
            A LG+IN V+YLIC++W+KP    K + A++ME   NG+GEE+C
Sbjct  540  AVLGIINLVIYLICAVWYKPDQKPKPQPALQMEAKFNGSGEERC  583



>gb|KJB07736.1| hypothetical protein B456_001G041900 [Gossypium raimondii]
Length=581

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 118/162 (73%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A  EKKRLA A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQS
Sbjct  421  LGMAVAALAEKKRLAVARTVGATTTTLPISVFMLIPQFFLVGAGEAFIYTGQLDFFITQS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + S+ GQ WLADNIN+GRLD FY LL
Sbjct  481  PKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGSNDGQGWLADNINHGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            A LGVINFV+YL+ ++W+KP+  K A++MET++NG + E KC
Sbjct  540  AVLGVINFVLYLVFAVWYKPKNPKPALQMETIVNGSSAENKC  581



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL+ A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  400  VGMAAAALVERKRLSVARAVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  459

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + S GG  WLADNIN GRLDLFY LL
Sbjct  460  PKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLL  518

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            A L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  519  AILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  560



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL+ A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  405  VGMAAAALVERKRLSVARAVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  464

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + S GG  WLADNIN GRLDLFY LL
Sbjct  465  PKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLL  523

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            A L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  524  AILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  565



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANS-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            VGMA +A  E+KRL+ A S    +N TL +SVF+L+PQFFLVGSGEAF+YTGQLDFFLTQ
Sbjct  421  VGMAAAALAEQKRLSVAKSVTHNYNKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFLTQ  480

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVT +S  GQ WLADNIN+GRLD FYWL
Sbjct  481  SPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDCFYWL  540

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LA L  INFVVY++C++WFKPRK K A+EM      + E+ C
Sbjct  541  LAVLSGINFVVYMVCALWFKPRKGKGALEMADGKGFSVEDNC  582



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL+ A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  415  VGMAAAALVERKRLSVARAVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  474

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + S GG  WLADNIN GRLDLFY LL
Sbjct  475  PKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLL  533

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            A L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  534  AILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  575



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL+ A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  415  VGMAAAALVERKRLSVARAVGLTTATLPVSVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  474

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + S GG  WLADNIN GRLDLFY LL
Sbjct  475  PKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLADNINRGRLDLFYGLL  533

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            A L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  534  AILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  575



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 6/162 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL  A S GR+ STL +SVF LIPQFF VG+GEAF+YTGQLDFF+TQS
Sbjct  413  IGMAAAALAEQKRLTVAKSAGRNTSTLPISVFLLIPQFFFVGAGEAFIYTGQLDFFITQS  472

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SSFLVSV+KK T  +   Q WLADNINYGRLDLFYWLL
Sbjct  473  PKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKATKTNATAQGWLADNINYGRLDLFYWLL  532

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            A LGVINF +YL  + W+KPRK KS +      NG G ++KC
Sbjct  533  AALGVINFAIYLNSATWYKPRKPKSPIP-----NGYGAQDKC  569



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEMKRLSVAKAVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNINY RLD FY LL 
Sbjct  482  KGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLT  540

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  163
             L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  541  ILSTINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANS-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            +GMA +A  E+KRL+ A S    H+ TL +SVF+L+PQFFLVGSGEAF+YTGQLDFF+TQ
Sbjct  421  LGMAAAALAEQKRLSVAKSVTTAHSKTLPISVFFLVPQFFLVGSGEAFIYTGQLDFFITQ  480

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVT +S  GQ WLADNIN+GRLD FYWL
Sbjct  481  SPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTGSSGNGQGWLADNINHGRLDRFYWL  540

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LA L  IN VVY+IC+ WFKPRK K AVEM +    + EE C
Sbjct  541  LAVLSGINIVVYMICAFWFKPRKGKGAVEMASGKGFSVEENC  582



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  464  GMAAAALVEMKRLSVAKAVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  523

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNINY RLD FY LL 
Sbjct  524  KGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLT  582

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  163
             L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  583  ILSTINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  623



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEIKRLSVAKAVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNINY RLD FY LL 
Sbjct  482  KGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLT  540

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  163
             L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  541  ILSAINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A + GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  464  GMAAAALVEIKRLSVAKAVGRSTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  523

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNINY RLD FY LL 
Sbjct  524  KGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLADNINYARLDCFYGLLT  582

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  163
             L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  583  ILSAINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  623



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A + G   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEMKRLSVAKAVGISTATLPLSVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNINY RLD FY LLA
Sbjct  482  KGMKTM-STGLFLTTLSLGFFVSSFLVAVVKRVTGSMDGQGWLADNINYARLDCFYGLLA  540

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  163
             L  INFV +L+C++W+KP+K K  +EMET  N G+G EKC
Sbjct  541  ILSAINFVAFLVCAVWYKPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGM  +A  E++RL+ A + G + +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  416  VGMTAAALAERRRLSVAKAVGDNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S  +  V K  + S  GQ WLADNINYGRLD FY LL
Sbjct  476  PKGMKTM-STGLFLSTLSLGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLL  534

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A L  INF V+L+C++W+KP+K    ++MET+ NG+  EEKC
Sbjct  535  AILSFINFAVFLVCAVWYKPQKPNDGMQMETMANGSCPEEKC  576



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGM  +A  E++RL+ A + G + +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  420  VGMTAAALAERRRLSVAKAVGDNTATLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  479

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S  +  V K  + S  GQ WLADNINYGRLD FY LL
Sbjct  480  PKGMKTM-STGLFLSTLSLGFFVSSFLVSVVKRVTGSRDGQGWLADNINYGRLDCFYGLL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            A L  INF V+L+C++W+KP+K    ++MET+ NG+  EEKC
Sbjct  539  AILSFINFAVFLVCAVWYKPQKPNDGMQMETMANGSCPEEKC  580



>gb|KJB64772.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=446

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  E KRL  A + G   +T  L ++VF LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  281  MGMASAAVAEVKRLEVARATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFIT  340

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY 
Sbjct  341  QSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYG  400

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  163
            LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  401  LLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  446



>gb|KJB64773.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=517

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  E KRL  A + G   +T  L ++VF LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  352  MGMASAAVAEVKRLEVARATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFIT  411

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY 
Sbjct  412  QSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYG  471

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  163
            LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  472  LLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  517



>gb|KJB64774.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=541

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  E KRL  A + G   +T  L ++VF LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  376  MGMASAAVAEVKRLEVARATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFIT  435

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY 
Sbjct  436  QSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYG  495

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  163
            LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  496  LLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  541



>gb|KJB64775.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=586

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            +GMA +A  E KRL  A + G   +T  L ++VF LIPQFFLVG+GEAF+YTGQLDFF+T
Sbjct  421  MGMASAAVAEVKRLEVARATGASATTGTLPVTVFILIPQFFLVGAGEAFIYTGQLDFFIT  480

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            QSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLADNIN+GRLD FY 
Sbjct  481  QSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLADNINHGRLDCFYG  540

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  163
            LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  541  LLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  586



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A  EKKRLA A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  432  GMAAAALAEKKRLAVARAAGATTATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSP  491

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S+ GQ WLADNIN+GRLD FY L+A
Sbjct  492  KGMKTM-STGLFLTTLSLGFFVSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVA  550

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
             L +INFVVYL+C+ W KPRK K A++MET++NG + E+KC
Sbjct  551  VLDIINFVVYLVCAAWHKPRKPKPALQMETIVNGSSAEDKC  591



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A  EKKRLA A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALAEKKRLAVARAAGATTATLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITQSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S+ GQ WLADNIN+GRLD FY L+A
Sbjct  482  KGMKTM-STGLFLTTLSLGFFVSSFLVSVVKRLTGSNDGQGWLADNINHGRLDCFYGLVA  540

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
             L +INFVVYL+C+ W KPRK K A++MET++NG + E+KC
Sbjct  541  VLDIINFVVYLVCAAWHKPRKPKPALQMETIVNGSSAEDKC  581



>emb|CAD33927.1| nitrate transporter [Cicer arietinum]
Length=201

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA ++  E KRL+ A S   + +T+ +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  42   GMAAASLCEVKRLSVAKSVKGNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  101

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + +  GQ WLADNIN GRLDLF+ LL 
Sbjct  102  KGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLT  160

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
             L  INFV +L+C+ W+KP+K K +++M  + NG+  EEKC
Sbjct  161  ILSFINFVAFLVCAFWYKPKKAKPSMQMGAINNGSSVEEKC  201



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 133/169 (79%), Gaps = 8/169 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S     STL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  418  LGMAAAALAERKRLSVAKSADGKTSTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  477

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SSFLV VVKKVT ++  GQ WL DNIN GRLD FY LL
Sbjct  478  PKGMKTMSTGLFLTTLSLGFFFSSFLVIVVKKVTGSNGTGQGWLGDNINNGRLDCFYGLL  537

Query  285  AGLGVINFVVYLICSIWFKPRK------NKSA-VEMETVMNGN-GEEKC  163
            A L VINF+VYL+C++W+KPRK      +KSA ++ME + NG+  EEKC
Sbjct  538  ATLCVINFLVYLVCALWYKPRKKNTNNDHKSAGLQMENMGNGSLAEEKC  586



>ref|XP_010050000.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW82844.1| hypothetical protein EUGRSUZ_C04215 [Eucalyptus grandis]
Length=535

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM  +A  E+KRL+ A S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  375  LGMLAAAITERKRLSVAASVGRATTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  434

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  V K  + S G Q WLAD+INYGRLD F+ LL
Sbjct  435  PKGMKTM-STGLFLTTLSLGFFLSSLLVSVVKKATGSGGRQGWLADHINYGRLDWFFGLL  493

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  169
              L ++NFVVYL+C+ W+KP+K K  ++ME + NG+  E
Sbjct  494  TILSLVNFVVYLVCAAWYKPQKPKPTLQMEKIGNGSAME  532



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM  +A  E+KRL+ A S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  420  LGMLAAAITERKRLSVAASVGRATTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  479

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  V K  + S G Q WLAD+INYGRLD F+ LL
Sbjct  480  PKGMKTM-STGLFLTTLSLGFFLSSLLVSVVKKATGSGGRQGWLADHINYGRLDWFFGLL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  169
              L ++NFVVYL+C+ W+KP+K K  ++ME + NG+  E
Sbjct  539  TILSLVNFVVYLVCAAWYKPQKPKPTLQMEKIGNGSAME  577



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  420  LGMAAAAITERKRLSVAASVGRTTTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  479

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  + K  + +  GQ WLADNINYGRLD FY LL
Sbjct  480  PKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
              L ++NFV YL+C+ W KP+K K  ++ E + NG+  E+
Sbjct  539  TLLSLVNFVAYLVCAAWCKPQKLKPTMQKEKIGNGSSMEE  578



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S GR  +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  416  LGMAAAAITERKRLSVAASVGRTTTTLPVSVFLLIPQFFLVGSGEAFIYTGQLDFFITQS  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  + K  + +  GQ WLADNINYGRLD FY LL
Sbjct  476  PKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKKATGTGAGQGWLADNINYGRLDCFYGLL  534

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
              L ++NFV YL+C+ W KP+K K  ++ E + NG+  E+
Sbjct  535  TLLSLVNFVAYLVCAAWCKPQKLKPTMQKEKIGNGSSMEE  574



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 125/150 (83%), Gaps = 3/150 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  444  VGMAAAAIVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQS  501

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL
Sbjct  502  PKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLL  560

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEME  196
              L  INFVVYLIC++WFKP K K + EME
Sbjct  561  VILSGINFVVYLICALWFKPTKGKDSEEME  590



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  421  IGMAAAAIVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQS  478

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL
Sbjct  479  PKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLL  537

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEME  196
              L  INFVVY+IC++WFKP K+K + EME
Sbjct  538  VILSGINFVVYVICALWFKPTKSKDSEEME  567



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  431  IGMAAAAIVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQS  488

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL
Sbjct  489  PKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLL  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEME  196
              L  INFVVY+IC++WFKP K+K + EME
Sbjct  548  VILSGINFVVYVICALWFKPTKSKDSEEME  577



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMAV++  E+KRL+ A S   +N+TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+SP
Sbjct  422  GMAVASLCERKRLSVAKSVTGNNATLPISVFLLIPQFFLVGTGEAFIYTGQLDFFITRSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + +  GQ WLADNIN GRLDLFY LL 
Sbjct  482  KGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGTRDGQGWLADNINQGRLDLFYGLLT  540

Query  282  GLGVINFVVYLICSIWFKPRKNK-SAVEMETVMNGNGEEKC  163
             L  +NFV +L+C++WFKP+K K  A++M  +     EEKC
Sbjct  541  ILSFVNFVAFLVCAVWFKPKKPKQPAMQMGAINGSTAEEKC  581



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+KRL  A S  +    L +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  445  VGMAAAAIVEQKRLLVAKSSTQK--ILPISVFQLVPQFFLVGSGEAFIYTGQLDFFITQS  502

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLDLFYWLL
Sbjct  503  PKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLADNINHGRLDLFYWLL  561

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEME  196
            A L  INFVVY+IC++WFKP K K + EME
Sbjct  562  AILSGINFVVYVICALWFKPTKGKDSEEME  591



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 9/168 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  EKKRL  A + GR   TL +SV++LIPQFFLVG+GEAF+YTGQLDFF+TQS
Sbjct  424  LGMAAAAMAEKKRLNVAIAVGRDTQTLPISVYFLIPQFFLVGAGEAFIYTGQLDFFITQS  483

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PKSMKTM +     T     F  S  +  + K  +A    + WLAD+INYG+LD FYWLL
Sbjct  484  PKSMKTM-STGLFLTTLSLGFFLSSFLVSLIKSVTAKRNTEGWLADDINYGKLDYFYWLL  542

Query  285  AGLGVINFVVYLICSIWFK-PRKNKSAVEMETVMNGNG------EEKC  163
              L +INFV +++C+IWFK P+KN +++ M+ V NGNG      EEKC
Sbjct  543  TLLSLINFVAFMVCAIWFKPPKKNNNSISMK-VSNGNGASYGGAEEKC  589



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A  E KRL  A S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  420  GMAAAALSEMKRLLVAKSAAPTTQTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + S  GQ WLADNIN GRLD FY LL 
Sbjct  480  KGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGSRDGQGWLADNINEGRLDCFYGLLT  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETV-MNGNGE--EKC  163
             LGVINF  Y++C+ W+KP+K K AV+M  +  NGN +  ++C
Sbjct  539  VLGVINFAAYIVCAKWYKPKKAKPAVQMSGINANGNNDNYDRC  581



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA ++  E KRL+ A S   + +T+ +SVF LIPQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAASLCEVKRLSVAKSVKGNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSP  481

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTM +     T     F  S  +  V K  + +  GQ WLADNIN GRLDLF+ LL 
Sbjct  482  KGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLT  540

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
             L  INFV +L+C+ W+KP+K K +++M  + NG+  EEKC
Sbjct  541  ILSFINFVAFLVCAFWYKPKKAKPSMQMGAINNGSSVEEKC  581



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRLA A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  422  LGMAAAALAERKRLAVAKAVGGDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  481

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM     L   +L          V        + G+ WLADNINYGRLD FY LL
Sbjct  482  PKGMKTM--STGLFLTTLSLGFFISSFLVSVVKRVTGNDGEGWLADNINYGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
              L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  540  TILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  580



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 127/162 (78%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  431  GMAAAALVEQKRLSVAKSSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  488

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL 
Sbjct  489  KGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLV  547

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INFVVY+IC++WFKP K K +VE E   NG G   E C
Sbjct  548  ILSGINFVVYIICALWFKPTKGKDSVEKE---NGKGFSVEDC  586



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 127/162 (78%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INFVVY+IC++WFKP K K +VE E   NG G   E C
Sbjct  539  ILSGINFVVYIICALWFKPTKGKDSVEKE---NGKGFSVEDC  577



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E KRL+ A S    + TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEGKRLSVAKST--THKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSTDG-GWLADNINHGRLDCFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
             L  +NFVVY+IC++WFKP K K + E ET  N    E C
Sbjct  539  ILSGVNFVVYIICALWFKPTKGKDSAEKET-SNSFSVEDC  577



>gb|KHN34550.1| Nitrate transporter 1.4, partial [Glycine soja]
Length=272

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 108/165 (65%), Gaps = 6/165 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            GMA ++  E+KRL+ A S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T
Sbjct  109  GMAAASVCERKRLSVAKSVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFIT  168

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            +SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD+IN GRLDLFY 
Sbjct  169  RSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYA  227

Query  291  LLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  163
            LL  L  +NFV + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  228  LLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  272



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 125/162 (77%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  415  GMAAAAIVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  472

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTS S  G  WLADNIN+GRLD FYWLL 
Sbjct  473  KGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTSTSTDG-GWLADNINHGRLDYFYWLLV  531

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INFV Y IC++WFKP K K + E E   NG G   E C
Sbjct  532  ILSGINFVAYFICALWFKPTKGKDSAEKE---NGKGFTAEDC  570



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 126/162 (78%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL  A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLCVAKSSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTST-DVGWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INFVVY+IC++WFKP K K +VE E   NG G   E C
Sbjct  539  ILSGINFVVYIICALWFKPTKGKDSVEKE---NGKGFSVEDC  577



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 126/162 (78%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INFVVY IC++WFKP K K + E +   NG G   E C
Sbjct  539  ILSGINFVVYFICALWFKPTKGKDSAEKD---NGKGFSAEDC  577



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 125/162 (77%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INF VY IC++WFKP K K + E E   NG G   E C
Sbjct  539  ILSGINFGVYFICALWFKPTKGKDSAEKE---NGKGFAAEDC  577



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 126/162 (78%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS+S  G  WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSSSTDG-GWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INF VY IC++WFKP K K + E E   NG G   E C
Sbjct  539  ILSGINFGVYFICALWFKPTKGKDSAEKE---NGKGFSAEDC  577



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MA +A IE KRL  A      +  L MSVFYL+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  416  ISMASAALIEAKRLNIAKDLHDEHGPLPMSVFYLVPQFFLVGSGEAFIYTGQLDFFITQS  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P  MKTMSTGLFLTTLSLGFFVSS LVS+V ++T  S G   WLAD+IN GRLD FYWLL
Sbjct  476  PAGMKTMSTGLFLTTLSLGFFVSSMLVSMVDRITGGS-GKGGWLADDINKGRLDCFYWLL  534

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN  178
            +GL ++NF VYL C+ WFKPR     +EME    GN
Sbjct  535  SGLSLVNFAVYLWCAAWFKPRPPPQDMEMEVADKGN  570



>ref|XP_006483349.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
Length=536

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA ++ +E KRLA A + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQS
Sbjct  376  LGMASASVVEVKRLAVAKANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQS  435

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  + K  + S+G   W+ +NIN GRLD FY LL
Sbjct  436  PKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLL  494

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
            A L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  495  AALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  534



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E KRL  A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  422  LGMAAAALAESKRLGVAKAVGGDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  481

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM     L   +L          V        + G+ WLADN+NYGRLD FY LL
Sbjct  482  PKGMKTM--STGLFLSTLSLGFFISSFLVSVVKRVTGNDGEGWLADNVNYGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
              L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  540  TILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  580



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E KRL  A + G   +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF+T+S
Sbjct  441  LGMAAAALAESKRLGVAKAVGGDTTTLPISVFLLIPQFFLVGAGEAFIYTGQLDFFITKS  500

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM     L   +L          V        + G+ WLADN+NYGRLD FY LL
Sbjct  501  PKGMKTM--STGLFLSTLSLGFFISSFLVSVVKRVTGNDGEGWLADNVNYGRLDCFYGLL  558

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
              L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  559  TILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  599



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA ++ +E KRLA A + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQS
Sbjct  421  LGMASASVVEVKRLAVAKANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  + K  + S+G   W+ +NIN GRLD FY LL
Sbjct  481  PKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
            A L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  540  AALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  579



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA ++ +E KRLA A + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQS
Sbjct  421  LGMASASVVEVKRLAVAKANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  + K  + S+G   W+ +NIN GRLD FY LL
Sbjct  481  PKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
            A L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  540  AALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  579



>ref|XP_006408723.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 gb|ESQ50176.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=533

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S    + T+ +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  377  GMAAAALVEQKRLSVAKSS--THKTMPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  434

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSVVK+VT+ S  G  WLADNIN GRLD FYWLL 
Sbjct  435  KGMKTMSTGLFLTTLSLGFFVSSFLVSVVKRVTATSMDG-GWLADNINQGRLDRFYWLLV  493

Query  282  GLGVINFVVYLICSIWFKPRKNK-SAVEME  196
             L  INFVVY+IC++WFKP K K  +VEME
Sbjct  494  ILSGINFVVYVICALWFKPTKGKEDSVEME  523



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S    + T+ +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSS--THKTMPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSVVK+VT+ S  G  WLADNIN GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSVVKRVTATSMDG-GWLADNINQGRLDRFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNK-SAVEME  196
             L  INFVVY+IC++WFKP K K  +VEME
Sbjct  539  ILSGINFVVYVICALWFKPTKGKEDSVEME  568



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 125/162 (77%), Gaps = 8/162 (5%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A +E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSP
Sbjct  422  GMAAAALVEQKRLSVAKSSTQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSP  479

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLADNIN+GRLD FYWLL 
Sbjct  480  KGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLADNINHGRLDYFYWLLV  538

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
             L  INF VY IC++WFKP K K + E +   NG G   E C
Sbjct  539  ILSGINFGVYFICALWFKPTKGKDSAEKD---NGKGFSAEDC  577



>ref|XP_006450457.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
 gb|ESR63697.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
Length=467

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA ++ +E  RLA A + G   +TL +SVFYLIPQFFLVGSGE FMYTGQLDFF+TQS
Sbjct  307  LGMASASVVEVNRLAVAKANGTTGTTLPISVFYLIPQFFLVGSGEGFMYTGQLDFFITQS  366

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  + K  + S+G   W+ +NIN GRLD FY LL
Sbjct  367  PKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGENINKGRLDCFYGLL  425

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
            A L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  426  AALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  465



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 109/163 (67%), Gaps = 7/163 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA ++ IE KRL+ A     + +TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQS
Sbjct  420  IGMAAASLIEVKRLSVAKGVKGNQTTLPISVFLLVPQFFLVGSGEAFIYTGQLDFFITQS  479

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S  +  V K  + +  GQ WLAD+IN GRLDLFY LL
Sbjct  480  PKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGTRDGQGWLADHINKGRLDLFYALL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
              L  INFV +L+C+ W+KP+K K +++    +NG+   EEKC
Sbjct  539  TILSFINFVAFLVCAFWYKPKKPKPSMQ----INGSSSVEEKC  577



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST---LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            +GMAV+A +E KRL+ A S   + +    + +SVF LIPQFFLVGSGEAF+YTGQLDFF+
Sbjct  419  LGMAVAALVEMKRLSVAKSVNNNTTADDHVPISVFLLIPQFFLVGSGEAFIYTGQLDFFI  478

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
            TQSPK MKTM +     T     F  S  +  V K  + S+GGQ WLADNIN+GRLD FY
Sbjct  479  TQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTTSNGGQGWLADNINHGRLDCFY  537

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNK  214
             LLA LG +N ++YLIC+ W+KP K K
Sbjct  538  GLLAVLGFVNLIIYLICAAWYKPHKPK  564



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 108/165 (65%), Gaps = 6/165 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            GMA ++  E+KRL+ A S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T
Sbjct  418  GMAAASVCERKRLSVAKSVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFIT  477

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            +SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD+IN GRLDLFY 
Sbjct  478  RSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYA  536

Query  291  LLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  163
            LL  L  +NFV + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  537  LLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  581



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 108/166 (65%), Gaps = 6/166 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A  E+KRL+ A + G    TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+S
Sbjct  421  IGMAVAALSERKRLSVARAVGGTTKTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S  +  + K  + S   Q WL DNINYGRLD FY LL
Sbjct  481  PKGMKTM-STGLFLSTLSLGFFVSSFLVSIVKAVTGSKDEQGWLTDNINYGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIWFKPRK-NKSAVEM-ETVMNGNG---EEKC  163
              L VINFVVYL+C+ W+K  + +  A++M  T    NG   E++C
Sbjct  540  TVLSVINFVVYLVCARWYKTHEPHPPALQMTSTTAKANGSSAEDRC  585



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 107/165 (65%), Gaps = 6/165 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            GMA ++  E+KRL+ A S    N   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T
Sbjct  422  GMAAASVCERKRLSVAKSVSGGNQATTTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFIT  481

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            +SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD+IN GRLDLFY 
Sbjct  482  RSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLADSINKGRLDLFYA  540

Query  291  LLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  163
            LL  L  +NF  + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  541  LLTILSFVNFAAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  585



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 121/154 (79%), Gaps = 8/154 (5%)
 Frame = -3

Query  618  EKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMst  439
            E+KRL+ A S  +   TL +SVF L+PQFFLVG+GEAF+YTGQLDFF+TQSPK MKTMST
Sbjct  430  EQKRLSVAKSSSQK--TLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMST  487

Query  438  glflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFV  259
            GLFLTTLSLGFFVSSFLVS+VK+VTS S  G  WLADNIN+GRLD FYWLL  L  INFV
Sbjct  488  GLFLTTLSLGFFVSSFLVSIVKRVTSTSTDG-GWLADNINHGRLDYFYWLLVILSGINFV  546

Query  258  VYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  163
            VY+IC++WFKP K K + E E   NG G   E C
Sbjct  547  VYIICALWFKPTKGKDSAEKE---NGKGFSVEDC  577



>ref|XP_011458172.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 102/162 (63%), Gaps = 7/162 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANS-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            +GMA +A  EKKRL  A   +      L +SV++LIPQFFLVGSGEAF+YTGQLDFF+TQ
Sbjct  424  LGMAAAALTEKKRLLVAKGMKTMSTGALPISVYWLIPQFFLVGSGEAFIYTGQLDFFITQ  483

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTM +     +     F  S  +  + +  + S  GQ WLADNINYGRLD FY L
Sbjct  484  SPKGMKTM-STGLFLSTIALGFFVSSFLVSIVRRFTGSKDGQGWLADNINYGRLDCFYGL  542

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            L+ L VINFV YL+C+ W+KPRK             + E+KC
Sbjct  543  LSVLSVINFVAYLVCARWYKPRKPTKPSN-----GSSAEDKC  579



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            VGM  ++  E KRL+ A +  G  ++TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQ
Sbjct  417  VGMTAASLAEVKRLSVAKDVGGTTSTTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQ  476

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTM +     +     F  S L+  V K  + S+ GQ WLADNIN GRLD FY L
Sbjct  477  SPKGMKTM-STGLFLSTLSLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGL  535

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            LA    INF+++L+C++W+K +K + ++++E   NG + EE C
Sbjct  536  LAVSSFINFLLFLLCTVWYKKQKPQRSLQIEIAANGSSAEEIC  578



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            VGM  ++  E KRL+ A +  G  ++TL +SVF L+PQFFLVGSGEAF+YTGQLDFF+TQ
Sbjct  421  VGMTAASLAEVKRLSVAKDVGGTTSTTLPLSVFLLVPQFFLVGSGEAFIYTGQLDFFITQ  480

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTM +     +     F  S L+  V K  + S+ GQ WLADNIN GRLD FY L
Sbjct  481  SPKGMKTM-STGLFLSTLSLGFFVSSLLVSVVKKVTGSNDGQGWLADNINDGRLDCFYGL  539

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  163
            LA    INF+++L+C++W+K +K + ++++E   NG + EE C
Sbjct  540  LAVSSFINFLLFLLCTVWYKKQKPQRSLQIEIAANGSSAEEIC  582



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSE--GRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            GMA ++  E+KRL+AA S   G   +TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+
Sbjct  422  GMAAASVCERKRLSAAKSVSGGNQATTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITR  481

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPK MKTM +     T     F  S  +  V K  + +  GQ WLADNIN GRLDLFY L
Sbjct  482  SPKGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFYAL  540

Query  288  LAGLGVINFVVYLICSIWFKPRKNK  214
            L  L  INFV + +C++WFKP+K K
Sbjct  541  LTILSFINFVAFAVCALWFKPKKPK  565



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+S
Sbjct  426  IGMAAAALSERKRLSVAKSARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKS  485

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S L+  +    + +  GQ WLA+NINYGRLD FY LL
Sbjct  486  PKGMKTM-STGLFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLL  544

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
              L VINFV YL+C+ W+     + A  ++T  + NG
Sbjct  545  TVLSVINFVAYLVCARWYHKTHKQHAFVLQTA-SANG  580



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+S
Sbjct  426  IGMAAAALSERKRLSXAKSARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKS  485

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S L+  +    + +  GQ WLA+NINYGRLD FY LL
Sbjct  486  PKGMKTM-STGLFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLABNINYGRLDCFYGLL  544

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
              L VINFV YL+C+ W+     + A  ++T  + NG
Sbjct  545  TVLSVINFVAYLVCARWYHKTHKQHAFVLQTA-SANG  580



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG-----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDF  481
            +GMA +A  E KRL+ A   G        +TL +SVF LIPQFFLVG+GEAF+YTGQLDF
Sbjct  424  IGMAAAAVAEVKRLSVARGAGPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDF  483

Query  480  FLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDL  301
            F+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVSVVK +T   H G  WLADNINYGRLD 
Sbjct  484  FITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSVVKSLTGGKH-GNGWLADNINYGRLDC  542

Query  300  FYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            FY LLA L  IN   +L+C+ W KP+  K  ++ E+ V + + +++C
Sbjct  543  FYGLLAVLSAINLGAFLVCAAWSKPQAAKPGLQTESAVKSSSADDEC  589



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG-----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDF  481
            +GMA +A  E KRL+ A   G        +TL +SVF LIPQFFLVG+GEAF+YTGQLDF
Sbjct  420  IGMAAAAVAEVKRLSVARGAGPAAAHHRGTTLPISVFILIPQFFLVGAGEAFVYTGQLDF  479

Query  480  FLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDL  301
            F+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVSVVK +T   H G  WLADNINYGRLD 
Sbjct  480  FITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSVVKSLTGGKH-GNGWLADNINYGRLDC  538

Query  300  FYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            FY LLA L  IN   +L+C+ W KP+  K  ++ E+ V + + +++C
Sbjct  539  FYGLLAVLSAINLGAFLVCAAWSKPQAAKPGLQTESAVKSSSADDEC  585



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 99/156 (63%), Gaps = 2/156 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E+KRL+ A S      TL +SVF LIPQFFLVGSGEAF+YTGQLDFF+T+S
Sbjct  421  IGMAAAALSERKRLSVAKSARSATGTLPISVFLLIPQFFLVGSGEAFIYTGQLDFFITKS  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     +     F  S L+  + K  + +  GQ WLADNINYGRLD FY LL
Sbjct  481  PKGMKTM-STGLFLSTLSLGFFVSSLLVSIVKSVTGNEDGQGWLADNINYGRLDCFYGLL  539

Query  285  AGLGVINFVVYLICSIW-FKPRKNKSAVEMETVMNG  181
              L VINFV YL+C+ W  K  K  + V      NG
Sbjct  540  TVLSVINFVAYLVCARWSHKTHKQHAFVLQMASANG  575



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 114/161 (71%), Gaps = 11/161 (7%)
 Frame = -3

Query  642  GMAVSAXIEKKRLA-AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            GMA +A  EKKRLA AA + G+H S L +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  440  GMAAAAICEKKRLAVAATAAGQHES-LPISVFMLTPQFLLVGAGEAFIYTGQLDFFITRS  498

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D IN+ RLD FYWLL
Sbjct  499  PKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------KGCTTWLGDTINHSRLDYFYWLL  551

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A L V+N V YL+C++W  P  +  A + +  M  +  EKC
Sbjct  552  AVLSVVNLVAYLVCAMWTTPPASSQAEQPQIAMTAD--EKC  590



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A  EKKRLA A +     + L +SVF LIPQF LVG+GEAF+YTGQLDFF+T+SP
Sbjct  478  GMAAAAVCEKKRLAVAAAASTDTAVLPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSP  537

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGLFL TLSLGFF+SS LVS+V        G   WL D IN+ RLD FYWLLA
Sbjct  538  KGMKTMSTGLFLATLSLGFFLSSALVSLV-------KGATTWLGDTINHSRLDYFYWLLA  590

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
             LG +N   YL+C++W  P    S  +         +EKC
Sbjct  591  VLGAVNLAAYLLCAMWATPAAGSSKADPAAT---AADEKC  627



>emb|CCN27382.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=143

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 106/153 (69%), Gaps = 12/153 (8%)
 Frame = -3

Query  618  EKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMst  439
            EKKRL  A S   + + L +SVF LIPQF LVG+GEAF+YTGQLDFF+T+SPKSMKTMST
Sbjct  2    EKKRLTVA-STATNGTALPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRSPKSMKTMST  60

Query  438  glflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFV  259
            GLFLTTLSLGFF+SS LVS+V        G   WL D IN+ RLD FYWLLA LG IN  
Sbjct  61   GLFLTTLSLGFFLSSALVSLV-------RGATTWLGDTINHSRLDYFYWLLAVLGAINLA  113

Query  258  VYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
             YL+C++W  P  +  A   E   +G   +EKC
Sbjct  114  AYLLCAMWATPAASSKA---EQPHHGTAADEKC  143



>gb|EMS53820.1| Nitrate transporter 1.4 [Triticum urartu]
Length=542

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM  +A  EKKRL  A S   + +TL +SVF LIPQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  392  IGMVAAAICEKKRLTVA-STATNGTTLPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRS  450

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PKSMKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D IN+ RL+ FYWLL
Sbjct  451  PKSMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGDTINHSRLNYFYWLL  503

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LG +N   YL+C++W  P  +  A +         +EKC
Sbjct  504  AVLGTLNLAAYLLCAMWATPAASSKAEQPHPAT--AADEKC  542



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM  +A  EKKRL  A S   + + L +SVF LIPQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  480  IGMVAAAICEKKRLTVA-STATNGTALPISVFMLIPQFLLVGAGEAFIYTGQLDFFITRS  538

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PKSMKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D IN+ RLD FYWLL
Sbjct  539  PKSMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGDTINHSRLDYFYWLL  591

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LG IN   YL+C++W  P  +  A +         +EKC
Sbjct  592  AVLGAINLAAYLLCAMWATPAASSKAEQPHHA--AAADEKC  630



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 96/155 (62%), Gaps = 5/155 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG----RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFF  478
            +GM  +A  E KRL+ A   G    R  +TL +SVF LIPQFFLVG+ E F+YTGQLDFF
Sbjct  423  IGMVAAALAEVKRLSVAREVGPAAARRGTTLPVSVFTLIPQFFLVGAAEGFVYTGQLDFF  482

Query  477  LTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLF  298
            +T+SPK MKTM +     T     F  S  +  + K  +A   G  WLADNINYGRLD F
Sbjct  483  ITRSPKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKSLTAGREGNGWLADNINYGRLDCF  541

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  193
            Y LLA L  +N   +L+C+   KP+  K+ V+ME+
Sbjct  542  YGLLAVLSAVNLGAFLLCAARTKPQTPKAGVQMES  576



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 114/162 (70%), Gaps = 10/162 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG-RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            VGMA +A  EKKRLA A + G   + +L +SVF L PQF LVG+GEAF+YTGQLDFF+T+
Sbjct  439  VGMAAAAISEKKRLAVAATSGVAGHGSLPISVFMLTPQFLLVGAGEAFIYTGQLDFFITR  498

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SPKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D IN+ RLD FYWL
Sbjct  499  SPKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWL  551

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LA L V+N V YL+C++W     +  A + +  M  +  EKC
Sbjct  552  LAVLSVVNLVAYLVCAMWATAPTSSQAEQPQPAMVAD--EKC  591



>ref|XP_007011887.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29506.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=553

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = -3

Query  612  KRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl  433
            KRL+ A  +    +TL ++VF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +  
Sbjct  405  KRLSVAK-QSSETTTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STG  462

Query  432  flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVY  253
               T     F  S L+  + K  + S G Q W+ +NIN GRLD FY LLA L  INF ++
Sbjct  463  LFLTTLALGFFLSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALF  522

Query  252  LICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            L+C+ W++ +  K   E+E +   +  EEKC
Sbjct  523  LVCAAWYRKKTVKRDPELEIIAKESTIEEKC  553



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 113/161 (70%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  E KRL+ A       +TL +SVF LIPQF  VG+GEAF+YTGQLDFF+T+S
Sbjct  422  MGMAAAALTEVKRLSVAREAASGTTTLPISVFTLIPQFLFVGAGEAFIYTGQLDFFITRS  481

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SSFLVS VK VT     GQ WLADNINYGRLD FY LL
Sbjct  482  PKGMKTMSTGLFLTTLSLGFFLSSFLVSFVKGVTGGKG-GQGWLADNINYGRLDCFYGLL  540

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            AGL  +N   +L+C+ W KPR            +  GE+KC
Sbjct  541  AGLSTMNLGAFLVCAGWSKPRVESPE------KDSCGEDKC  575



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 108/161 (67%), Gaps = 13/161 (8%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNST-LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            GM  +A  EKKRL  A++    N T L ++VF LIPQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  426  GMVAAAVTEKKRLTVASTATTMNGTALPITVFMLIPQFLLVGAGEAFIYTGQLDFFITRS  485

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D IN+ RLD FYWLL
Sbjct  486  PKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGDTINHSRLDYFYWLL  538

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LG +N   YL+C++W  P     A +       + +EKC
Sbjct  539  AVLGALNLAAYLLCAMWATPAAGSKAEQQP-----HPDEKC  574



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = -3

Query  612  KRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstgl  433
            KRL+ A  +    +TL ++VF LIPQFFLVGSGEAF+YTGQLDFF+TQSPK MKTM +  
Sbjct  520  KRLSVAK-QSSETTTLPITVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTM-STG  577

Query  432  flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVY  253
               T     F  S L+  + K  + S G Q W+ +NIN GRLD FY LLA L  INF ++
Sbjct  578  LFLTTLALGFFLSSLLVSIVKTVTGSSGKQGWVGENINEGRLDCFYGLLAALSFINFALF  637

Query  252  LICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            L+C+ W++ +  K   E+E +   +  EEKC
Sbjct  638  LVCAAWYRKKTVKRDPELEIIAKESTIEEKC  668



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM  +A +E KRL A++S      +  +SVF LIPQFFL+GSGEAF+YTGQLDFF+TQS
Sbjct  379  IGMVAAALVETKRLKASSS------SRNLSVFLLIPQFFLLGSGEAFIYTGQLDFFITQS  432

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMST LFLTTL+LGFF+SSFLV+VVK++T++S  G  WLA NI+ GRLD FY LL
Sbjct  433  PKGMKTMSTALFLTTLALGFFLSSFLVTVVKQITASSSRG-GWLAGNIDRGRLDCFYGLL  491

Query  285  AGLGVINFVVYLICSIWFKPRKNK--SAVEME  196
            A LG +NF VYL+C+  +K +K K    VE+E
Sbjct  492  AALGGLNFAVYLVCAAKYKYQKPKHEQVVELE  523



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 7/167 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGR----HNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFF  478
            +GMA +A  E KRL+ A   G       +TL +SVF LIPQFFLVG+GEAF+YTGQLDFF
Sbjct  418  IGMAAAAVAEAKRLSVARRAGEGAALRGATLPISVFTLIPQFFLVGAGEAFLYTGQLDFF  477

Query  477  LTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLF  298
            +T+SPK MKTMSTGLFLTTLS GFF+SSF+VSVV+ VT   + GQ WLADNINYGRLD F
Sbjct  478  ITRSPKGMKTMSTGLFLTTLSFGFFLSSFMVSVVRDVTGGKN-GQGWLADNINYGRLDYF  536

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEM--ETVMNGNGEEKC  163
            Y LLA L  +N   +L+C++W K       ++M    + + + E+ C
Sbjct  537  YGLLAALSTLNMGAFLVCAMWIKQENPNQGLQMGSAALKSSSMEDTC  583



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  618  EKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMst  439
            E KRL+ A  +    +TL ++VFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMST
Sbjct  429  EVKRLSVAK-KYNETTTLPITVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMST  487

Query  438  glflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFV  259
            GLFLTTLSLGFF SS LVS+VK  T +S   Q WL ++IN GRLD FY LLA L  +NF 
Sbjct  488  GLFLTTLSLGFFFSSLLVSIVKATTGSSD-KQGWLGEHINKGRLDCFYGLLAALSFLNFG  546

Query  258  VYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            ++L+ ++WF+ +  K A +ME V+  +  EEKC
Sbjct  547  LFLLSAVWFRKKTVKQAPKMEIVVKESTIEEKC  579



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 118/166 (71%), Gaps = 11/166 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN-----STLTMSVFYLIPQFFLVGSGEAFMYTGQLDF  481
            +GM  +A  E KRL+ A   G        +TL +SVF LIPQFFLVG+GEAF+YTGQLDF
Sbjct  423  LGMVAAAVAEAKRLSVARGAGAAAAHRGGTTLPISVFTLIPQFFLVGAGEAFIYTGQLDF  482

Query  480  FLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDL  301
            F+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVS+VK +T   H G  WLAD+IN+GRLD 
Sbjct  483  FITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSIVKTLTGGKH-GNGWLADDINHGRLDC  541

Query  300  FYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            FYWLLA L  IN   +++ + W KP+  KS  +  +V     +++C
Sbjct  542  FYWLLAVLSAINLGAFIVSAAWTKPQAAKSVAKSYSV-----DDQC  582



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSE-----GRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDF  481
            +GM  +A  E KRL+ A         R  +TL +SVF LIPQFFLVG+GE F+YTGQLDF
Sbjct  422  IGMVAAALAEVKRLSVARRVGAAAASRGGTTLPVSVFTLIPQFFLVGAGEGFVYTGQLDF  481

Query  480  FLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDL  301
            F+T+SPK MKTMSTGLFLTTLSLGFFVSS LVS+V  +T   H G  WLADNIN GRLD 
Sbjct  482  FITRSPKGMKTMSTGLFLTTLSLGFFVSSLLVSIVNSLTGGKH-GNGWLADNINNGRLDC  540

Query  300  FYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  193
            FY LLA LG +N   +L+C+   KP+  ++ ++ME+
Sbjct  541  FYGLLAVLGAVNLGAFLLCAARTKPQTPQAGLQMES  576



>ref|XP_010093702.1| Nitrate transporter 1.1 [Morus notabilis]
 gb|EXB54482.1| Nitrate transporter 1.1 [Morus notabilis]
Length=222

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 9/157 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNST---LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A S G  +S    + MSVF+L+PQFFLVGSGEAF+Y GQLDFFL 
Sbjct  64   AMIAAALTEIKRLHVARSHGLTDSATAEIPMSVFWLVPQFFLVGSGEAFIYIGQLDFFLR  123

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FYW
Sbjct  124  ECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHK---VTWNTKPWLPDNLNQGRLYDFYW  180

Query  291  LLAGLGVINFVVYLICSIWF---KPRKNKSAVEMETV  190
            LLA L  +NFV+YL+C+ W+     R   + +E+E V
Sbjct  181  LLAALSALNFVIYLVCAKWYVYKDKRLADAGIELEEV  217



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 10/161 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLA-AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            GMA +A  EKKRLA AA S    + +L +SVF L PQF LVGSGEAF+YTGQLDFF+ +S
Sbjct  436  GMAAAAICEKKRLAVAATSVAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRS  495

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D IN+ RLD FYWLL
Sbjct  496  PKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWLL  548

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LGV+N V Y++ ++W     +  A + +  M  +  EKC
Sbjct  549  AVLGVVNLVAYIVYAMWAAAPASSQAEQPQHAMAAD--EKC  587



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 10/161 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLA-AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            GMA +A  EKKRLA AA S    + +L +SVF L PQF LVGSGEAF+YTGQLDFF+ +S
Sbjct  440  GMAAAAICEKKRLAVAATSVAVGHGSLPISVFMLTPQFLLVGSGEAFIYTGQLDFFIMRS  499

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D IN+ RLD FYWLL
Sbjct  500  PKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGDTINHSRLDYFYWLL  552

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LGV+N V Y++ ++W     +  A + +  M  +  EKC
Sbjct  553  AVLGVVNLVAYIVYAMWAAAPASSQAEQPQHAMAAD--EKC  591



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  EKKRLA A +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  413  LGMAAAALCEKKRLAVAVAATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRS  471

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D I+  RLD FYWLL
Sbjct  472  PKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLL  524

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            A L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  525  AVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  EKKRLA A +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  413  LGMAAAALCEKKRLAVAVAATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRS  471

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D I+  RLD FYWLL
Sbjct  472  PKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLL  524

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            A L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  525  AVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  EKKRLA A +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  413  LGMAAAALCEKKRLAVAVAATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRS  471

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D I+  RLD FYWLL
Sbjct  472  PKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLL  524

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            A L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  525  AVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>gb|KJB82816.1| hypothetical protein B456_013G215400 [Gossypium raimondii]
Length=579

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  618  EKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMst  439
            E KRL+ A  +    +TL ++VFYLIPQFFLVG+GE F+YTGQLDFF+TQSPK MKTMST
Sbjct  429  EVKRLSVAK-KYNETTTLPITVFYLIPQFFLVGAGEGFIYTGQLDFFITQSPKGMKTMST  487

Query  438  glflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFV  259
            GLFLTTLSLGFF SS LVS+VK  T +S   Q WL ++IN GRLD FY LLA L   NF 
Sbjct  488  GLFLTTLSLGFFFSSLLVSIVKATTGSSD-KQGWLGEHINKGRLDCFYGLLAALSFFNFG  546

Query  258  VYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  163
            ++L+ + WF+ +  K A E E ++  +  EEKC
Sbjct  547  LFLLSAAWFRKKTVKQAPETEIIVKESTIEEKC  579



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMA +A  EKKRLA A +    NST  +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  434  LGMAAAALCEKKRLAVAVAATTGNST-PISVFLLTPQFLLVGAGEAFIYTGQLDFFITRS  492

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D I+  RLD FYWLL
Sbjct  493  PKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGDTIDRSRLDYFYWLL  545

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  163
            A L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  546  AVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  587



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 6/160 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A +E +RL  A   G  N+    + +SVF+LIPQFF VG+GEAF Y GQLDFFL
Sbjct  439  ISMVSAALVEIRRLKVAKDAGLVNNPYEVVPISVFWLIPQFFFVGAGEAFTYIGQLDFFL  498

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFLTTLSLGFFVSS LV+VV  +T   H    W+ADN+N GRLD FY
Sbjct  499  RECPKGMKTMSTGLFLTTLSLGFFVSSALVTVVHNITGDKH---PWIADNLNQGRLDYFY  555

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
            WLLAGL V+NF+VYL+ + W+  ++ + A E   V   +G
Sbjct  556  WLLAGLSVVNFLVYLVFAKWYIYKETRLAEEGYEVEEDDG  595



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            V M  +A  EKKRL AA   G  N   + + +SVF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  424  VAMIAAALTEKKRLRAARLHGLANDPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFL  483

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FY
Sbjct  484  RECPKGMKTMSTGLFLSTLSLGFFVSSSLVTIVHKVTI----NKPWLADNLNQGRLHDFY  539

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  +NFV+YLIC+ W+  +  + A E
Sbjct  540  WLLAILSALNFVIYLICARWYVYKDKRLADE  570



>ref|XP_006645998.1| PREDICTED: nitrate transporter 1.4-like [Oryza brachyantha]
Length=593

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 100/137 (73%), Gaps = 11/137 (8%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A  EKKRL+AA +     + + +SVF L PQF LVG+GEAF+YTGQLDFF+T+S
Sbjct  434  VGMAAAALCEKKRLSAAAAA----TPVPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRS  489

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WLAD I+  RLD FYWLL
Sbjct  490  PKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------KGATAWLADTIDRSRLDYFYWLL  542

Query  285  AGLGVINFVVYLICSIW  235
            A L  +N   YL+C++W
Sbjct  543  AVLSALNLAAYLVCAMW  559



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAV+A IE KR + A +     S L +SVF LIPQF LVG+GEAF YTGQLDFF+T+SP+
Sbjct  419  MAVAAIIELKRRSVARATSEM-SVLPISVFLLIPQFLLVGAGEAFTYTGQLDFFITESPR  477

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK +STGLFL T+SLGFF+SSFLV +V+KVT  S GG  W+ DNIN GRLD FY LL+ 
Sbjct  478  GMKGLSTGLFLVTISLGFFISSFLVLIVQKVTL-SFGGDGWIGDNINKGRLDCFYGLLSI  536

Query  279  LGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            L  INF +YL+ + W+K +         T   G+ EE+C
Sbjct  537  LSFINFGLYLVSARWYKRQMPAKPTLQVTCGKGSPEEEC  575



>ref|XP_011033951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like, partial [Populus 
euphratica]
Length=505

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            VGM  +A  EKKR +AA   G      + + ++VF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  346  VGMIAAALTEKKRRSAAILHGLATDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFFL  405

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FY
Sbjct  406  RECPKGMKTMSTGLFLSTLSLGFFVSSSLVAIVHKVTL----NKPWLADNLNQGRLHDFY  461

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WL+A L  +NFV+YLIC+ W+  +  + A E
Sbjct  462  WLVAILSALNFVIYLICARWYVSKDERLAAE  492



>ref|XP_007155636.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
 gb|ESW27630.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
Length=450

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL 
Sbjct  291  AMVAAALTEIKRLRVARAHGLTHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLR  350

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLADN+N G+L  FYW
Sbjct  351  ECPKGMKTMSTGLFLSTLSLGFFLSSMLVTLVHK---ATRHSEPWLADNLNEGKLHHFYW  407

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L  +N VVYL C+   ++   R  ++ +E+E
Sbjct  408  LLAVLSGVNLVVYLFCAKGYVYKDKRLAEAGIELE  442



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAV+A IE KR + A +     S L +SVF LIPQF LVG+GEAF YTGQLDFF+T+SP+
Sbjct  443  MAVAAIIELKRRSVARATSEM-SVLPISVFLLIPQFLLVGAGEAFTYTGQLDFFITESPR  501

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK +STGLFL T+SLGFF+SSFLV +V+KVT  S GG  W+ DNIN GRLD FY LL+ 
Sbjct  502  GMKGLSTGLFLVTISLGFFISSFLVLIVQKVTL-SFGGDGWIGDNINKGRLDCFYGLLSI  560

Query  279  LGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            L  INF +YL+ + W+K +         T   G+ EE+C
Sbjct  561  LSFINFGLYLVSARWYKRQMPAKPTLQVTCGKGSPEEEC  599



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 110/156 (71%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KRL  A + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  434  LAMVSAALIEIKRLRMARANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFL  493

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLADN+N+G+L  FY
Sbjct  494  RECPKGMKTMSTGLFLSTLSLGFFLSSLLVTLVHK---ATRHREPWLADNLNHGKLHYFY  550

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L  +N V YL C+   ++   R  ++ +E+E
Sbjct  551  WLLALLSGVNLVAYLFCAKGYVYKDKRLAEAGIELE  586



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL 
Sbjct  461  AMVAAALTEIKRLRVARAHGLTHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFLR  520

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLADN+N G+L  FYW
Sbjct  521  ECPKGMKTMSTGLFLSTLSLGFFLSSMLVTLVHK---ATRHSEPWLADNLNEGKLHHFYW  577

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L  +N VVYL C+   ++   R  ++ +E+E
Sbjct  578  LLAVLSGVNLVVYLFCAKGYVYKDKRLAEAGIELE  612



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A +E+KRL  A S G  N   + + +SVF+LIPQFF+VGSGE+FMY GQLDFFL
Sbjct  432  LSMVAAALVEEKRLIFAQSHGLVNDPTAKIPLSVFWLIPQFFIVGSGESFMYMGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + P  MKTMS GLFL++ SLGFF SS LVS V K+T  S   + W+ADN+N GRL+ +Y
Sbjct  492  RECPDGMKTMSMGLFLSSRSLGFFFSSLLVSTVNKITGPS---KPWIADNLNQGRLNYYY  548

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  IN ++YL C+ W+  +  K A E
Sbjct  549  WLLAMLSAINLMIYLACAKWYVYKDKKVAEE  579



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 97/166 (58%), Gaps = 6/166 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGR----HNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFF  478
            + MA +A  E KRL+ A   G+      + L +SVF L+PQFFLVGSGEA +YTGQLDFF
Sbjct  419  MAMASAALTEVKRLSVAREAGKAAAPRGAALPISVFTLVPQFFLVGSGEALIYTGQLDFF  478

Query  477  LTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLF  298
            +T+SPK MKTM +     T     F  S  +  + K  +    GQ WLADNIN+GRLD F
Sbjct  479  ITRSPKGMKTM-STGLFLTTLSLGFFLSSFIVSIVKSVTGGESGQGWLADNINHGRLDYF  537

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVM-NGNGEEKC  163
            Y LLA L  +N   +L C+ W KP      +EM +   N   E+KC
Sbjct  538  YGLLAALSALNLAAFLYCATWIKPENAGDGLEMASAAKNSPAEDKC  583



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M V A IE KRL  A S G   +  + + M+VF+LIPQ F+VG+GEAFMY GQL+FFL
Sbjct  413  ISMVVGALIEIKRLRYAQSHGLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFL  472

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FY
Sbjct  473  RECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFY  529

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  530  WLLAILSAINVVLYLVCAKWYVYKEKRLADE  560



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M V A IE KRL  A S G   +  + + M+VF+LIPQ F+VG+GEAFMY GQL+FFL
Sbjct  424  ISMVVGALIEIKRLRYAQSHGLVDKPEAKIPMTVFWLIPQNFIVGAGEAFMYMGQLNFFL  483

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FY
Sbjct  484  RECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFY  540

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  541  WLLAILSAINVVLYLVCAKWYVYKEKRLADE  571



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = -3

Query  618  EKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKT  448
            E KRL  A S+       +T+ +SVF+LIPQFFLVG+GEAF Y GQLDFFL + PK MKT
Sbjct  451  EIKRLRVARSDPAALEMGATVPLSVFWLIPQFFLVGAGEAFTYVGQLDFFLRECPKGMKT  510

Query  447  MstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLFYWLLAGLGV  271
            MSTGLFL+TLSLGFFVS+ LV+ V  +T  S HG   WLADN+N+G+L+ FYWLLA L +
Sbjct  511  MSTGLFLSTLSLGFFVSTALVAAVDSITGQSGHGA--WLADNLNHGKLNNFYWLLAALCL  568

Query  270  INFVVYLICSIWFKPRKNKSAVEMETV  190
            +N +VYL+ + W+  +  + AV+ ++V
Sbjct  569  VNLMVYLVAAKWYVYKDQRPAVDDDSV  595



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 6/155 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M+ +A  E KRL  A S      + +T+ MSVF+LIPQFFLVG+GEAF Y GQLDFFL
Sbjct  434  LAMSAAALTEIKRLGVARSTPAALENGATVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFL  493

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGLFL+TLSLGFFVSS LV+VV KVT  S HG   WLADN+N G+L  F
Sbjct  494  RECPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKVTGESGHGA--WLADNLNRGKLYNF  551

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  193
            YWLLA L ++N V YL+ + W+  ++ ++AV+ ++
Sbjct  552  YWLLAVLCLVNLVAYLVVARWYAYKEQRAAVDDDS  586



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KRL  A S G  N   + + +SVF+L+PQFF VGSGEAFMY GQLDFFL
Sbjct  432  LSMVAAALIEIKRLKFAKSHGFVNDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V      +   + W+A+N+N GRL  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVNN---VTGPNKPWIANNLNQGRLYDFY  548

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEMETV  190
            WLLA L  IN V+YL C+ W+  ++N+ A   +E+E +
Sbjct  549  WLLAMLSAINVVIYLACAKWYVYKENRLAEEGIELEEI  586



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + MA +A +E KRL  A S     +  +T+ +SVF+L+PQFFLVGSGEAF Y GQLDFFL
Sbjct  437  LAMAAAALVEIKRLNVARSNPVTMQKGATVPLSVFWLVPQFFLVGSGEAFTYIGQLDFFL  496

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  F
Sbjct  497  RECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGESGHGA--WLADNLNRGKLYNF  554

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  190
            YWLLA L ++N  VYL+ + W+  +  ++A E E++
Sbjct  555  YWLLAVLCLVNLGVYLVAARWYVYKDGRAAAEDESM  590



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 10/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KRL  A + G   +HN+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  434  LAMVSAALIEIKRLRMARANGLAHKHNAVVPISVFWLVPQFFFVGSGEAFTYIGQLDFFL  493

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF+SS LV++V K T      + WLADN+N+G+L  FY
Sbjct  494  RECPKGMKTMSTGLFLSTLSLGFFLSSLLVTLVHKATRR----EPWLADNLNHGKLHYFY  549

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L  +N V YL C+   ++   R  ++ +E+E
Sbjct  550  WLLALLSGVNLVAYLFCAKGYVYKDKRLAEAGIELE  585



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%), Gaps = 9/158 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KRL  A S G      + + +SVF+L+PQFF VGSGEAFMY GQLDFFL
Sbjct  430  ISMVAAALIEMKRLKFARSHGFVDDPTAKMPLSVFWLVPQFFFVGSGEAFMYMGQLDFFL  489

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLS+GFF SS LV++V      +   + W+ADN++ GRL  FY
Sbjct  490  RECPKGMKTMSTGLFLSTLSIGFFFSSLLVTLVNN---VTGPNKPWIADNLDQGRLYDFY  546

Query  294  WLLAGLGVINFVVYLICSIWF---KPRKNKSAVEMETV  190
            WLLA L  IN V+YL C+ W+     R  ++ +E+E +
Sbjct  547  WLLAMLSAINVVIYLACAKWYVYKDKRLAEAGIELEEI  584



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 104/147 (71%), Gaps = 6/147 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
             M  +A  E KRL  A S    N T  L +SVF+LIPQFFLVGSGEAF Y GQLDFFL +
Sbjct  436  AMVAAALAELKRLRVATSHHMVNETTELPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLRE  495

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFF SSFLV++V K+T    G + WLADN+N G+L  FYWL
Sbjct  496  CPKGMKTMSTGLFLSTLSLGFFFSSFLVTIVHKIT----GNKPWLADNLNQGKLYDFYWL  551

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSA  208
            LA L  +NF +YL+C+ W+  +  + A
Sbjct  552  LAILSALNFGIYLVCAKWYVYKDKRLA  578



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL AA S G  +   + + +SVF LIPQFFLVG GEAF Y GQLDFFL
Sbjct  433  LAMVAAALTELKRLRAARSNGLTDNPTAEIPLSVFCLIPQFFLVGCGEAFTYIGQLDFFL  492

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKT+STGLFL+T+SLG F SSFLVS+V K+   +  G+ WL+DN+N G+L  FY
Sbjct  493  RECPKGMKTISTGLFLSTISLGLFFSSFLVSLVHKL---TGNGRPWLSDNLNQGKLYNFY  549

Query  294  WLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            WLLAGL ++NF +YL+C+ W+     R  +  +E+E
Sbjct  550  WLLAGLSLLNFGLYLVCARWYVYKDTRLAQEGIELE  585



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            VGM  +A  EKKR   A   G      + + ++VF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  424  VGMIAAALTEKKRRRVARLHGLATDPTAEIPLTVFWLVPQFFFVGSGEAFTYIGQLDFFL  483

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FY
Sbjct  484  RECPKGMKTMSTGLFLSTLSLGFFVSSSLVTIVHKVTR----NKPWLADNLNQGRLHDFY  539

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WL+A L  +NFV+YLIC+ W+  +    A E
Sbjct  540  WLVAILSALNFVIYLICARWYVYKDKMLAAE  570



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + MA +A  E KRL  A S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL
Sbjct  438  LAMAAAALTEIKRLKVAQSSPLAVEKGATVPLSVFFLVPQFFLVGAGEAFTYVGQLDFFL  497

Query  474  TQSPKSMKTMstgl-flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGL   T     F  S  +  V K      HG   WL D++N G+L  F
Sbjct  498  RECPKGMKTMSTGLFLSTLSLGFFVSSVLVTIVHKVTGEGGHGA--WLTDDLNRGKLYNF  555

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNK-SAVEMETVMN  184
            YWLLA L ++NF VYL+ + W+ P++ + +A E+E+++ 
Sbjct  556  YWLLAVLSLVNFGVYLVSAWWYVPKEGQAAAAEVESMVG  594



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 108/154 (70%), Gaps = 9/154 (6%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            M   A IE KRL  A S G   +  + + M+VF+LIPQ F VG+GEAFMY GQLDFFL +
Sbjct  426  MVAGALIEIKRLRYAQSHGLVDKPEAKIPMTVFWLIPQNFFVGAGEAFMYMGQLDFFLRE  485

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFF S+ LVSVV K+   +HG + WLADN+N GRL  FYWL
Sbjct  486  CPKGMKTMSTGLFLSTLSLGFFFSTLLVSVVNKM--TAHG-RPWLADNLNKGRLYDFYWL  542

Query  288  LAGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            LA L  IN ++YL+C+ W+   + R  +  +E+E
Sbjct  543  LAILSAINVMLYLVCAKWYVYKEKRLAEEGIELE  576



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 106/148 (72%), Gaps = 6/148 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            + M  +A  E KRL  A S    N T  + +SVF+LIPQFFLVGSGEAF Y GQLDFFL 
Sbjct  435  LAMVAAALTELKRLRVATSHHLINGTTEVPLSVFWLIPQFFLVGSGEAFTYIGQLDFFLR  494

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFF+SSFLV++V K+T    G + WLADN+N G+L  FYW
Sbjct  495  ECPKGMKTMSTGLFLSTLSLGFFLSSFLVTIVHKIT----GNKPWLADNLNQGKLYNFYW  550

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LLA L  +NF +YL+C+ W+  +  + A
Sbjct  551  LLAILSTLNFGIYLVCAKWYVYKDKRLA  578



>gb|ACR34962.1| unknown [Zea mays]
Length=568

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA--NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            V MA +A  E +RL  A  +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL 
Sbjct  407  VAMAGAALTEVRRLRVARDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLR  466

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYW
Sbjct  467  ECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYW  523

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LLA + + N +VYL+ + W+K +  +   +
Sbjct  524  LLAAVCLANLLVYLVAARWYKYKAGRPGAD  553



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA--NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            V MA +A  E +RL  A  +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL 
Sbjct  447  VAMAGAALTEVRRLRVARDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLR  506

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYW
Sbjct  507  ECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYW  563

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LLA + + N +VYL+ + W+K +  +   +
Sbjct  564  LLAAVCLANLLVYLVAARWYKYKAGRPGAD  593



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA--NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
            V MA +A  E +RL  A  +SE      + MSVF+LIPQFFLVG+GEAF Y GQLDFFL 
Sbjct  447  VAMAGAALTEVRRLRVARDSSESASGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLR  506

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+++N GRLD FYW
Sbjct  507  ECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIANDLNKGRLDNFYW  563

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LLA + + N +VYL+ + W+K +  +   +
Sbjct  564  LLAAVCLANLLVYLVAARWYKYKAGRPGAD  593



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 110/156 (71%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLT---MSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            VGM  +A +E KRL  A S G  N+ +T   M+VF+LIPQF +VG+GEAF+Y GQLDFFL
Sbjct  425  VGMVAAAAVEIKRLHVAKSHGLANNPVTPVPMTVFWLIPQFAIVGAGEAFIYVGQLDFFL  484

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKT+STGLFL+TLSLGFF SS LV++V K    +   + WLADN+N G+L+ FY
Sbjct  485  RECPKGMKTISTGLFLSTLSLGFFFSSVLVTIVHK---VTGNRKPWLADNLNQGKLNDFY  541

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLL  L  +N + +LIC+ W+  ++ + A   +E+E
Sbjct  542  WLLGILSALNLMFFLICAKWYVYKERRLADVGIELE  577



>ref|XP_006440345.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53585.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=448

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL 
Sbjct  290  AMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLR  349

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYW
Sbjct  350  ECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYW  406

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LLA L  +NFV+YL  + W+  +  + A
Sbjct  407  LLAILSALNFVIYLAFARWYVYKDKRLA  434



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL +A+S G  N   + + MSVF+LIPQF LVG+GEAF Y GQLDFFL
Sbjct  427  IAMIAAALTEIKRLRSASSHGLTNDPSAQIPMSVFWLIPQFLLVGAGEAFTYIGQLDFFL  486

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FY
Sbjct  487  RECPKGMKTMSTGLFLSTLSLGFFVSSVLVTIVHKVTGTKH---PWLPDNLNQGRLYDFY  543

Query  294  WLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            WLLA L  +N V+YL+ + W+     R     +E+E
Sbjct  544  WLLAILSCLNLVIYLVFARWYVYKDKRLADEGIELE  579



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 115/166 (69%), Gaps = 7/166 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KRL  A +        +T+ +SVF+L+PQFFLVGSGEAF Y GQLDFFL
Sbjct  439  LAMVAAALIEIKRLRVARANAASMEKGATVPVSVFWLVPQFFLVGSGEAFTYIGQLDFFL  498

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGLFL+TLSLGFFVSS LVSVV KVT  S HGG  WL DN+N G+L  F
Sbjct  499  RECPKGMKTMSTGLFLSTLSLGFFVSSVLVSVVHKVTGESGHGG--WLTDNLNRGKLYNF  556

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            YWL+A L  +N V+YL+ + W+  ++ ++ V+ +++      EE C
Sbjct  557  YWLVAVLSSVNLVLYLVAAKWYVYKEQRAVVDDDSMAGVELTEEAC  602



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 9/150 (6%)
 Frame = -3

Query  627  AXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKS  457
            A IE KRL  A S G   +  + + M+VF+LIPQ   VG+GEAFMY GQLDFFL + PK 
Sbjct  430  ALIEIKRLRYAQSHGLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLDFFLRECPKG  489

Query  456  MKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGL  277
            MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L
Sbjct  490  MKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAIL  546

Query  276  GVINFVVYLICSIWF---KPRKNKSAVEME  196
              IN V+YL+C+ W+   + R  +  +E+E
Sbjct  547  SAINVVLYLVCAKWYVYKEKRLAEECIELE  576



>ref|XP_010906610.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + MA +A  E KRL  A S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL
Sbjct  373  LAMAAAALTEIKRLHVARSNPNTIHKGATVPLSVFWLVPQFFLVGAGEAFTYIGQLDFFL  432

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  F
Sbjct  433  RECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGKSGHGA--WLADNLNRGKLYNF  490

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  190
            YWLLA L ++N  +YL+ + W+  ++ ++A E +++
Sbjct  491  YWLLAVLCLVNLGLYLVAAKWYVYKEGRTAAEDDSM  526



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM V++ IE KRL+ A       +TL +SVF LIPQFFLVG+G  FMYTGQLD F+TQS
Sbjct  422  LGMGVASIIEVKRLSIAKENEETPNTLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQS  481

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTT++LGFF SS L+S+VKKVT+A+     W+ ++IN GRLD FY LL
Sbjct  482  PKGMKTMSTGLFLTTMALGFFFSSLLISIVKKVTTANI-NNGWVGESINKGRLDCFYGLL  540

Query  285  AGLGVINFVVYLICSIWF  232
            A L  I+F  Y++C+ W+
Sbjct  541  AILIFIDFGFYVLCASWY  558



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM V++ IE KRL+ A       +TL +SVF LIPQFFLVG+G  FMYTGQLD F+TQS
Sbjct  402  LGMGVASIIEVKRLSIAKENEETPNTLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQS  461

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFLTT++LGFF SS L+S+VKKVT+A +    W+ ++IN GRLD FY LL
Sbjct  462  PKGMKTMSTGLFLTTMALGFFFSSLLISIVKKVTTA-NINNGWVGESINKGRLDCFYGLL  520

Query  285  AGLGVINFVVYLICSIWF  232
            A L  I+F  Y++C+ W+
Sbjct  521  AILIFIDFGFYVLCASWY  538



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + MA +A  E +RL  A ++       + MSVF+LIPQFFLVG+GEAF Y GQLDFFL +
Sbjct  426  IAMAGAAATEIRRLRVARDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRE  485

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWL
Sbjct  486  CPKGMKTMSTGLFLSTLSLGFFVSSALVTCVHKVTGDRHA---WIADDLNKGRLDNFYWL  542

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LA + ++N +VYL+ + W+K +  +   +
Sbjct  543  LAVICLVNLLVYLVAARWYKYKAGRPGAD  571



>ref|XP_011463731.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=530

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  +   + + +SVF+L+PQFFLVGSGEAF Y GQLDFFL 
Sbjct  372  AMVAAALTELKRLRAARSHGLTDNPTAEIPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLR  431

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFF SS LV++V K    +   + WLADN+N G+L  FYW
Sbjct  432  ECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVHK---VTGDRKPWLADNLNQGKLYDFYW  488

Query  291  LLAGLGVINFVVYLICSIWF  232
            LLA L  +N ++YL C+ W+
Sbjct  489  LLAILSALNLLIYLACAKWY  508



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + MA +A  E +RL  A ++       + MSVF+LIPQFFLVG+GEAF Y GQLDFFL +
Sbjct  439  IAMAGAAATEIRRLRVARDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRE  498

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWL
Sbjct  499  CPKGMKTMSTGLFLSTLSLGFFVSSALVTCVHKVTGDRHA---WIADDLNKGRLDNFYWL  555

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LA + ++N +VYL+ + W+K +  +   +
Sbjct  556  LAVICLVNLLVYLVAARWYKYKAGRPGAD  584



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + M V+A +E +RL  A S    NSTL +S F L PQF L G+ E  +YTGQLDFFL++S
Sbjct  424  ITMVVAAIVETRRLKVAKSTSSTNSTLPISAFLLAPQFVLAGAAEGLVYTGQLDFFLSES  483

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK +ST LFLTT+SLGFFVSS LV+++++    + G Q+WL  N+N+GRLDLFY L+
Sbjct  484  PKGMKAVSTSLFLTTISLGFFVSSALVAIIRR---VTEGRQNWLPANLNHGRLDLFYGLI  540

Query  285  AGLGVINFVVYLICSIWFKPRKNK  214
            A L  IN   YL+ + WF  +K +
Sbjct  541  ALLSAINLGFYLLSAKWFLCKKTQ  564



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL 
Sbjct  433  AMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLR  492

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYW
Sbjct  493  ECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYW  549

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LLA L  +NFV+YL  + W+  +  + A
Sbjct  550  LLAILSALNFVIYLAFARWYVYKDKRLA  577



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MA +A  E +RL  A      +  + M+VF+LIPQF LVGSGEAF Y GQLDFFL + 
Sbjct  440  LAMAAAALTEVRRLRIARENPTSDGVVPMTVFWLIPQFLLVGSGEAFTYIGQLDFFLREC  499

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFL+TLSLGFFVSS LVS V K+T  +H  + W+AD++N G L  FYWLL
Sbjct  500  PKGMKTMSTGLFLSTLSLGFFVSSALVSAVHKLT--AH-RRPWIADDLNQGELHKFYWLL  556

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            AGL + N VVYL  + W+K +  +   +       N  E C
Sbjct  557  AGLCLANLVVYLFAARWYKYKAGRPGADGSV----NDAEPC  593



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL 
Sbjct  433  AMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLR  492

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLADN+N GRL  FYW
Sbjct  493  ECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLADNLNQGRLYDFYW  549

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LLA L  +NFV+YL  + W+  +  + A
Sbjct  550  LLAILSALNFVIYLAFARWYVYKDKRLA  577



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + MA +A  E KRL  A S        +T+ +SVF+L+PQFFLVG+GEAF Y GQLDFFL
Sbjct  437  LAMAAAALTEIKRLHVARSNPNTIHKGATVPLSVFWLVPQFFLVGAGEAFTYIGQLDFFL  496

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLADNINYGRLDLF  298
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLADN+N G+L  F
Sbjct  497  RECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGKSGHGA--WLADNLNRGKLYNF  554

Query  297  YWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  190
            YWLLA L ++N  +YL+ + W+  ++ ++A E +++
Sbjct  555  YWLLAVLCLVNLGLYLVAAKWYVYKEGRTAAEDDSM  590



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  N   + + +SVF+L+PQFFLVG+GEAF Y GQLDFFL 
Sbjct  433  AMVAAALCEIKRLRAARSHGLTNDPTAEIPLSVFWLVPQFFLVGAGEAFTYIGQLDFFLR  492

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFFVSS LVS+V KVT      + WLADN+N GRL  FYW
Sbjct  493  ECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHKVTGVK---KPWLADNLNQGRLYDFYW  549

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LLA L  +NFV+YL  + W+  +  + A
Sbjct  550  LLAILSALNFVIYLAFARWYVYKDKRLA  577



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 104/149 (70%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRL-AAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + MA +A  E KRL  A ++       + MSVF+LIPQFFLVG+GEAF Y GQLDFFL +
Sbjct  441  IAMAGAALTEIKRLHVARDAAVPAGGVVPMSVFWLIPQFFLVGAGEAFTYIGQLDFFLRE  500

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD++N GRLD FYWL
Sbjct  501  CPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKVTGDRH---PWIADDLNKGRLDNFYWL  557

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LA + + N +VYL+ + W+K +  +   +
Sbjct  558  LAVICLANLLVYLVAARWYKYKAGRPGAD  586



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL AA   G     N+ + +SVF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  433  LAMVAAALTEIKRLRAARHYGLTNDPNAVIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFL  492

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV+VV K    +   + WLA+N+N G+L  FY
Sbjct  493  RECPKGMKTMSTGLFLSTLSLGFFFSSLLVTVVHK---VTGNKKPWLANNLNQGKLHDFY  549

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  +NF+++L+C+ W+  +  + A E
Sbjct  550  WLLAILSALNFLIFLVCAKWYVYKDKRLADE  580



>emb|CDY21035.1| BnaA08g24900D [Brassica napus]
Length=575

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMAV+A +E KRL  A+S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  416  VGMAVAALVEIKRLRTAHSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  476  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTDKAH---PWIADDLNKGRLYNFYWLV  532

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+++L+ S W+  +  + A   +E+E
Sbjct  533  AVVVFLNFLIFLVFSKWYVYKDKRLAELGIELE  565



>ref|XP_009110669.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brassica rapa]
 gb|AFK74856.1| low-affinity nitrate transporter [Brassica rapa subsp. oleifera]
Length=590

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMAV+A +E KRL  A+S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  VGMAVAALVEIKRLRTAHSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTDKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+++L+ S W+  +  + A   +E+E
Sbjct  548  AVVVFLNFLIFLVFSKWYVYKDKRLAELGIELE  580



>ref|XP_004298652.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=591

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL AA S G  +   + + +SVF+L+PQFFLVGSGEAF Y GQLDFFL 
Sbjct  433  AMVAAALTELKRLRAARSHGLTDNPTAEIPLSVFWLVPQFFLVGSGEAFTYIGQLDFFLR  492

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLFL+TLSLGFF SS LV++V K    +   + WLADN+N G+L  FYW
Sbjct  493  ECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVHK---VTGDRKPWLADNLNQGKLYDFYW  549

Query  291  LLAGLGVINFVVYLICSIWF  232
            LLA L  +N ++YL C+ W+
Sbjct  550  LLAILSALNLLIYLACAKWY  569



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 9/150 (6%)
 Frame = -3

Query  627  AXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKS  457
            A IE KRL  A S G   +  + + M+VF+LIPQ   VG+GEAFMY GQL+FFL + PK 
Sbjct  430  ALIEIKRLRYAQSHGLVDKPEAKIPMTVFWLIPQNLFVGAGEAFMYMGQLNFFLRECPKG  489

Query  456  MKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGL  277
            MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLADN+N GRL  FYWLLA L
Sbjct  490  MKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLADNLNQGRLYDFYWLLAIL  546

Query  276  GVINFVVYLICSIWF---KPRKNKSAVEME  196
              IN V+YL+C+ W+   + R  +  +E+E
Sbjct  547  SAINVVLYLVCAKWYVYKEKRLAEECIELE  576



>gb|KJB46719.1| hypothetical protein B456_008G2375002, partial [Gossypium raimondii]
Length=548

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 108/156 (69%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL +A+S G  N   + + MSVF+LIPQF LVG+GEAF Y GQLDFFL
Sbjct  389  ITMIAAALTEIKRLRSASSHGLTNDPSAQIPMSVFWLIPQFLLVGAGEAFTYIGQLDFFL  448

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FY
Sbjct  449  RECPKGMKTMSTGLFLSTLSLGFFVSSVLVTIVHKVTGTKH---LWLPDNLNQGRLYDFY  505

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N V++L+ + W+  +  + A   +E+E
Sbjct  506  WLLAILSCLNLVIFLVFAKWYVYKDKRLADEGIELE  541



>dbj|BAJ98569.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 109/147 (74%), Gaps = 9/147 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V MAV+A +EK R  AAN E R    + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  427  VAMAVAALVEKMRRDAANGEPR----VAISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  482

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL TLS+GFF+SSFLV +V  VTS +     W+ +N++ GRLDLFYW+L
Sbjct  483  PERMKSMSTGLFLVTLSMGFFLSSFLVFLVHTVTSGA-----WIRNNLDMGRLDLFYWML  537

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAV  205
            A LGV+NF+V+++ +   + + N S V
Sbjct  538  AVLGVVNFIVFVMIARRHEYKPNTSVV  564



>emb|CDY31242.1| BnaC08g15370D [Brassica napus]
Length=575

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A+S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  416  MGMAVAALVEIKRLRTAHSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  476  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTDKAH---PWIADDLNKGRLYNFYWLV  532

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+++L+ S W+  +  + A   +E+E
Sbjct  533  AVVVFLNFLIFLVFSKWYVYKDKRLAELGIELE  565



>ref|XP_006358355.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  SA  E KRL  A+  G     N+T+ +SVF+LIPQF L+G+GEAF Y GQLDFFL
Sbjct  431  IAMVASALTEVKRLNTAHLNGLTNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFL  490

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFF SS LV++V  VT  +H    W+ADN+N G+L  FY
Sbjct  491  RECPKGMKTMSTGLFLSTLALGFFFSSILVTIVHMVTGTTH---PWIADNLNQGKLHDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V+N +V+L  S   ++ + R  +  +E+E
Sbjct  548  WLLAILSVLNLMVFLYTSKTYVYKEKRLAEMGIELE  583



>gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 105/156 (67%), Gaps = 10/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL AA S G  N   + + +SVF+LIPQF LVG+GEA  Y GQLDFFL
Sbjct  424  IAMVAAALTELKRLRAARSNGLSNDATAQIPLSVFWLIPQFLLVGAGEAVTYIGQLDFFL  483

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLADN+N GRL  FY
Sbjct  484  RECPKGMKTMSTGLFLSTLSLGFFVSSILVTIVHKVTR----NKPWLADNLNQGRLYDFY  539

Query  294  WLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            WLLA L  +NFV++   S W+     R  +  +EME
Sbjct  540  WLLAILSALNFVIFFASSKWYVYKDKRLGEVGIEME  575



>ref|XP_011070105.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 97/138 (70%), Gaps = 6/138 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG-RHNSTLT--MSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            V M  +A  E KRL  A S G  HN T T  MSVF+L+PQF LVGSGEAF Y GQLDFFL
Sbjct  434  VAMVAAALTEIKRLNVARSHGLTHNETATVPMSVFWLVPQFLLVGSGEAFTYIGQLDFFL  493

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT   H    WLADN+N G+L  FY
Sbjct  494  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKVTGHQH---PWLADNLNEGKLYDFY  550

Query  294  WLLAGLGVINFVVYLICS  241
            WLL  L + N +++L C+
Sbjct  551  WLLTVLSIFNLMIFLFCA  568



>ref|XP_010676153.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=593

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            V M V+A  E KRL  A S G     N+ L ++VF+LIPQF L G+GEA +Y GQLDFFL
Sbjct  431  VAMVVAALTEIKRLQVAESHGLVHDQNAVLPITVFWLIPQFILTGAGEAMIYAGQLDFFL  490

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKT+STGLFL+TLS+GFF S+ +VS+V  +T+ S   + WLADN+N GRL  FY
Sbjct  491  RECPKGMKTISTGLFLSTLSIGFFFSTLVVSIVNSLTAHS---KPWLADNLNEGRLYNFY  547

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLL  + ++NFV+++ C+ W+  +    A E
Sbjct  548  WLLGIISLVNFVLFMFCAKWYVYKDKWLAAE  578



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A+S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  432  MAMAVAALVEIKRLRTAHSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  491

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  492  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTGTTH---PWIADDLNKGRLYNFYWLV  548

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A L  +NF+++L+ S W+  +  + A   +E+E
Sbjct  549  AVLVALNFLIFLVFSKWYVYKDKRLAEVGIELE  581



>gb|KHG24776.1| Uncharacterized protein F383_04224 [Gossypium arboreum]
Length=585

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL AA + G  N   + + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  426  IAMVAAALTEIKRLRAATTNGLANNPSAQIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  485

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FY
Sbjct  486  RECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHKVTGNKH---PWLPDNLNQGRLYDFY  542

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N  +YL+ + W+  +  + A   +E+E
Sbjct  543  WLLAILSCLNLAIYLVFAKWYVYKDKRLADEGIELE  578



>gb|KJB20885.1| hypothetical protein B456_003G170300 [Gossypium raimondii]
Length=586

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL AA + G  N   + + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  427  IAMVAAALTEIKRLRAATTNGLANNPTAQIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  486

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT   H    WL DN+N GRL  FY
Sbjct  487  RECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHKVTGNKH---PWLPDNLNQGRLYDFY  543

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N  +YL+ + W+  +  + A   +E+E
Sbjct  544  WLLAILSCLNLAIYLVFAKWYVYKDKRLADEGIELE  579



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 111/157 (71%), Gaps = 6/157 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MGMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEMETVMN  184
            A +  +NF+V+L+ S W+  ++ + A   +E+E  ++
Sbjct  548  AVIVALNFLVFLVFSKWYVYKEKRLADLGIELEDELD  584



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  430  MGMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLREC  489

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+
Sbjct  490  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLV  546

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  547  AVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  579



>emb|CDY26539.1| BnaA09g47380D [Brassica napus]
Length=574

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  416  MGMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLREC  475

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+
Sbjct  476  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLV  532

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  533  AVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  565



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MGMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  548  AVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  580



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 101/151 (67%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL      G   +  + + +SVF+L PQF LVGSGEAF Y GQLDFFL
Sbjct  432  IAMIAAALTEIKRLKVVEENGLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LG F SS LV++V K    +  G+ W+ DN+N G+L  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLALGXFFSSLLVTIVGK---VTEHGKPWIPDNLNEGKLYDFY  548

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L V+N +V+L+C+ W+  ++ + A E
Sbjct  549  WLLAVLSVLNLMVFLVCAKWYVYKEKRLADE  579



>ref|XP_004244572.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  SA  E KRL  A+  G     N+T+ +SVF+LIPQF L+G+GEAF Y GQLDFFL
Sbjct  431  IAMIASALTEVKRLNTAHLNGLTNDPNATIPLSVFWLIPQFLLIGAGEAFTYIGQLDFFL  490

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFF SS LV++V  VT   H    W+ADN+N G+L  FY
Sbjct  491  RECPKGMKTMSTGLFLSTLALGFFFSSILVTIVHMVTGTKH---PWIADNLNQGKLHDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V+N +V+L  S   ++ + R  +  +E+E
Sbjct  548  WLLAILSVLNLMVFLYTSKTYVYKEKRLAEMGIELE  583



>ref|XP_004147617.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004171170.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL      G   +  + + +SVF+L PQF LVGSGEAF Y GQLDFFL
Sbjct  432  IAMVAAALTEIKRLKVVEENGLTYKPTAEVPLSVFWLAPQFLLVGSGEAFTYMGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFF SS LV++V K    +  G+ W+ DN+N G+L  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLALGFFFSSLLVTIVGK---VTEHGRPWIPDNLNEGKLYDFY  548

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L V+N +V+L+C+ W+  ++ + A E
Sbjct  549  WLLAILSVLNLMVFLVCAKWYVYKEKRLADE  579



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 105/155 (68%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A   G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL 
Sbjct  434  AMIAAALTEVKRLKVAKLHGLTNDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLR  493

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLF++T+SLGFF SS LV++V KVT  +   + WLADN+N G+L  FYW
Sbjct  494  ECPKGMKTMSTGLFISTISLGFFFSSILVTIVDKVTGKT---KPWLADNLNKGKLYDFYW  550

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L V+N +V+L CS   ++ + R  +  +EME
Sbjct  551  LLAILSVLNLMVFLFCSRRYVYKEKRLAEVGIEME  585



>emb|CDY15967.1| BnaC08g41560D [Brassica napus]
Length=574

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 6/152 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + P
Sbjct  417  GMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECP  476

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+A
Sbjct  477  KGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLVA  533

Query  282  GLGVINFVVYLICSIWFKPRKNKSA---VEME  196
             +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  534  IIVALNFLVFLVFSKWYVYKEKRLADLGIELE  565



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A +E KRL  A++ G    TL +    LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MGMAVAALVEIKRLRTAHAHGPTVKTLPLGFSLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  548  AVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  580



>emb|CCN27378.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 87/152 (57%), Gaps = 12/152 (8%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A IE+ RL   +++G     +T++VF L+PQF LVG+GEAF Y GQLDFFL + P
Sbjct  8    GMAAAALIERYRLTE-SADG-----VTITVFLLMPQFLLVGAGEAFTYMGQLDFFLRECP  61

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLADNINYGRLDLFYWLL  286
            K MKTM     L   +         + V        HG  D WLA+NI+ GRLD FYWLL
Sbjct  62   KGMKTM--STGLFLSTCALGFFFSTLIVTIVHKVTGHGSNDGWLANNIDQGRLDYFYWLL  119

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEM  199
            A +  IN V + I +   ++ + R   + +E+
Sbjct  120  AVMSAINIVFFTIAARGYVYKEKRMADAGIEL  151



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 110/165 (67%), Gaps = 7/165 (4%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNS-----TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            M  +A  E+KRL AA +  R +S     T+ +SVF+L+PQFF VGSGEAF Y GQLDFFL
Sbjct  434  MVAAALTERKRLHAAWATDRSSSVGRGATVPLSVFWLVPQFFFVGSGEAFTYIGQLDFFL  493

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LVS+V KVT  S  G  WLADN+N GRL  FY
Sbjct  494  RECPKGMKTMSTGLFLSTLSLGFFFSSALVSIVHKVTGESGRGA-WLADNLNEGRLYNFY  552

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  163
            WLLA L V+N  V+L+ +  +  ++ +   E  +V      EE C
Sbjct  553  WLLAVLSVVNLGVFLVSAKGYVYKEKRIEAEDGSVAAVELAEEAC  597



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 96/165 (58%), Gaps = 7/165 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GM V++ IE KRL+ A +    ++ L +SVF LIPQFFLVG+G  FMYTGQLD F+TQS
Sbjct  423  LGMGVASIIEVKRLSIAKANEETSNNLPISVFLLIPQFFLVGAGVGFMYTGQLDLFITQS  482

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTM +     T     F  S L+  + K  + ++    W+ ++IN  RLD FY LL
Sbjct  483  PKGMKTM-STGLFLTTMALGFFFSSLLISIVKKVTTTNINNGWVGESINKSRLDCFYGLL  541

Query  285  AGLGVINFVVYLICSIWF------KPRKNKSAVEMETVMNGNGEE  169
            A L  I+F  Y++C+ W+       P  +K  + + + + G   E
Sbjct  542  AILIFIDFGFYVLCASWYFWLKIVAPGNSKPDLIINSQLRGREPE  586



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + M  +A IE KRL AA S     +T+ + VF+L+PQFFLVGSG AF Y GQLDFFL + 
Sbjct  426  LAMVAAALIEIKRLKAARS-----TTVPLRVFWLVPQFFLVGSGVAFTYIGQLDFFLREC  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGLFL+TL+LGFFVSS LV++V  VT  S G   WLA+++N G+L  FYWLL
Sbjct  481  PKGMKTMSTGLFLSTLALGFFVSSGLVAIVHLVTGESGGHGAWLANDLNRGKLYNFYWLL  540

Query  285  AGLGVINFVVYLICSIWF  232
            A L ++NF VY++ + W+
Sbjct  541  AVLSLVNFGVYVLSARWY  558



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MAMAVAALVEIKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            A L  INF+++L+ S W+   + R  ++ +EM+
Sbjct  548  AVLVAINFLIFLVFSKWYVYKEKRLAEAGIEMD  580



>ref|XP_002889915.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66174.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
Length=589

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  ANS G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MAMAVAALVELKRLRTANSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            A L  +NF+++L+ S W+  ++ + A
Sbjct  548  AVLVALNFLIFLVFSKWYVYKEKRLA  573



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MAMAVAALVEIKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  491  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWF---KPRKNKSAVEME  196
            A L  INF+++L+ S W+   + R  ++ +EM+
Sbjct  548  AVLVAINFLIFLVFSKWYVYKEKRLAEAGIEMD  580



>ref|XP_009611019.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
 dbj|BAC56914.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  432  IAMIAAALTEVKRLNVAHLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT    G   WLADN+N GRL  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKVT----GKNPWLADNLNQGRLYDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  163
            WLLA L V+N +++L  S   ++ + R  +  +EME     + E  C
Sbjct  548  WLLATLSVLNLMIFLFISRRYVYKEKRLAECGIEME-----DSEPAC  589



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLA---AANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            +GMA ++  E KRL    A       +STL ++ FYL+PQF LVG G+ FMYTGQLDFF+
Sbjct  425  LGMAAASFAEMKRLEVVRANRGSTSTSSTLPITAFYLLPQFVLVGIGDGFMYTGQLDFFI  484

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
            T+SPK MK + +     T +   F  S ++  +    +    G  WL   IN  RLD FY
Sbjct  485  TESPKGMKAI-STGLFLTTNALGFFGSSILVTIITKVTGEEVGHGWLLSRINDSRLDFFY  543

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA  208
             LLA LG IN V YL+ + W+KP   + A
Sbjct  544  ALLAVLGFINLVFYLVLASWYKPSPVEDA  572



>ref|XP_006366745.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=592

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A S G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL 
Sbjct  434  AMIAAALTEIKRLNVAQSHGLTNNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLR  493

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLF++T+SLGFF SS LVS+V KVT+ S   + WLADN+N G+L  FYW
Sbjct  494  ECPKGMKTMSTGLFISTISLGFFFSSILVSIVDKVTAKS---RPWLADNLNQGKLSNFYW  550

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L V+N +++  C+   ++ + R  +  ++ME
Sbjct  551  LLAILSVLNVILFFYCAKRYVYKEKRLAEVGIQME  585



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 105/155 (68%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A   G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL 
Sbjct  434  AMIAAALTEVKRLKVAKLHGLANDQNAIIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLR  493

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLF++T+SLGFF SS LV++V KVT  +   + WLADN+N G+L  FYW
Sbjct  494  ECPKGMKTMSTGLFISTISLGFFFSSILVTIVDKVTGKT---RPWLADNLNKGKLYDFYW  550

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L V+N +++L CS   ++ + R  +  +EME
Sbjct  551  LLAILSVLNLMLFLFCSSRYVYKEKRLAEVGIEME  585



>emb|CAC00544.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=590

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 110/167 (66%), Gaps = 15/167 (9%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  432  IAMVAAALTEVKRLNVAHLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  +     WLADN+N GRL  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFVSSILVTIVHKVTVKN----PWLADNLNQGRLYDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  163
            WLLA L V+N +V+L  S   ++ + R  +  +EME     + E  C
Sbjct  548  WLLATLSVLNLMVFLFISRRYVYKEKRLAECGIEME-----DSEPAC  589



>ref|XP_002452347.1| hypothetical protein SORBIDRAFT_04g024090 [Sorghum bicolor]
 gb|EES05323.1| hypothetical protein SORBIDRAFT_04g024090 [Sorghum bicolor]
Length=597

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 92/159 (58%), Gaps = 13/159 (8%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
             MAVSA +EKKR  A+N  G     + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++P
Sbjct  433  AMAVSALVEKKRRDASNGPGH----VAISAFWLVPQFFLVGAGEAFAYVGQLEFFIREAP  488

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            + MK+M          +   +  FL S +     A  GG  W+ +N++ GRLDLFYW+LA
Sbjct  489  ERMKSM----STGLFLVTLSMGFFLSSFLVFAVDAVTGGA-WIRNNLDRGRLDLFYWMLA  543

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
             LGV NF V+++    F  R    A  +   +  +G  +
Sbjct  544  VLGVANFAVFIV----FARRHQYKASNLPAAVAPDGAAR  578



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 101/146 (69%), Gaps = 3/146 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + M V+A +E KRL  A++  +   TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  483  MAMVVAALVEIKRLRTAHAHDQTVKTLPLGFYLLIPQYLIVGIGEALLYTGQLDFFLREC  542

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMS GL L+TL+LGFF SS LV++V KVT  +H    W+ADN+N GRL  FYWL+
Sbjct  543  PKGMKTMSAGLLLSTLALGFFFSSVLVTIVHKVTGTTHA---WIADNLNKGRLYNFYWLV  599

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            + L  +NF+V+L+ S W+  +  + A
Sbjct  600  SVLCALNFIVFLVFSKWYVYKDKRLA  625



>ref|XP_010553465.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=589

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
             MAV+A +E KRL  A+S    + TL +  + LIPQ+ +VG GEA +YTGQLDFFL + P
Sbjct  431  AMAVAALVEIKRLRTAHSHSPTDKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECP  490

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLA  283
            K MKTMSTGL L+TL+LGFF+SS LV++V KVT  +H    W+A+++N GRL  FYWL+A
Sbjct  491  KGMKTMSTGLLLSTLALGFFLSSVLVAIVHKVTGTAHA---WIANDLNKGRLYNFYWLVA  547

Query  282  GLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGE  172
             L  +NF V+L+ + W+   K+K   E+   ++   E
Sbjct  548  VLCALNFAVFLVFAKWYV-YKDKRLAEVGIELDDEPE  583



>ref|XP_004245746.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 10/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  432  IAMIAAALTEVKRLNVAHMHGLTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT    G + WLADN+N GRL  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFVSSILVTIVHKVT----GDKPWLADNLNQGRLYDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V+N +++L  S   ++ + R     +EME
Sbjct  548  WLLAILSVLNLMIFLFFSRRYVYKEKRLADVGIEME  583



>ref|XP_003574312.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=599

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 98/162 (60%), Gaps = 13/162 (8%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMAV+A +E+ RL +++    H +TLT  VF L+PQF LVG+GEAF Y GQLDFFL + P
Sbjct  444  GMAVAALVERHRLTSSS----HGATLT--VFLLMPQFLLVGAGEAFTYMGQLDFFLRECP  497

Query  462  KSMKTMstgl-flttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            K MKTMSTGL   T     F  +  +  V K       G   WLA+N++ GRLD FYWLL
Sbjct  498  KGMKTMSTGLFLSTCALGFFLSTLTVTIVHKITGHGPQGSAGWLANNLDQGRLDYFYWLL  557

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  178
            A +  +N V +++ +   ++ + R   + +E+   E +M G+
Sbjct  558  AVMSAVNLVFFVVAARGYVYKEKRLADAGIELADEEAIMVGH  599



>gb|KHG03840.1| Uncharacterized protein F383_26454 [Gossypium arboreum]
Length=525

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 105/156 (67%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KR+  A + G  N   + + +SVF+L+PQF  VG+GEAF Y GQLDFFL
Sbjct  366  IAMVAAALIEIKRMRVATTNGLTNNPTAQIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFL  425

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF+SS LV++V KV+   H    WL DN+N GRL  FY
Sbjct  426  RECPKGMKTMSTGLFLSTLSLGFFLSSLLVTIVDKVSGNKH---PWLPDNLNQGRLYDFY  482

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N  +YL+ + W+  +  + A   +E+E
Sbjct  483  WLLAILCCLNLAIYLVFAKWYVYKDKRLADEGIELE  518



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 82/150 (55%), Gaps = 6/150 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAA---NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KR+      N     NS + MSVF+L+PQFF VGSGEAF Y GQLDFFL 
Sbjct  433  AMVAAALTELKRMRVTHLHNLTHNPNSEIPMSVFWLVPQFFFVGSGEAFTYIGQLDFFLR  492

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTM        LS       F   +V  V   +   + WLADN+N G+L  FYW
Sbjct  493  ECPKGMKTM---STGLFLSTLSLGFFFSSLLVTVVHRVTGHHKPWLADNLNQGKLYDFYW  549

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LLA L   N V+YL C+ W+  +  + A E
Sbjct  550  LLALLSGFNLVIYLFCAKWYVYKDKRLADE  579



>gb|EMT27348.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=381

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 97/153 (63%), Gaps = 10/153 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+ RL ++     H  TLT  VF L+PQF LVG+GEAF Y GQLDFFL + 
Sbjct  225  VGMAAAAIVERHRLTSST----HGVTLT--VFLLMPQFLLVGAGEAFTYMGQLDFFLREC  278

Query  465  PKSMKTMstglflttlslgff-vssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            PK MKTMSTGLFL+T +LGFF  +  +  V K       G   WLADN++ GRLD FYWL
Sbjct  279  PKGMKTMSTGLFLSTCALGFFFSTVTVTIVHKVTGHGPRGTGGWLADNLDQGRLDYFYWL  338

Query  288  LAGLGVINFVVYLICS---IWFKPRKNKSAVEM  199
            LA +  IN V + I +   ++ + R   + +E+
Sbjct  339  LAVMSAINIVFFTIAARGYVYKEKRLADAGIEL  371



>emb|CCN27377.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 102/153 (67%), Gaps = 10/153 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            VGMA +A +E+ RL ++     H  TLT  VF L+PQ  LVG+GEAF Y GQLDFFL + 
Sbjct  5    VGMAAAAIVERHRLTSST----HGVTLT--VFLLMPQSLLVGAGEAFTYMGQLDFFLREC  58

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvt-SASHGGQDWLADNINYGRLDLFYWL  289
            PK MKTMSTGLFL+T +LGFF S+ +V++V KVT     G   WLADN++ GRLD FYWL
Sbjct  59   PKGMKTMSTGLFLSTCALGFFFSTVIVTIVHKVTGHGPRGTGGWLADNLDQGRLDYFYWL  118

Query  288  LAGLGVINFVVYLICS---IWFKPRKNKSAVEM  199
            LA +  IN V + I +   ++ + R   + +E+
Sbjct  119  LAVMSAINIVFFTIAARGYVYKEKRLADAGIEL  151



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 6/148 (4%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG-RHN--STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A S G  H+  + + +SVF+L+PQF LVGSGEAF Y GQLDFFL 
Sbjct  436  AMVAAALSEIKRLHVARSHGLTHDRAAIVPLSVFWLVPQFLLVGSGEAFTYIGQLDFFLR  495

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTM        LS           +V  V   +   + WLADN+N GRL  FYW
Sbjct  496  ECPKGMKTM---STGLFLSTLSLGFFVSSILVAIVHKVTGEKKPWLADNLNEGRLYNFYW  552

Query  291  LLAGLGVINFVVYLICSIWFKPRKNKSA  208
            LL  L ++N  V+L+ + W+  ++N+ A
Sbjct  553  LLTILSILNLAVFLVSARWYVYKENRLA  580



>dbj|BAG91755.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            V M  +A  E +RL  A ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL +
Sbjct  293  VAMVCAALTEVRRLRVARDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRE  352

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWL
Sbjct  353  CPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWL  409

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LAG+ + N +VYL+ + W+K +  ++A   +  +     E C
Sbjct  410  LAGVCLANLLVYLVAARWYKYKAGRAAAAGDGGVEMADAEPC  451



>ref|XP_002464959.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
 gb|EER91957.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
Length=595

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 9/152 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMAV+A +E+ R  AA++E  H   +T+SVF L+PQF LVG+GEAF Y GQL FFL + P
Sbjct  439  GMAVAALVERHRQTAASAE--HG--VTLSVFLLMPQFVLVGAGEAFTYMGQLAFFLRECP  494

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLL  286
            K MKTM +     +     F  S L+  +    +  HGG+  WLADN++ GRLD FYWLL
Sbjct  495  KGMKTM-STGLFLSTCALGFFFSTLLVTIVHKVTGRHGGRGGWLADNLDDGRLDYFYWLL  553

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEM  199
            A +  IN V++   +   ++ + R   + +E+
Sbjct  554  AVISAINLVIFTFAARGYVYKEKRLADAGIEL  585



>ref|XP_006417264.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
 gb|ESQ35617.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
Length=590

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A+S G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  431  MAMAVAALVEIKRLRTAHSHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  490

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+A+++N GRL  FYWL+
Sbjct  491  PKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTGKTH---PWIANDLNKGRLYNFYWLV  547

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            A L  +NF+++L+ S W+  +  + A
Sbjct  548  AVLVALNFLIFLVFSKWYVYKDKRLA  573



>ref|XP_002529778.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32592.1| oligopeptide transporter, putative [Ricinus communis]
Length=584

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 105/156 (67%), Gaps = 10/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG-RHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A S G  H+ T  +  +VF+LIPQF LVGSGEA  Y GQLDFFL
Sbjct  425  IAMIAAALTEIKRLRTAESHGLTHDPTAEIPTTVFWLIPQFILVGSGEALTYVGQLDFFL  484

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT    G   W+ADNIN G+L  FY
Sbjct  485  KECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVHKVT----GNSPWIADNINEGKLYDFY  540

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N V++L C+ W+  +  + A   +E+E
Sbjct  541  WLLAILAGLNLVLFLGCAKWYVYKDKRLAEVGIELE  576



>ref|XP_004242006.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=592

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 9/155 (6%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLT  472
             M  +A  E KRL  A S G     N+ + MSVF+L+PQF LVG GEAF Y GQLDFFL 
Sbjct  434  AMIAAALTEIKRLNVAKSHGLINNPNAVIPMSVFWLVPQFLLVGGGEAFTYIGQLDFFLR  493

Query  471  QSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYW  292
            + PK MKTMSTGLF++T+SLGFF SS LVS+V KVT+ S   + WLADN+N G+L  FYW
Sbjct  494  ECPKGMKTMSTGLFISTISLGFFFSSILVSIVDKVTAKS---RPWLADNLNQGKLYNFYW  550

Query  291  LLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            LLA L V+N +++  C+   ++ + R  +  ++ME
Sbjct  551  LLAILSVLNVILFFYCAKRYVYKEKRLAEVGIQME  585



>ref|XP_009798260.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
 dbj|BAC56913.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  432  IAMVAAALTEVKRLNVAHLHGLTNDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT  +     WLADN+N GRL  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKVTVKN----PWLADNLNQGRLYDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  163
            WLLA L V+N +++L  S   ++ + R  +  +EME     + E  C
Sbjct  548  WLLATLSVLNLMIFLFISRRYVYKEKRLAECGIEME-----DSEPAC  589



>gb|AFK33709.1| unknown [Lotus japonicus]
Length=397

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 10/135 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V M VSA +EK+R    N+  +H +T   S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  236  VAMMVSAIVEKER--RENAVKKHTNT---SAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  290

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL TLS+G+FVSS LVS+V KV+      + WL  N+N GRLD FYWLL
Sbjct  291  PERMKSMSTGLFLATLSMGYFVSSLLVSIVDKVSQ-----KKWLKSNLNKGRLDYFYWLL  345

Query  285  AGLGVINFVVYLICS  241
            A LG++NF+++++ +
Sbjct  346  AALGILNFILFIVLA  360



>ref|NP_001061020.1| Os08g0155400 [Oryza sativa Japonica Group]
 dbj|BAF22934.1| Os08g0155400, partial [Oryza sativa Japonica Group]
Length=525

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            V M  +A  E +RL  A ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL +
Sbjct  365  VAMVCAALTEVRRLRVARDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRE  424

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWL
Sbjct  425  CPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWL  481

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LAG+ + N +VYL+ + W+K +  ++A   +  +     E C
Sbjct  482  LAGVCLANLLVYLVAARWYKYKAGRAAAAGDGGVEMADAEPC  523



>gb|ACU17848.1| unknown [Glycine max]
Length=256

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 110/161 (68%), Gaps = 15/161 (9%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V MAV+A +EK+R   A      N+T T+S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  95   VAMAVAAIVEKERRVNA----VKNNT-TISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  149

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL+TLS+G+FVSS LV++V          + WL  N+N GRLD FYWLL
Sbjct  150  PERMKSMSTGLFLSTLSMGYFVSSLLVAIVD-----KASKKRWLRSNLNKGRLDYFYWLL  204

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            A LGV NF+ +L+ ++     +++  V+  T  N + E++ 
Sbjct  205  AVLGVQNFIFFLVLAM-----RHQYKVQHSTKPNDSAEKEL  240



>ref|XP_006307075.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
 gb|EOA39973.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
Length=590

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAV+A IE KRL  A++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  432  MGMAVAALIEIKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  491

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  492  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  548

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            A L  +NF+V+L+ S   ++ + R   + +E++
Sbjct  549  AVLVALNFLVFLVFSKRYVYKEKRLADAGIELD  581



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -3

Query  618  EKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKT  448
            E KRL AA S G  +   + + +SVF+L+PQFFLVGSGEAF Y GQL FFL + P+ MKT
Sbjct  441  ELKRLRAARSNGLADDPSAQIPLSVFWLVPQFFLVGSGEAFTYIGQLGFFLRECPEGMKT  500

Query  447  MstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVI  268
            MSTG+FL+TLSLGFF+SS LVS+V KVT        WL+DN+N G+L  FYWLLA L V+
Sbjct  501  MSTGMFLSTLSLGFFLSSLLVSIVHKVTGERR--PPWLSDNLNQGKLYNFYWLLAVLSVL  558

Query  267  NFVVYLICSIWFKPRKNKSA  208
            NF +YL+C+ W+  ++++ A
Sbjct  559  NFGLYLVCARWYVYKESRLA  578



>ref|NP_563899.1| nitrate transporter 1.1 [Arabidopsis thaliana]
 sp|Q05085.1|PTR7_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.3; Short=AtNPF6.3; AltName: 
Full=Nitrate transporter 1.1; Short=AtNRT1; AltName: 
Full=Nitrate/chlorate transporter; AltName: Full=Protein CHLORINA 
1 [Arabidopsis thaliana]
 pdb|4CL4|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL4|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL5|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 pdb|4CL5|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 gb|AAA32770.1| CHL1 [Arabidopsis thaliana]
 gb|AAC17604.1| Identical to nitrate/chlorate transporter cDNA gb|L10357 from 
A. thaliana. ESTs gb|H37533 and gb|R29790, gb|T46117, gb|T46068, 
gb|T75688, gb|R29817, gb|R29862, gb|Z34634 and gb|Z34258 
come from this gene [Arabidopsis thaliana]
 gb|AAN72027.1| putative NPK1-related protein kinase 2 [Arabidopsis thaliana]
 gb|AAP68222.1| At1g12110 [Arabidopsis thaliana]
 dbj|BAH20163.1| AT1G12110 [Arabidopsis thaliana]
 gb|AEE28838.1| nitrate transporter 1.1 [Arabidopsis thaliana]
Length=590

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  432  MAMAVAALVELKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  491

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  492  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  548

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            A L  +NF+++L+ S W+  ++ + A
Sbjct  549  AVLVALNFLIFLVFSKWYVYKEKRLA  574



>pdb|4OH3|A Chain A, Crystal Structure Of A Nitrate Transporter
 pdb|4OH3|B Chain B, Crystal Structure Of A Nitrate Transporter
Length=599

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 103/146 (71%), Gaps = 3/146 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAV+A +E KRL  A++ G    TL +  + LIPQ+ +VG GEA +YTGQLDFFL + 
Sbjct  432  MAMAVAALVELKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLREC  491

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD++N GRL  FYWL+
Sbjct  492  PKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIADDLNKGRLYNFYWLV  548

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            A L  +NF+++L+ S W+  ++ + A
Sbjct  549  AVLVALNFLIFLVFSKWYVYKEKRLA  574



>gb|KJB20886.1| hypothetical protein B456_003G170400 [Gossypium raimondii]
Length=585

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A IE KR+  A + G  N   + + +SVF+L+PQF  VG+GEAF Y GQLDFFL
Sbjct  426  IAMVAAALIEIKRMRVATTNGLTNNPTAQIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFL  485

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF+SS LV++V KVT   H    WL DN+N GRL  FY
Sbjct  486  RECPKGMKTMSTGLFLSTLSLGFFLSSLLVTIVDKVTGNKH---PWLPDNLNQGRLYDFY  542

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  196
            WLLA L  +N  +YL+ + W+  +  + A   +E+E
Sbjct  543  WLLAILCGLNLAIYLVFAKWYVYKDKRLADEGIELE  578



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            V M  +A  E +RL  A ++       + M+VF+LIPQF  VG+GEAF Y GQLDFFL +
Sbjct  443  VAMVCAALTEVRRLRVARDARVGGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRE  502

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD++N G+L  FYWL
Sbjct  503  CPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLADDLNKGQLHKFYWL  559

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  163
            LAG+ + N +VYL+ + W+K +  ++A   +  +     E C
Sbjct  560  LAGVCLANLLVYLVAARWYKYKAGRAAAAGDGGVEMADAEPC  601



>gb|ACF86161.1| unknown [Zea mays]
Length=545

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 104/155 (67%), Gaps = 13/155 (8%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAVSA +E+KR  AAN  G     + +S F+L+PQ+FLVG+GEAF Y GQL+FF+ ++P+
Sbjct  383  MAVSALVERKRRDAANGPGH----VAVSAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPE  438

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK+MSTGLFL TLS+GFF+SS LV  V   T+ +     W+ +N++ GRLDLFYW+LA 
Sbjct  439  RMKSMSTGLFLVTLSMGFFLSSLLVFAVDAATAGT-----WIRNNLDRGRLDLFYWMLAL  493

Query  279  LGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
            LGV NF V+++    F  R    A  +   +  +G
Sbjct  494  LGVANFAVFVV----FARRHQYKATSLPASVAPDG  524



>gb|EMT09323.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=771

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 110/160 (69%), Gaps = 9/160 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V M V+A +EK R  AAN E      + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  604  VAMVVAALVEKMRRDAANGEPH----VAISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  659

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL TLS+GFF+SSFLV +V  VT  +     W+ +N++ GRLDLFYW+L
Sbjct  660  PERMKSMSTGLFLVTLSMGFFLSSFLVFLVHTVTRGA-----WIRNNLDRGRLDLFYWML  714

Query  285  AGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
            A LGV+NF+V+++ +   + + + S V      + +  EK
Sbjct  715  AVLGVVNFLVFVVIARRHEYKPSTSVVVAPAGEDNDTTEK  754



>gb|ACG29230.1| peptide transporter PTR2 [Zea mays]
Length=594

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 106/155 (68%), Gaps = 13/155 (8%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAVSA +E+KR  AAN  G     + +S F+L+PQ+FLVG+GEAF Y GQL+FF+ ++P+
Sbjct  432  MAVSALVERKRRDAANGPGH----VAVSAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPE  487

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK+MSTGLFL TLS+GFF+SSFLV  V   T+ +     W+ +N++ GRLDLFYW+LA 
Sbjct  488  RMKSMSTGLFLVTLSMGFFLSSFLVFAVDAATAGT-----WIRNNLDRGRLDLFYWMLAL  542

Query  279  LGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
            LGV NF V+++    F  R    A  + + +  +G
Sbjct  543  LGVANFAVFVV----FARRHQYKATSLPSSVAPDG  573



>ref|NP_001281186.1| peptide transporter PTR2 [Zea mays]
 gb|ACN34268.1| unknown [Zea mays]
 gb|AFW72027.1| peptide transporter PTR2 isoform 1 [Zea mays]
 gb|AFW72028.1| peptide transporter PTR2 isoform 2 [Zea mays]
Length=596

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 104/155 (67%), Gaps = 13/155 (8%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAVSA +E+KR  AAN  G     + +S F+L+PQ+FLVG+GEAF Y GQL+FF+ ++P+
Sbjct  434  MAVSALVERKRRDAANGPGH----VAVSAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPE  489

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK+MSTGLFL TLS+GFF+SS LV  V   T+ +     W+ +N++ GRLDLFYW+LA 
Sbjct  490  RMKSMSTGLFLVTLSMGFFLSSLLVFAVDAATAGT-----WIRNNLDRGRLDLFYWMLAL  544

Query  279  LGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  175
            LGV NF V+++    F  R    A  +   +  +G
Sbjct  545  LGVANFAVFVV----FARRHQYKATSLPASVAPDG  575



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + M  +A +E KRL  A +S     + + M+VF+LIPQFF VG+GEAF Y GQLDFFL +
Sbjct  442  LAMTSAALVEVKRLRVARDSAVPAGAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRE  501

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+VV K+   +   + W+AD++N G L  FYWL
Sbjct  502  CPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKI---TGDRRPWIADDLNKGELYKFYWL  558

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LAG+ + N VVYL  + W+K +  +   +
Sbjct  559  LAGVCLANLVVYLFAARWYKYKAGRPGAD  587



>ref|XP_006355480.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+ + +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  432  IAMIAAALTEVKRLNVAHLHGLTNDANAMIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  491

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT    G + WLADN+N G+L  FY
Sbjct  492  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKVT----GKKPWLADNLNQGKLYDFY  547

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  163
            WLLA L V N +++L  S   ++ + R  +  +EME     + E  C
Sbjct  548  WLLAILSVFNLMIFLFFSRRYVYKEKRLAEVGIEME-----DSEPAC  589



>gb|AAL16907.1|AF420016_1 putative low-affinity nitrate transporter [Narcissus pseudonarcissus]
Length=123

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = -3

Query  561  MSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvs  382
            MSVF+L+PQFFLVG+GEAF Y GQLDFFL + PK MKTMSTG+FL+TLSLGFF+SS LV+
Sbjct  3    MSVFWLVPQFFLVGAGEAFCYIGQLDFFLRECPKGMKTMSTGMFLSTLSLGFFLSSALVT  62

Query  381  vvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            +V KVT  S  G  WL D++N G+L  FYWLLA L  +N V +L+ + W+  ++N+ A +
Sbjct  63   IVHKVTGESGQGA-WLPDDLNRGKLYDFYWLLAVLSAVNLVAFLVSARWYVYKENRMATD  121



>ref|XP_006662041.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=589

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 15/162 (9%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMA +A IE+ RLA+++    H + LT  VF L+PQF LVG+GEAF Y GQLDFFL + P
Sbjct  436  GMAAAALIERHRLASSS----HGAVLT--VFLLMPQFVLVGAGEAFTYMGQLDFFLRECP  489

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQ-DWLADNINYGRLDLFYWLL  286
            K MKTM     L   +         + V        HG +  WLADN+++GRLD FYWLL
Sbjct  490  KGMKTM--STGLFLSTCAIGFFFSTLLVTIVHKITGHGPRGGWLADNLDHGRLDYFYWLL  547

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  178
            A L  IN   + + +   ++ + R   + +E+   ET+  G+
Sbjct  548  AVLSAINLCFFTLAAKGYVYKEKRLADAGIELADEETIAVGH  589



>emb|CCN27450.1| low affiniy nitrate transporter, partial [Triticum aestivum]
Length=230

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 9/133 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            +GMAVSA +EKKR  A+N  G     + +S  +L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  87   LGMAVSALVEKKRRDASNGSG----GVAVSALWLVPQFFLVGAGEAFAYVGQLEFFIREA  142

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL TL++GFF+SS LV  V  VT  +     W+  +++ GRLDLFYW+L
Sbjct  143  PERMKSMSTGLFLATLAMGFFLSSLLVLGVDAVTRGA-----WIRGHLDDGRLDLFYWML  197

Query  285  AGLGVINFVVYLI  247
            A LG+ NF V+L+
Sbjct  198  AVLGLANFAVFLV  210



>ref|XP_009411557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNS-TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + M  +A  E+KRLAAA ++    +  + +SVF+LIPQFFLVG+GEAF Y GQLDFFL +
Sbjct  432  LAMCAAALTERKRLAAAWTDPTDTAGVVPLSVFWLIPQFFLVGAGEAFTYIGQLDFFLRE  491

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S  G  WL D++N G+L  FYWL
Sbjct  492  CPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGESGKGA-WLPDDLNKGKLYDFYWL  550

Query  288  LAGLGVINFVVYLICS  241
            LA L  +N VV+++ +
Sbjct  551  LAVLSTLNLVVFVVAA  566



>ref|XP_003575234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Brachypodium distachyon]
Length=598

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 108/145 (74%), Gaps = 8/145 (6%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MAV+A +EK R  AA    + +++  +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++P+
Sbjct  432  MAVAALVEKMRRHAAV---KDHASPPVSAFWLVPQFFLVGAGEAFAYVGQLEFFIREAPE  488

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MK+MSTGLFL TLS+GFF+SSFLV VV  VT  +     WL ++++ GRLDLFYW+LA 
Sbjct  489  RMKSMSTGLFLVTLSMGFFLSSFLVFVVDAVTRGA-----WLPNDLDAGRLDLFYWMLAL  543

Query  279  LGVINFVVYLICSIWFKPRKNKSAV  205
            LGV+NFVV+L+ +   + + + SAV
Sbjct  544  LGVVNFVVFLVIARGHEYKPSTSAV  568



>gb|EYU24743.1| hypothetical protein MIMGU_mgv1a003354mg [Erythranthe guttata]
Length=590

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 101/151 (67%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A S G  +   +T+ +SVF+LIPQF LVGSGEAF Y GQLDFFL
Sbjct  431  IAMVAAALTEVKRLRVAESHGLTDDPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFL  490

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V K+   +     WLADN+N G+L  FY
Sbjct  491  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKL---TGDNNPWLADNLNQGKLYDFY  547

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLL  L V N V++  C+  +  ++ + A E
Sbjct  548  WLLTILSVFNLVIFQYCARRYVYKEKRLAEE  578



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAA-NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            + M  +A +E KRL  A  S     + + M+VF+LIPQFF VG+GEAF Y GQLDFFL +
Sbjct  442  LAMTSAALVEIKRLRVARESAVPEGAPVPMTVFWLIPQFFFVGAGEAFTYIGQLDFFLRE  501

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
             PK MKTMSTGLFL+TLSLGFFVSS LV+VV K+   +   + W+AD++N G L  FYWL
Sbjct  502  CPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKI---TGDRRPWIADDLNKGELYKFYWL  558

Query  288  LAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            LAG+ + N VVYL  + W+K +  +   +
Sbjct  559  LAGVCLANLVVYLFAARWYKYKAGRPGAD  587



>ref|XP_002984211.1| hypothetical protein SELMODRAFT_119838 [Selaginella moellendorffii]
 gb|EFJ14721.1| hypothetical protein SELMODRAFT_119838 [Selaginella moellendorffii]
Length=572

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 103/144 (72%), Gaps = 5/144 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M ++A +E+KRLA A   G   R  +T+ MS+F+L+PQ+ LVG  E F Y GQL+FF 
Sbjct  414  LAMVIAAMVERKRLALAREHGLLDRPKATVPMSIFWLVPQYALVGVSEVFTYIGQLEFFY  473

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
            +QSP+ M++M+TG+F++T+S+GFF SSFLV+ + +VT  S  G  W+++NIN GR+D FY
Sbjct  474  SQSPEEMRSMATGMFMSTISVGFFASSFLVATINRVTGGS--GHGWISNNINRGRIDNFY  531

Query  294  WLLAGLGVINFVVYLICSIWFKPR  223
            W+LA L + N  +++ C+  +K R
Sbjct  532  WMLAVLSLGNLAIHIACATCYKYR  555



>ref|XP_002972300.1| hypothetical protein SELMODRAFT_97069 [Selaginella moellendorffii]
 gb|EFJ26386.1| hypothetical protein SELMODRAFT_97069 [Selaginella moellendorffii]
Length=572

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 103/144 (72%), Gaps = 5/144 (3%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M ++A +E+KRLA A   G   R  +T+ MS+F+L+PQ+ LVG  E F Y GQL+FF 
Sbjct  414  LAMVIAAMVERKRLALAREHGLLDRPKATVPMSIFWLVPQYALVGVSEVFTYIGQLEFFY  473

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
            +QSP+ M++M+TG+F++T+S+GFF SSFLV+ + +VT  S  G  W+++NIN GR+D FY
Sbjct  474  SQSPEEMRSMATGMFMSTISVGFFASSFLVATINRVTGGS--GHGWISNNINRGRIDNFY  531

Query  294  WLLAGLGVINFVVYLICSIWFKPR  223
            W+LA L + N  +++ C+  +K R
Sbjct  532  WMLAVLSLGNLAIHIACATCYKYR  555



>gb|EYU18566.1| hypothetical protein MIMGU_mgv1a020825mg [Erythranthe guttata]
Length=590

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 101/151 (67%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHN---STLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A S G  +   +T+ +SVF+LIPQF LVGSGEAF Y GQLDFFL
Sbjct  431  IAMVAAALTEVKRLRVAESHGLTDDPTATIPLSVFWLIPQFLLVGSGEAFTYIGQLDFFL  490

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFF SS LV++V K+   +     WLADN+N G+L  FY
Sbjct  491  RECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKL---TGDNNPWLADNLNQGKLYDFY  547

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLL  L V N V++  C+  +  ++ + A E
Sbjct  548  WLLTILSVFNLVIFQYCARRYVYKEKRLAEE  578



>gb|EAY94439.1| hypothetical protein OsI_16210 [Oryza sativa Indica Group]
Length=420

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            + MAVSA +EKKR  A+   G     + +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  257  LAMAVSALVEKKRRDASGGAGGGGVAM-ISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  315

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+M        L+           +V  V +A+ G   W+ D ++ GRLDLFYW+L
Sbjct  316  PERMKSM---STGLFLATLAMGFFLSSLLVSAVDAATRGA--WIRDGLDDGRLDLFYWML  370

Query  285  AGLGVINFVVYLI  247
            A LGV NF  +L+
Sbjct  371  AALGVANFAAFLV  383



>gb|EAY88182.1| hypothetical protein OsI_09629 [Oryza sativa Indica Group]
Length=589

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -3

Query  594  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  415
                R ++ +T+SVFYL+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TLS
Sbjct  455  TERARRDAAVTLSVFYLLPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  514

Query  414  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYL  250
            LGFF S+ LV+VV KVT+ S   + WLADN++ GRLD FYWLL G+ V+N  V++
Sbjct  515  LGFFFSTALVTVVHKVTAESR--RPWLADNLDEGRLDNFYWLLGGISVVNLAVFV  567



>gb|ABF93501.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01124.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64490.1| hypothetical protein OsJ_19340 [Oryza sativa Japonica Group]
Length=589

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -3

Query  594  NSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMstglflttls  415
                R ++ +T+SVFYL+PQF LVG+GEAF Y GQLDFFL + PK MKTMSTGLFL+TLS
Sbjct  455  TERARRDAAVTLSVFYLLPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLS  514

Query  414  lgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINFVVYL  250
            LGFF S+ LV+VV KVT+ S   + WLADN++ GRLD FYWLL G+ V+N  V++
Sbjct  515  LGFFFSTALVTVVHKVTAESR--RPWLADNLDEGRLDNFYWLLGGISVVNLAVFV  567



>ref|XP_010228489.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brachypodium distachyon]
Length=559

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNST--LTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            M  +  +E  RL AA S G  +S   L +S+F+ +PQ+F+VG+ E F++ GQ+DFF  Q+
Sbjct  403  MIAAGVLEVARLRAAASHGMLDSKDFLPVSIFWQVPQYFIVGAAEVFVFVGQIDFFYDQA  462

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P +M+++   L LT+ +LG ++S+ LV +V  V+   +GG  W+ DN+N G LD F+WLL
Sbjct  463  PDAMRSLGAALSLTSAALGNYLSTLLVVIVTAVS-TRNGGIGWIPDNLNKGHLDYFFWLL  521

Query  285  AGLGVINFVVYLICSIWFKPRKNKSA  208
            A L V+NFVVYL  + W+K +  K+A
Sbjct  522  AALSVLNFVVYLWIAKWYKYKVYKTA  547



>ref|XP_006648788.1| PREDICTED: nitrate transporter 1.3-like [Oryza brachyantha]
Length=461

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 10/132 (8%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V MAV+A +EKKR  A N+ G       +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  292  VAMAVAALVEKKRRNATNNGGAM-----VSAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  346

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL TLS+GFF+SSFLV VV  VT  +     W+ +N++ GRLDLFYW+L
Sbjct  347  PERMKSMSTGLFLVTLSMGFFLSSFLVFVVDAVTRGA-----WIRNNLDAGRLDLFYWML  401

Query  285  AGLGVINFVVYL  250
            A LGV+NF  +L
Sbjct  402  AVLGVVNFAAFL  413



>ref|XP_007039888.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
 gb|EOY24389.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
Length=583

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A S G  N     + +SVF+L+PQF  VG+GEAF Y GQLDFFL
Sbjct  424  IAMIAAAMTEIKRLRVARSHGLTNDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFL  483

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FY
Sbjct  484  RECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHK---VTGNKKPWLPDNLNQGRLYDFY  540

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  +N  +YL+ + W+  +  + A E
Sbjct  541  WLLAILSSLNLAIYLVFAKWYVYKDKRLADE  571



>gb|EYU30304.1| hypothetical protein MIMGU_mgv1a003140mg [Erythranthe guttata]
Length=605

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 96/138 (70%), Gaps = 9/138 (7%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLT------MSVFYLIPQFFLVGSGEAFMYTGQLD  484
            + M  +A  E KRL  A S G   S+ T      +SVF+L+PQFFLVGSGEAF Y GQLD
Sbjct  443  LAMVAAALTEVKRLGVARSYGLTTSSGTAAAVVPLSVFWLVPQFFLVGSGEAFTYIGQLD  502

Query  483  FFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLD  304
            FFL + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLADN+N G+L 
Sbjct  503  FFLRECPKGMKTMSTGLFLSTLSLGFFVSSILVSIVHK---VTRQKKPWLADNLNQGKLY  559

Query  303  LFYWLLAGLGVINFVVYL  250
             FYWLLA L  +N VV+L
Sbjct  560  NFYWLLAILSTLNLVVFL  577



>ref|XP_007039889.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
 gb|EOY24390.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
Length=584

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A S G  N     + +SVF+L+PQF  VG+GEAF Y GQLDFFL
Sbjct  425  IAMIAAAMTEIKRLRVARSHGLTNDRAVEIPLSVFWLVPQFLFVGAGEAFTYIGQLDFFL  484

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TLSLGFFVSS LV++V K    +   + WL DN+N GRL  FY
Sbjct  485  RECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHK---VTGNKKPWLPDNLNQGRLYDFY  541

Query  294  WLLAGLGVINFVVYLICSIWFKPRKNKSAVE  202
            WLLA L  +N  +YL+ + W+  +  + A E
Sbjct  542  WLLAILSSLNLAIYLVFAKWYVYKDKRLADE  572



>ref|XP_009763469.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=594

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+T+ +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  435  LAMIAAALTEVKRLKVAHLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  494

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FY
Sbjct  495  RECPKGMKTMSTGLFLSTLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFY  551

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V+N + +L  S   ++ + R  +  +E+E
Sbjct  552  WLLAILSVLNLMFFLYFSRKYVYKEKRLAEMGIELE  587



>dbj|BAC56915.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+T+ +SVF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  435  LAMIAAALTEVKRLKVAHLHGLTNDANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFL  494

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFF SS LV++V  VT  ++    WLADN+N GRL  FY
Sbjct  495  RECPKGMKTMSTGLFLSTLALGFFFSSILVTIVHVVTGTTN---PWLADNLNQGRLYDFY  551

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V+N + +L  S   ++ + R  +  +E+E
Sbjct  552  WLLAILSVLNLMFFLYFSRKYVYKEKRLAEMGIELE  587



>ref|XP_002992556.1| hypothetical protein SELMODRAFT_135528, partial [Selaginella 
moellendorffii]
 gb|EFJ06362.1| hypothetical protein SELMODRAFT_135528, partial [Selaginella 
moellendorffii]
Length=465

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNS---TLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQ  469
            M  +A  E KR +AA + G  +S   T+ +S+F+L+PQ+ L+G  E F+  GQ++FF  Q
Sbjct  312  MVAAAATEVKRRSAAAAAGLLDSPDRTIPISIFWLLPQYVLIGVTELFLSIGQIEFFYDQ  371

Query  468  SPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWL  289
            SP+SM++M+T +F   +  G + S+ +VS       A H   +W+ DNIN GRLDLFYW+
Sbjct  372  SPESMRSMATAVFWMVIGGGNYCSTAMVS-------AVHARTNWVPDNINRGRLDLFYWM  424

Query  288  LAGLGVINFVVYLICSIWFKPRK  220
            LAG+  +N  VYL+ + W++ ++
Sbjct  425  LAGILTVNLGVYLVVARWYRYKR  447



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -3

Query  618  EKKRLAAANS-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMs  442
            E+KRL    +      STL ++ F LIPQF +VG  EAFMY+GQL FF++++PK MK +S
Sbjct  428  EQKRLKVIRANRNTPTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAIS  487

Query  441  tglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINF  262
              LFLTT+S G+FV++ LV ++KK+T    GG  WLA  IN  RLD FY L++ L  IN 
Sbjct  488  NSLFLTTISFGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINL  547

Query  261  VVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
             +YL+C+ W+KP  +++A + + V   + EEK
Sbjct  548  GLYLVCARWYKPNSSENAKDSD-VNASHDEEK  578



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -3

Query  618  EKKRLAAANS-EGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPKSMKTMs  442
            E+KRL    +      STL ++ F LIPQF +VG  EAFMY+GQL FF++++PK MK +S
Sbjct  430  EQKRLKVIRANRNTPTSTLPLTAFILIPQFAIVGIAEAFMYSGQLAFFISEAPKGMKAIS  489

Query  441  tglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAGLGVINF  262
              LFLTT+S G+FV++ LV ++KK+T    GG  WLA  IN  RLD FY L++ L  IN 
Sbjct  490  NSLFLTTISFGYFVTTILVDLIKKITPGKDGGHGWLAPKINDSRLDYFYALISVLSFINL  549

Query  261  VVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  166
             +YL+C+ W+KP  +++A + + V   + EEK
Sbjct  550  GLYLVCARWYKPNSSENAKDSD-VNASHDEEK  580



>gb|EYU27205.1| hypothetical protein MIMGU_mgv1a025825mg, partial [Erythranthe 
guttata]
Length=280

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 76/137 (55%), Gaps = 9/137 (7%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNS------TLTMSVFYLIPQFFLVGSGEAFMYTGQLDF  481
             M  +A  E KRL  A S    +S       + +SVF+L+PQFFLVGSGEAF Y GQLDF
Sbjct  119  AMVTAALTEVKRLGVARSHLTTSSGTATSAVVPLSVFWLVPQFFLVGSGEAFTYIGQLDF  178

Query  480  FLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDL  301
            FL + PK MKTM        LS           +V  V   +   + WLADN+N G+L  
Sbjct  179  FLRECPKGMKTM---STGLFLSTLSLGFFVSSILVSIVHKVTGQKKSWLADNLNQGKLYN  235

Query  300  FYWLLAGLGVINFVVYL  250
            FYWLLA L  +N VV+L
Sbjct  236  FYWLLAILSTLNLVVFL  252



>ref|XP_010919516.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=592

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 107/161 (66%), Gaps = 4/161 (2%)
 Frame = -3

Query  639  MAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSPK  460
            MA +A  E KRL AA++     ST+ +SVF+L+PQFF  G+GEAF Y GQLDFFL + PK
Sbjct  431  MAAAALTELKRLHAASAV-DAGSTVPLSVFWLVPQFFFTGAGEAFTYIGQLDFFLRECPK  489

Query  459  SMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLLAG  280
             MKTMSTGLFL+TLSLGFF SS LV++V KVT  +  G  WL DN+N GRL  FYWLLA 
Sbjct  490  GMKTMSTGLFLSTLSLGFFFSSALVTIVDKVTGETGRGA-WLPDNLNQGRLYDFYWLLAA  548

Query  279  LGVINFVVYLICS--IWFKPRKNKSAVEMETVMNGNGEEKC  163
            L V+N  ++L+ +    +K ++  S  +   V     +E C
Sbjct  549  LSVLNLGLFLLSAKGYVYKEKRMASGEQGSVVAVELADEAC  589



>gb|EEC73483.1| hypothetical protein OsI_07814 [Oryza sativa Indica Group]
Length=720

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 81/133 (61%), Gaps = 8/133 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V MA SA +EKKR  AAN          +S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  547  VAMATSALVEKKRRDAAND---GGGGGMISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  603

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+M        L            +V  V +A+ G   W+ ++++ GRLDLFYW+L
Sbjct  604  PERMKSM---STGLFLVTLSMGFFLSSFLVFAVDAATRGA--WIRNDLDAGRLDLFYWML  658

Query  285  AGLGVINFVVYLI  247
            A LGV NF V+L+
Sbjct  659  AVLGVANFAVFLV  671



>ref|XP_008658424.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46299.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
 tpg|DAA46300.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
Length=595

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 87/152 (57%), Gaps = 12/152 (8%)
 Frame = -3

Query  642  GMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQSP  463
            GMAV+A +E+ R  A+     H +TLT  VF L+PQF LVG+GEAF Y GQL FFL + P
Sbjct  442  GMAVAALVERHRQVASG----HGATLT--VFLLMPQFVLVGAGEAFTYMGQLAFFLRECP  495

Query  462  KSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLADNINYGRLDLFYWLL  286
            K MKTM     L   +         + V       +H G+D WLADN++ GRLD FYWLL
Sbjct  496  KGMKTM--STGLFLSTCALGFFFSTLLVTIVHKVTAHAGRDGWLADNLDDGRLDYFYWLL  553

Query  285  AGLGVINFVVYLICS---IWFKPRKNKSAVEM  199
            A +  IN V++   +   ++ + R   + +E+
Sbjct  554  AVISAINLVLFTFAARGYVYKEKRLADAGIEL  585



>ref|XP_004491123.1| PREDICTED: nitrate transporter 1.3-like [Cicer arietinum]
Length=581

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 115/165 (70%), Gaps = 16/165 (10%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V M VSA +EK+R    ++  + N+T+  S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  426  VAMVVSAIVEKER---RDNAVKKNTTI--SAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTG FLTTLS+G+FVSS LVS+V KV+      + WL  N+N G+LD FYWLL
Sbjct  481  PERMKSMSTGFFLTTLSMGYFVSSLLVSIVDKVSK-----KRWLKSNLNKGKLDYFYWLL  535

Query  285  AGLGVINFVVYLICSIW--FKPRKN----KSAVEMETVMNGNGEE  169
            A LGV+NFV++L+ ++   +K + N      ++E E V+    EE
Sbjct  536  AVLGVLNFVLFLVLAMRHEYKAQHNNIETNDSIEKELVIANGMEE  580



>ref|XP_003545571.1| PREDICTED: nitrate transporter 1.3-like [Glycine max]
Length=587

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 101/136 (74%), Gaps = 11/136 (8%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEGRHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFLTQS  466
            V MAV+A +EK+R A A          T+S F+L+PQFFLVG+GEAF Y GQL+FF+ ++
Sbjct  427  VAMAVAAIVEKERRANAVKNN------TISAFWLVPQFFLVGAGEAFAYVGQLEFFIREA  480

Query  465  PKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFYWLL  286
            P+ MK+MSTGLFL+TLS+G+FVSS LV++V K +      + WL  N+N GRLD FYWLL
Sbjct  481  PERMKSMSTGLFLSTLSMGYFVSSLLVAIVDKASK-----KRWLRSNLNKGRLDYFYWLL  535

Query  285  AGLGVINFVVYLICSI  238
            A LG++NF+++L+ ++
Sbjct  536  AVLGLLNFILFLVLAM  551



>ref|XP_009800593.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800594.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Nicotiana 
sylvestris]
Length=594

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 9/156 (6%)
 Frame = -3

Query  645  VGMAVSAXIEKKRLAAANSEG---RHNSTLTMSVFYLIPQFFLVGSGEAFMYTGQLDFFL  475
            + M  +A  E KRL  A+  G     N+T+ ++VF+L+PQF LVG+GEAF Y GQLDFFL
Sbjct  435  LAMIAAALTEVKRLKVAHLHGLANDENATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFL  494

Query  474  TQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINYGRLDLFY  295
             + PK MKTMSTGLFL+TL+LGFFVSS LV++V  VT   +    WLADN+N GRL  FY
Sbjct  495  RECPKGMKTMSTGLFLSTLALGFFVSSILVTIVHIVTGTKN---PWLADNLNQGRLYDFY  551

Query  294  WLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  196
            WLLA L V N + +L  S   ++ + R  +  +E+E
Sbjct  552  WLLAILSVFNLMFFLYSSRKYVYKEKRLAEMGIELE  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625