BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF030C23

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230973.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  65.1    2e-10   Solanum lycopersicum
ref|XP_009611087.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  64.3    3e-10   Nicotiana tomentosiformis
emb|CAM59671.1|  parvulin-type peptidyl-prolyl cis/trans isomerase    63.2    8e-10   Lotus japonicus
ref|XP_010531077.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  62.4    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_010679861.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  62.0    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009768326.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  61.6    2e-09   Nicotiana sylvestris
ref|XP_009150751.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  61.2    3e-09   Brassica rapa
ref|NP_179395.1|  peptidyl-prolyl cis-trans isomerase Pin1            61.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  61.2    4e-09   Tarenaya hassleriana [spider flower]
emb|CDY25130.1|  BnaC07g03770D                                        61.2    4e-09   Brassica napus [oilseed rape]
ref|XP_009102286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  60.8    4e-09   Brassica rapa
pdb|1J6Y|A  Chain A, Solution Structure Of Pin1at From Arabidopsi...  61.2    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ABR09055.1|  PIN1                                                  60.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006425516.1|  hypothetical protein CICLE_v10026785mg           60.5    6e-09   Citrus clementina [clementine]
ref|XP_007046727.1|  Peptidylprolyl cis/trans isomerase               61.2    6e-09   
ref|XP_002884105.1|  PIN1AT                                           60.5    7e-09   
ref|XP_006359611.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  60.5    7e-09   Solanum tuberosum [potatoes]
ref|XP_009341146.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  60.1    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_002310854.2|  hypothetical protein POPTR_0007s14010g           59.3    9e-09   
ref|XP_006409205.1|  hypothetical protein EUTSA_v10022913mg           60.1    9e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010489500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  60.1    1e-08   Camelina sativa [gold-of-pleasure]
emb|CDY29218.1|  BnaA06g25390D                                        60.1    1e-08   Brassica napus [oilseed rape]
ref|XP_010467608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  59.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010413120.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  59.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011025935.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  59.7    1e-08   Populus euphratica
ref|XP_006296744.1|  hypothetical protein CARUB_v10014942mg           59.7    1e-08   Capsella rubella
gb|KFK40181.1|  hypothetical protein AALP_AA3G340900                  59.3    1e-08   Arabis alpina [alpine rockcress]
ref|XP_008452069.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  59.3    2e-08   Cucumis melo [Oriental melon]
ref|XP_009629157.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  60.1    2e-08   Nicotiana tomentosiformis
sp|Q94G00.1|PIN1_MALDO  RecName: Full=Peptidyl-prolyl cis-trans i...  58.5    3e-08   Malus domestica [apple tree]
ref|XP_008355527.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  58.5    3e-08   
ref|XP_010920237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  58.5    3e-08   Elaeis guineensis
ref|NP_001236944.1|  uncharacterized protein LOC100499854             58.2    4e-08   Glycine max [soybeans]
ref|XP_011088541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.8    5e-08   Sesamum indicum [beniseed]
emb|CDP01913.1|  unnamed protein product                              57.8    5e-08   Coffea canephora [robusta coffee]
ref|XP_004146507.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.8    6e-08   Cucumis sativus [cucumbers]
ref|XP_004303637.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.8    6e-08   Fragaria vesca subsp. vesca
ref|XP_009789724.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.4    8e-08   Nicotiana sylvestris
ref|XP_008785114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.4    9e-08   Phoenix dactylifera
ref|XP_010113370.1|  Peptidyl-prolyl cis-trans isomerase Pin1         59.7    1e-07   
ref|XP_007225834.1|  hypothetical protein PRUPE_ppa013466mg           57.0    1e-07   Prunus persica
ref|XP_008807602.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  57.0    1e-07   Phoenix dactylifera
ref|XP_008222450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  56.6    1e-07   Prunus mume [ume]
ref|XP_010934204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  56.6    1e-07   Elaeis guineensis
ref|XP_004509352.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  56.6    2e-07   Cicer arietinum [garbanzo]
emb|CDY20906.1|  BnaC06g01260D                                        56.2    2e-07   Brassica napus [oilseed rape]
gb|KJB70968.1|  hypothetical protein B456_011G099300                  57.0    2e-07   Gossypium raimondii
ref|XP_008377945.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  56.2    2e-07   
ref|XP_007156126.1|  hypothetical protein PHAVU_003G260800g           55.8    3e-07   Phaseolus vulgaris [French bean]
ref|XP_003629341.1|  Peptidyl-prolyl cis-trans isomerase Pin1         55.5    4e-07   Medicago truncatula
ref|XP_004233552.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  55.5    4e-07   Solanum lycopersicum
gb|KHG27749.1|  Peptidyl-prolyl cis-trans isomerase Pin1              55.5    4e-07   Gossypium arboreum [tree cotton]
gb|KJB40134.1|  hypothetical protein B456_007G048100                  55.1    4e-07   Gossypium raimondii
gb|KJB40135.1|  hypothetical protein B456_007G048100                  55.5    4e-07   Gossypium raimondii
ref|XP_006366567.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  55.5    4e-07   Solanum tuberosum [potatoes]
ref|XP_009381989.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  55.1    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN34300.1|  Peptidyl-prolyl cis-trans isomerase Pin1              54.7    5e-07   Glycine soja [wild soybean]
ref|XP_009413764.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  55.1    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010271418.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  55.1    6e-07   Nelumbo nucifera [Indian lotus]
emb|CDX87855.1|  BnaC06g09170D                                        57.4    6e-07   
gb|KDP46719.1|  hypothetical protein JCGZ_06507                       54.3    8e-07   Jatropha curcas
ref|XP_010033471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  54.7    8e-07   Eucalyptus grandis [rose gum]
ref|XP_002269631.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  54.3    9e-07   Vitis vinifera
gb|KCW53116.1|  hypothetical protein EUGRSUZ_J02408                   55.1    1e-06   Eucalyptus grandis [rose gum]
ref|XP_010246952.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  53.5    2e-06   Nelumbo nucifera [Indian lotus]
gb|KHG12287.1|  Peptidyl-prolyl cis-trans isomerase Pin1              54.7    2e-06   Gossypium arboreum [tree cotton]
ref|XP_001778554.1|  predicted protein                                53.1    2e-06   
ref|NP_001150505.1|  peptidyl-prolyl cis-trans isomerase 1            53.1    3e-06   Zea mays [maize]
ref|XP_002447438.1|  hypothetical protein SORBIDRAFT_06g001060        52.4    4e-06   Sorghum bicolor [broomcorn]
ref|XP_006653117.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  52.4    4e-06   Oryza brachyantha
ref|XP_001758394.1|  predicted protein                                52.0    6e-06   
ref|XP_006852979.1|  hypothetical protein AMTR_s00185p00028040        52.0    6e-06   Amborella trichopoda
ref|XP_002973323.1|  hypothetical protein SELMODRAFT_232038           52.0    6e-06   Selaginella moellendorffii
gb|EYU37912.1|  hypothetical protein MIMGU_mgv1a016491mg              51.6    8e-06   Erythranthe guttata [common monkey flower]
ref|XP_011099817.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  51.2    9e-06   Sesamum indicum [beniseed]
ref|XP_003580461.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  51.2    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_010239652.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  50.8    1e-05   
dbj|BAJ85091.1|  predicted protein                                    49.7    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975019.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  49.7    4e-05   Setaria italica
gb|EMT12276.1|  Peptidyl-prolyl cis-trans isomerase 1                 48.9    6e-05   
ref|XP_008671050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  49.7    2e-04   Zea mays [maize]
emb|CAH66008.1|  H0613H07.6                                           47.4    2e-04   Oryza sativa [red rice]
tpg|DAA35510.1|  TPA: hypothetical protein ZEAMMB73_023896            49.3    2e-04   
emb|CAE01287.2|  OSJNBa0020P07.4                                      47.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20518.1|  hypothetical protein MIMGU_mgv1a014437mg              48.1    3e-04   Erythranthe guttata [common monkey flower]
gb|EEE61853.1|  hypothetical protein OsJ_16521                        48.1    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963400.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  48.1    5e-04   
ref|XP_002489339.1|  hypothetical protein SORBIDRAFT_0010s018140      45.4    6e-04   
tpg|DAA35511.1|  TPA: hypothetical protein ZEAMMB73_023896            48.1    6e-04   
gb|EPS60265.1|  hypothetical protein M569_14540                       46.2    7e-04   Genlisea aurea



>ref|XP_004230973.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Solanum 
lycopersicum]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE RIICN             RDDI+SGKS  E V    SDCS A
Sbjct  12   LIKHEGSRRKSSWKDPEGRIICNTTRDAAASQLKSFRDDIISGKSKFEDVASRFSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>ref|XP_009611087.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Nicotiana 
tomentosiformis]
Length=118

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+ICN             RDDI+SGKS  E V    SDCS A
Sbjct  12   LIKHEGSRRKASWKDPEGRVICNTTRDAAVTQLKAFRDDIISGKSKFEDVASRFSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>emb|CAM59671.1| parvulin-type peptidyl-prolyl cis/trans isomerase [Lotus japonicus]
 gb|AFK36354.1| unknown [Lotus japonicus]
Length=122

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             R+DILSGK+N E V    SDCS A
Sbjct  16   LIKHQGSRRKASWKDPEGRVIKNTTRESAVAQLSTLREDILSGKANFEDVASRISDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_010531077.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Tarenaya 
hassleriana]
Length=119

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II +  RD           DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMSTTRDAAVEQLRSIRADIVSGKANFEEVAARVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010679861.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 40/68 (59%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             RDDILS K+N + V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGRVIMNTTKESAISQLQSIRDDILSHKANFDDVASRISDCSSA  72

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  73   KRGGDLGS  80



>ref|XP_009768326.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Nicotiana 
sylvestris]
Length=118

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I N             RDDI+SGKS  E V    SDCS A
Sbjct  12   LIKHEGSRRKASWKDPEGRVISNTTRDAAVTQLKAFRDDIISGKSKFEDVASRFSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>ref|XP_009150751.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Brassica 
rapa]
Length=119

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II    R+           DILSGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTTTREAAVEQLRSIREDILSGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|NP_179395.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arabidopsis thaliana]
 sp|Q9SL42.1|PIN1_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1; Short=PPIase 
Pin1; AltName: Full=PIN1At; AltName: Full=Rotamase Pin1 
[Arabidopsis thaliana]
 gb|AAK26028.1|AF360318_1 putative peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
 gb|AAD20122.1| putative peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
 gb|AAL07163.1| putative peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
 gb|AAL09755.1| At2g18040/T27K22.9 [Arabidopsis thaliana]
 gb|AAM61615.1| putative peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
 gb|AEC06719.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arabidopsis thaliana]
Length=119

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II    R+           DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  73   KRGGDLGS  80



>ref|XP_010548297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Tarenaya 
hassleriana]
Length=119

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE ++I +  RD           DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKVIMSTTRDAAVEQLRSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>emb|CDY25130.1| BnaC07g03770D [Brassica napus]
Length=119

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE ++I    R+           DILSGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKVIMTTTREAAAEQLKSIREDILSGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_009102286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Brassica 
rapa]
 emb|CDY38175.1| BnaA07g02080D [Brassica napus]
Length=119

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE ++I    R+           DILSGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKVIMTTTREAAVEQLKSIREDILSGKANFEDVAARVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>pdb|1J6Y|A Chain A, Solution Structure Of Pin1at From Arabidopsis Thaliana
Length=139

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 40/68 (59%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II    R+           DI+SGK+N E V    SDCS A
Sbjct  33   LIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  92

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  93   KRGGDLGS  100



>gb|ABR09055.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09056.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09057.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09058.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09059.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09060.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09061.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09062.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09063.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09064.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09065.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09066.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09067.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09068.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09069.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09070.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09071.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09072.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09073.1| PIN1, partial [Arabidopsis thaliana]
 gb|ABR09074.1| PIN1, partial [Arabidopsis thaliana]
Length=78

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_006425516.1| hypothetical protein CICLE_v10026785mg [Citrus clementina]
 ref|XP_006466930.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Citrus 
sinensis]
 gb|ESR38756.1| hypothetical protein CICLE_v10026785mg [Citrus clementina]
 gb|KDO71149.1| hypothetical protein CISIN_1g033441mg [Citrus sinensis]
Length=119

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             RDDI+SGK+  + V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGRVISNTTRESAVSQLQAIRDDIVSGKAKFDEVASRLSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_007046727.1| Peptidylprolyl cis/trans isomerase [Theobroma cacao]
 gb|EOX90884.1| Peptidylprolyl cis/trans isomerase [Theobroma cacao]
Length=183

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             RDDI+SGK+  + V    SDCS A
Sbjct  77   LIKHQGSRRKASWKDPEGRVISNTTRDAAVSQLKALRDDIVSGKAKFDEVASRYSDCSSA  136

Query  25   KRGNYL  8
            KRG  L
Sbjct  137  KRGGDL  142



>ref|XP_002884105.1| PIN1AT [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60364.1| PIN1AT [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_006359611.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Solanum 
tuberosum]
Length=118

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE RII N             RDDI+SGKS  + V    SDCS A
Sbjct  12   LIKHEGSRRKSSWKDPEGRIISNTTRDAAVSQLKSFRDDIISGKSKFKDVASRFSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>ref|XP_009341146.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Pyrus x 
bretschneideri]
 ref|XP_009341147.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Pyrus x 
bretschneideri]
Length=121

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE RII N             RDDILSGK+  + +    SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGRIIRNTTRDSAVSQLKALRDDILSGKAKFDDLAARYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_002310854.2| hypothetical protein POPTR_0007s14010g [Populus trichocarpa]
 gb|EEE91304.2| hypothetical protein POPTR_0007s14010g [Populus trichocarpa]
Length=82

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I N  RD           DI+SGK+  E V    SDCS A
Sbjct  16   LIKHEGSRRKASWKDPEGRVIKNTTRDSAISELKAIREDIVSGKAKFEDVASRISDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_006409205.1| hypothetical protein EUTSA_v10022913mg [Eutrema salsugineum]
 dbj|BAJ34365.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50658.1| hypothetical protein EUTSA_v10022913mg [Eutrema salsugineum]
Length=119

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTTTREAAVEQLKSIREDIVSGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010489500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Camelina 
sativa]
Length=119

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTITREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>emb|CDY29218.1| BnaA06g25390D [Brassica napus]
Length=119

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTTTREAAVEQLRSIREDIVSGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010467608.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Camelina 
sativa]
Length=119

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTITREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010413120.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Camelina 
sativa]
Length=119

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIITITREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_011025935.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Populus 
euphratica]
 ref|XP_011013669.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Populus 
euphratica]
Length=122

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I N  RD           DI+SGK+  E V    SDCS A
Sbjct  16   LIKHEGSRRKASWKDPEGRVIKNTTRDSAISQLKAIREDIVSGKAKFEDVASRISDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_006296744.1| hypothetical protein CARUB_v10014942mg [Capsella rubella]
 gb|EOA29642.1| hypothetical protein CARUB_v10014942mg [Capsella rubella]
Length=119

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE ++I               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKVIMTVTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>gb|KFK40181.1| hypothetical protein AALP_AA3G340900 [Arabis alpina]
Length=119

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMTITREAAVEQLKSIREDIVSGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_008452069.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Cucumis 
melo]
Length=122

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRR  +WKDPE RII N             RDDI+SGK+  E +    SDCS A
Sbjct  16   LIKHQGSRRPASWKDPEGRIIKNTTRESAVSQLTVIRDDIISGKAKFEDIATRISDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_009629157.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Nicotiana 
tomentosiformis]
Length=195

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE  +I N  +D           DI+SGK+  E V    SDCS A
Sbjct  89   LIKHQGSRRKASWKDPEGHVISNTTKDAAVSQLKSLREDIVSGKAKFEDVAATHSDCSSA  148

Query  25   KRGNYL  8
            KRG  L
Sbjct  149  KRGGDL  154



>sp|Q94G00.1|PIN1_MALDO RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1; Short=PPIase 
Pin1; AltName: Full=MdPin1; AltName: Full=Rotamase Pin1 
[Malus domestica]
 gb|AAK83088.1|AF290200_1 Pin1-type peptidyl-prolyl cis/trans isomerase [Malus domestica]
Length=121

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II N             RDDILSGK+  + +    SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGQIIRNTTRDSAVSQLKALRDDILSGKAKFDDLAARYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_008355527.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Malus domestica]
 ref|XP_008355528.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Malus domestica]
Length=121

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II N             RDDILSGK+  + +    SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGQIIRNTTRDSAVSQLKALRDDILSGKAKFDDLAARYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_010920237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Elaeis 
guineensis]
Length=119

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ RIIC              RDDIL GK   E V    SDCS A
Sbjct  13   LIKHEGSRRKASWKDPDGRIICATTRDAAVRQIRALRDDILDGKVRFEDVAARHSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|NP_001236944.1| uncharacterized protein LOC100499854 [Glycine max]
 gb|ACU13912.1| unknown [Glycine max]
Length=126

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE RII               RDDI+SGK+  E +    SDCS A
Sbjct  20   LIKHEGSRRKASWKDPEGRIIKSTTRENAVSQLKALRDDIVSGKATFEDIASRFSDCSSA  79

Query  25   KRGNYL  8
            KRG  L
Sbjct  80   KRGGDL  85



>ref|XP_011088541.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Sesamum 
indicum]
Length=119

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXR-----------DDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R I +  R           DDILSGKS  E +    SDCS A
Sbjct  13   LIKHEGSRRKSSWKDPEGRRISSTTRGQAVAQLKTIRDDILSGKSRFEDIASQFSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>emb|CDP01913.1| unnamed protein product [Coffea canephora]
Length=123

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE +II N  RD           DI+S K+  E V    SDCS A
Sbjct  17   LIKHEGSRRKASWKDPEGQIISNTTRDAAVSQLIALRQDIVSAKAKFEDVAARYSDCSSA  76

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  77   KRGGDLGS  84



>ref|XP_004146507.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Cucumis 
sativus]
 ref|XP_004160967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Cucumis 
sativus]
 gb|KGN53316.1| hypothetical protein Csa_4G046790 [Cucumis sativus]
Length=122

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRR  +WKDPE RII N  R+           DI+SGK+  E +    SDCS A
Sbjct  16   LIKHQGSRRPASWKDPEGRIIKNTTRESAVSQLTVIRNDIISGKAKFEDIATRISDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_004303637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Fragaria 
vesca subsp. vesca]
Length=119

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDP+  +I N  RD           DI+SGKS  + V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPDGLVISNTTRDAAVTQLKSLREDIVSGKSTFDQVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_009789724.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Nicotiana 
sylvestris]
Length=123

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE  +I N  +D           DI+SGK+  + V    SDCS A
Sbjct  17   LIKHRGSRRKASWKDPEGHVISNTTKDAAVSQLKSLREDIVSGKAKFDDVAATHSDCSSA  76

Query  25   KRGNYL  8
            KRG  L
Sbjct  77   KRGGDL  82



>ref|XP_008785114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Phoenix 
dactylifera]
Length=119

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ RII            +  RDDIL+GK   E V    SDCS A
Sbjct  13   LIKHEGSRRKASWKDPDGRIISATTRDAAVRQLHALRDDILAGKVRFEDVAARHSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010113370.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Morus notabilis]
 gb|EXC35377.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Morus notabilis]
Length=403

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             RDDI+SGK+  + V    SDCS A
Sbjct  297  LIKHQGSRRKASWKDPEGRVISNTTRDAAVSQLKSLRDDIVSGKAKFDAVASRYSDCSSA  356

Query  25   KRGNYL  8
            KRG  L
Sbjct  357  KRGGDL  362



>ref|XP_007225834.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica]
 ref|XP_007225835.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica]
 gb|EMJ27033.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica]
 gb|EMJ27034.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica]
Length=121

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXR-----------DDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE  II N  R           DDI+SGK+  + +    SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGAIIKNTTRDSAVSQLKALHDDIISGKAKFDDLASRYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_008807602.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Phoenix 
dactylifera]
Length=119

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ RII               RDDI++GK+  E V    SDCS A
Sbjct  13   LIKHEGSRRKASWKDPDGRIISATTRDAAVRQLRALRDDIIAGKARFEDVAARHSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_008222450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume]
 ref|XP_008222451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume]
Length=121

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXR-----------DDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE  II N  R           DDI+SGK+  + +    SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGAIIKNTTRDSAVSQLKGLHDDIISGKAKFDDLASRYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_010934204.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Elaeis 
guineensis]
Length=119

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ RII    RD           DIL+GK   E V    SDCS A
Sbjct  13   LIKHEGSRRKASWKDPDGRIISATTRDAAVRQLRGHREDILAGKVRFEDVAARHSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_004509352.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Cicer 
arietinum]
Length=124

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE  +I N  RD           DI+SGK+  E +    SDCS A
Sbjct  18   LIKHEGSRRKASWKDPEGYVIKNTSRDSAVAILKAMQNDIVSGKATFEDIASRYSDCSSA  77

Query  25   KRGNYL  8
            KRG  L
Sbjct  78   KRGGDL  83



>emb|CDY20906.1| BnaC06g01260D [Brassica napus]
Length=119

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+ GK+N E V    SDCS A
Sbjct  13   LIKHQGSRRKASWKDPEGKIIMATTREAAVEQLRSIREDIVCGKANFEDVATRVSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>gb|KJB70968.1| hypothetical protein B456_011G099300 [Gossypium raimondii]
Length=206

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I N             RDDI SG +    V    SDCS A
Sbjct  100  LIKHQGSRRKASWKDPEGRVISNTTRDAAVSQLKALRDDIASGNAKFGEVASRHSDCSSA  159

Query  25   KRGNYL  8
            KRG  L
Sbjct  160  KRGGDL  165



>ref|XP_008377945.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Malus domestica]
 ref|XP_008377946.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Malus domestica]
 ref|XP_008347594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Malus domestica]
Length=121

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II N             RD+ILSGK+  +      SDCS A
Sbjct  15   LIKHQGSRRKASWKDPEGQIIRNTTQDSAVSQLKALRDEILSGKAKFDDXASRYSDCSSA  74

Query  25   KRGNYL  8
            KRG  L
Sbjct  75   KRGGDL  80



>ref|XP_007156126.1| hypothetical protein PHAVU_003G260800g [Phaseolus vulgaris]
 gb|ESW28120.1| hypothetical protein PHAVU_003G260800g [Phaseolus vulgaris]
Length=122

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE RII               RDDI+SGK+  E V    SDC+ +
Sbjct  16   LIKHEGSRRKASWKDPEGRIIKSTTREAAVSQLKALRDDIVSGKATFEDVASRFSDCNSS  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_003629341.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Medicago truncatula]
 gb|AET03817.1| peptidylprolyl cis/trans isomerase, NIMA-interacting protein 
[Medicago truncatula]
 gb|AFK49053.1| unknown [Medicago truncatula]
Length=122

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXR-----------DDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE  +I N  R           +DIL+GK+  E +    SDCS A
Sbjct  16   LIKHEGSRRKASWKDPEGYVIKNTTRESAVAILTSMKEDILTGKAKFEDLASRYSDCSSA  75

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  76   KRGGDLGS  83



>ref|XP_004233552.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Solanum 
lycopersicum]
Length=127

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 38/68 (56%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K Q SRRK +WKDPE R+I N             R+DI+SGK+  + +    S CS A
Sbjct  21   LIKHQESRRKFSWKDPEGRVISNTTKEAAVSQLKSIREDIVSGKAKFQDIAATHSHCSSA  80

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  81   KRGGDLGS  88



>gb|KHG27749.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium arboreum]
Length=122

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I               RDDI+S K+  + V    SDCS A
Sbjct  16   LIKHQGSRRKASWKDPEGRVISTTTRDAAVSQLKLLRDDIVSNKAKFDEVASRYSDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>gb|KJB40134.1| hypothetical protein B456_007G048100 [Gossypium raimondii]
Length=92

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I    RD           DI+S K+  + V    SDCS A
Sbjct  16   LIKHQGSRRKASWKDPEGRVISTTTRDAAVSQLKLLRGDIVSNKAKFDEVASRYSDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>gb|KJB40135.1| hypothetical protein B456_007G048100 [Gossypium raimondii]
Length=122

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I    RD           DI+S K+  + V    SDCS A
Sbjct  16   LIKHQGSRRKASWKDPEGRVISTTTRDAAVSQLKLLRGDIVSNKAKFDEVASRYSDCSSA  75

Query  25   KRGNYL  8
            KRG  L
Sbjct  76   KRGGDL  81



>ref|XP_006366567.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Solanum 
tuberosum]
Length=127

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 38/68 (56%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K Q SRRK +WKDPE R+I N             R+DI+SGK+  + +    S CS A
Sbjct  21   LIKHQESRRKFSWKDPEGRVISNTTKEAAVSQLKSIREDIVSGKAKFQDIAATHSHCSSA  80

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  81   KRGGDLGS  88



>ref|XP_009381989.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R+I               RDDI SGK+  + V    SDCS A
Sbjct  12   LIKHEGSRRKASWKDPDGRVISATTRDAAVRQLLTLRDDIDSGKARFQDVAVLHSDCSSA  71

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  72   KRGGDLGS  79



>gb|KHN34300.1| Peptidyl-prolyl cis-trans isomerase Pin1, partial [Glycine soja]
Length=104

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 11/62 (18%)
 Frame = -3

Query  160  QGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXAKRGN  14
            +GSRRK +WKDPE RII               RDDI+SGK++ E +    SDCS AKRG 
Sbjct  2    EGSRRKASWKDPEGRIIKSTTRENAVSQLKALRDDIVSGKASFEDIASRFSDCSSAKRGG  61

Query  13   YL  8
             L
Sbjct  62   DL  63



>ref|XP_009413764.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R+I    RD           DI+SGK+  + V    SDCS A
Sbjct  12   LIKHEGSRRKASWKDPDGRVISATTRDAAVGQLLTLREDIVSGKARFQDVAARYSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>ref|XP_010271418.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Nelumbo 
nucifera]
Length=118

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE  +I    RD           DI++GK+  E V    SDCS A
Sbjct  12   LIKHQGSRRKASWKDPEGDVIRKTTRDSAVSQLKSLREDIITGKAKFEDVASRYSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>emb|CDX87855.1| BnaC06g09170D [Brassica napus]
Length=374

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE +II               R+DI+SGK+  E V    SDCS A
Sbjct  267  LIKHQGSRRKASWKDPEGKIIMTTTREAAVEQLKSIREDIVSGKATFEDVAARVSDCSSA  326

Query  25   KRGNYL  8
            KRG  L
Sbjct  327  KRGGDL  332



>gb|KDP46719.1| hypothetical protein JCGZ_06507 [Jatropha curcas]
Length=119

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I N             R+DI+ GK+  E +    SDCS A
Sbjct  13   LIKHEGSRRKASWKDPEGRVIKNTTRETAVSQLKAFREDIVCGKAKFEDIASRFSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_010033471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Eucalyptus 
grandis]
Length=127

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               R+DI++GK+  E +    SDCS A
Sbjct  21   LIKHEGSRRKASWKDPEGRVIRSTTRESAVSQLKALREDIVAGKAKFEDLASRFSDCSSA  80

Query  25   KRGNYL  8
            KRG  L
Sbjct  81   KRGGDL  86



>ref|XP_002269631.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Vitis vinifera]
 emb|CBI17392.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K Q SRRK +W+DPE R+I               RDDI+SGKS    V    SDCS A
Sbjct  12   LIKHQDSRRKASWRDPEGRVIKATTKESAVTQIKAIRDDIISGKSKFSDVASQISDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>gb|KCW53116.1| hypothetical protein EUGRSUZ_J02408, partial [Eucalyptus grandis]
Length=189

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               R+DI++GK+  E +    SDCS A
Sbjct  83   LIKHEGSRRKASWKDPEGRVIRSTTRESAVSQLKALREDIVAGKAKFEDLASRFSDCSSA  142

Query  25   KRGNYL  8
            KRG  L
Sbjct  143  KRGGDL  148



>ref|XP_010246952.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Nelumbo 
nucifera]
Length=118

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRR+ +WKDP+  +I N             R+DI++GK+  E V    SDCS A
Sbjct  12   LIKHQGSRRQASWKDPDGHVIKNTTRETAVNQLKSLREDIVAGKAKFEDVASRYSDCSSA  71

Query  25   KRGNYL  8
            KRG  L
Sbjct  72   KRGGDL  77



>gb|KHG12287.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium arboreum]
Length=210

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDPE R+I +             RDDI SG +    V    SDCS A
Sbjct  104  LIKHQGSRRKASWKDPEGRVISSTTRDAAVSQLKALRDDITSGNAKFGEVASRHSDCSSA  163

Query  25   KRGNYL  8
            KRG  L
Sbjct  164  KRGGDL  169



>ref|XP_001778554.1| predicted protein [Physcomitrella patens]
 gb|EDQ56584.1| predicted protein [Physcomitrella patens]
Length=119

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 35/66 (53%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            +VK QGSRR  +WKDPE +II    RD           DI SGKS    +    SDCS A
Sbjct  13   LVKHQGSRRPASWKDPEGKIIQKTTRDDAVAQLQQFKSDIESGKSTLADLASKNSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|NP_001150505.1| peptidyl-prolyl cis-trans isomerase 1 [Zea mays]
 gb|ACG39308.1| peptidyl-prolyl cis-trans isomerase 1 [Zea mays]
 gb|AFW57893.1| peptidyl-prolyl cis-trans isomerase 1 [Zea mays]
Length=124

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ RII    R D           ILSG++N   +    SDCS A
Sbjct  18   LIKHEGSRRKASWKDPDGRIISATTRGDAAARLLDLRNQILSGQANFADLAARHSDCSSA  77

Query  25   KRGNYL  8
            +RG  L
Sbjct  78   RRGGDL  83



>ref|XP_002447438.1| hypothetical protein SORBIDRAFT_06g001060 [Sorghum bicolor]
 gb|EES11766.1| hypothetical protein SORBIDRAFT_06g001060 [Sorghum bicolor]
Length=124

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDP+ RII               R+ ILSG++N   +    SDCS A
Sbjct  18   LIKHQGSRRKASWKDPDGRIISATTRADAAARLLDLRNQILSGQANFADLAARHSDCSSA  77

Query  25   KRGNYL  8
            +RG  L
Sbjct  78   RRGGDL  83



>ref|XP_006653117.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Oryza 
brachyantha]
Length=121

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            +VK +GSRRK +WKDP+ R+I               RD ILSG+++   +    SDCS A
Sbjct  15   LVKHEGSRRKASWKDPDGRVISATSRADAAARLAEFRDQILSGRASFADIAARHSDCSSA  74

Query  25   KRGNYL  8
            +RG  L
Sbjct  75   RRGGDL  80



>ref|XP_001758394.1| predicted protein [Physcomitrella patens]
 gb|EDQ76796.1| predicted protein [Physcomitrella patens]
Length=119

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            +VK QGSRR  +WKDPE RII    RD           DI SG++    +    SDCS A
Sbjct  13   LVKHQGSRRPASWKDPEGRIIRKTTRDDAVAKLMQFKSDIESGRATLADLATQNSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_006852979.1| hypothetical protein AMTR_s00185p00028040 [Amborella trichopoda]
 gb|ERN14446.1| hypothetical protein AMTR_s00185p00028040 [Amborella trichopoda]
Length=117

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRR  +WKDPE ++I N             R++I+SG+S    +    SDCS A
Sbjct  11   LIKHQGSRRTASWKDPEGKVIQNTTKEAAIAQLKALREEIVSGRSKFSDIASRYSDCSSA  70

Query  25   KRGNYL  8
            KRG  L
Sbjct  71   KRGGDL  76



>ref|XP_002973323.1| hypothetical protein SELMODRAFT_232038 [Selaginella moellendorffii]
 ref|XP_002976583.1| hypothetical protein SELMODRAFT_105619 [Selaginella moellendorffii]
 gb|EFJ22252.1| hypothetical protein SELMODRAFT_105619 [Selaginella moellendorffii]
 gb|EFJ25697.1| hypothetical protein SELMODRAFT_232038 [Selaginella moellendorffii]
Length=123

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            +VK QGSRR  +W+DPE  +I N             RD+ILSG++    +    SDCS A
Sbjct  17   LVKHQGSRRPASWRDPEGLVIQNTTHEQAVAKLEHIRDEILSGRAKFSDLATQLSDCSSA  76

Query  25   KRGNYL  8
            KRG  L
Sbjct  77   KRGGDL  82



>gb|EYU37912.1| hypothetical protein MIMGU_mgv1a016491mg [Erythranthe guttata]
Length=119

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R I               RDDI++GK+  + V    SDCS A
Sbjct  13   LIKHEGSRRKSSWKDPDGRRISATTRDSAVAQLKTFRDDIIAGKTRFDDVASRFSDCSSA  72

Query  25   KRGNYL  8
            KRG  L
Sbjct  73   KRGGDL  78



>ref|XP_011099817.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Sesamum 
indicum]
Length=119

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDP+ R+I    R+           DILSG ++ + +    S CS A
Sbjct  13   LIKHQGSRRKSSWKDPDGRVISATTREEAVAQLQALRCDILSGDASFKDLASQNSHCSSA  72

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  73   KRGGDLGS  80



>ref|XP_003580461.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like isoform 
X1 [Brachypodium distachyon]
Length=128

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               RD IL+G ++   +    SDCS A
Sbjct  22   LIKHEGSRRKSSWKDPEGRVISATTRADAAARLGGLRDQILAGGASFADIAAQHSDCSSA  81

Query  25   KRGNYL  8
            +RG  L
Sbjct  82   RRGGDL  87



>ref|XP_010239652.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like isoform 
X2 [Brachypodium distachyon]
Length=111

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               RD IL+G ++   +    SDCS A
Sbjct  22   LIKHEGSRRKSSWKDPEGRVISATTRADAAARLGGLRDQILAGGASFADIAAQHSDCSSA  81

Query  25   KRGNYL  8
            +RG  L
Sbjct  82   RRGGDL  87



>dbj|BAJ85091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=124

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               R  IL+G+++   +    SDCS A
Sbjct  18   LIKHEGSRRKASWKDPEGRVISATTRADAAARLGELRSQILAGRASFADLAAQHSDCSSA  77

Query  25   KRGNYL  8
            +RG  L
Sbjct  78   RRGGDL  83



>ref|XP_004975019.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Setaria 
italica]
Length=124

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXX-----------RDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R+I               R+ IL+G++N   +    SDCS A
Sbjct  18   LIKHEGSRRKASWKDPDGRVISATTRADAAARLLDLRNQILAGQANFADLAARHSDCSSA  77

Query  25   KRGNYL  8
            +RG  L
Sbjct  78   RRGGDL  83



>gb|EMT12276.1| Peptidyl-prolyl cis-trans isomerase 1 [Aegilops tauschii]
Length=121

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRII-----------CNXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDPE R+I               R  IL+G+++   +    SDCS A
Sbjct  15   LIKHEGSRRKASWKDPEGRVISATTRADAAARLGDLRAQILAGRASFADLAAQHSDCSSA  74

Query  25   KRGNYL  8
            +RG  L
Sbjct  75   RRGGDL  80



>ref|XP_008671050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase NIMA-interacting 
1-like [Zea mays]
Length=256

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 35/68 (51%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +W+DPE   I    RDD           I+SG    E V    SDCS A
Sbjct  150  LIKHEGSRRKASWRDPEGVAISATTRDDAADLARALRDQIVSGDREFEDVAAENSDCSSA  209

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  210  KRGGDLGS  217



>emb|CAH66008.1| H0613H07.6 [Oryza sativa Indica Group]
 emb|CAH65943.1| H0716A07.1 [Oryza sativa Indica Group]
Length=123

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIIC-----------NXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R+I               RD ILSG++N   +    SDCS A
Sbjct  17   LIKHEGSRRKASWKDPDGRVISATTRADAAARLADLRDQILSGRANFADLAARHSDCSSA  76

Query  25   KRGNYL  8
            +RG  L
Sbjct  77   RRGGDL  82



>tpg|DAA35510.1| TPA: hypothetical protein ZEAMMB73_023896 [Zea mays]
Length=276

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 35/68 (51%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +W+DPE   I    RDD           I+SG    E V    SDCS A
Sbjct  170  LIKHEGSRRKASWRDPEGVAISATTRDDAADLARALRDQIVSGDREFEDVAAENSDCSSA  229

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  230  KRGGDLGS  237



>emb|CAE01287.2| OSJNBa0020P07.4 [Oryza sativa Japonica Group]
 gb|EAZ29504.1| hypothetical protein OsJ_13578 [Oryza sativa Japonica Group]
Length=123

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIIC-----------NXXRDDILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +WKDP+ R+I               RD ILSG++N   +    SDCS A
Sbjct  17   LIKHEGSRRKASWKDPDGRVISATTRADAAARLADLRDQILSGRANFADLAARHSDCSSA  76

Query  25   KRGNYL  8
            +RG  L
Sbjct  77   RRGGDL  82



>gb|EYU20518.1| hypothetical protein MIMGU_mgv1a014437mg [Erythranthe guttata]
Length=189

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRD-----------DILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDP+ R+I    R+           DI SG ++ + +    S CS A
Sbjct  83   LIKHQGSRRKSSWKDPDGRVISATTREEAVSQLQDLRRDIQSGDASFKDLAAKHSHCSSA  142

Query  25   KRGNYL  8
            KRG  L
Sbjct  143  KRGGDL  148



>gb|EEE61853.1| hypothetical protein OsJ_16521 [Oryza sativa Japonica Group]
Length=200

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +W+DPE   I    RDD           I++G+   E V    SDC+ A
Sbjct  94   LIKHEGSRRKASWRDPEGVAISATTRDDAADLARALREKIVAGERKFEDVATEESDCNSA  153

Query  25   KRGNYL  8
            KRG  L
Sbjct  154  KRGGDL  159



>ref|XP_004963400.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Setaria 
italica]
Length=211

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 35/68 (51%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +W+DPE   I    RDD           I+SG    E +    SDC+ A
Sbjct  105  LIKHEGSRRKASWRDPEGVAISATTRDDAADLARALREQIVSGDRKFEDIAAENSDCNSA  164

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  165  KRGGDLGS  172



>ref|XP_002489339.1| hypothetical protein SORBIDRAFT_0010s018140 [Sorghum bicolor]
 gb|EES20132.1| hypothetical protein SORBIDRAFT_0010s018140 [Sorghum bicolor]
Length=73

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -3

Query  160  QGSRRKXTWKDPEXRIICNXXRDD--ILSGKSNXEXVIXCXSDCSXAKRGNYLT  5
            +GSRRK +WKDP+  II    R D  ILSG ++   +    SDCS A+RG  L 
Sbjct  2    KGSRRKASWKDPDGGIISATMRADTAILSGDASFADLAARHSDCSSARRGGDLA  55



>tpg|DAA35511.1| TPA: hypothetical protein ZEAMMB73_023896 [Zea mays]
Length=256

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 34/66 (52%), Gaps = 11/66 (17%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K +GSRRK +W+DPE   I    RDD           I+SG    E V    SDCS A
Sbjct  170  LIKHEGSRRKASWRDPEGVAISATTRDDAADLARALRDQIVSGDREFEDVAAENSDCSSA  229

Query  25   KRGNYL  8
            KRG  L
Sbjct  230  KRGGDL  235



>gb|EPS60265.1| hypothetical protein M569_14540, partial [Genlisea aurea]
Length=117

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 37/68 (54%), Gaps = 11/68 (16%)
 Frame = -3

Query  172  VVKXQGSRRKXTWKDPEXRIICNXXRDD-----------ILSGKSNXEXVIXCXSDCSXA  26
            ++K QGSRRK +WKDP+  +I +   +D           I+SG ++ + +    S CS A
Sbjct  11   LIKHQGSRRKSSWKDPDGALISSTTLEDAVSQLRDLRSQIVSGDASFQDLASKHSHCSSA  70

Query  25   KRGNYLTS  2
            KRG  L S
Sbjct  71   KRGGDLGS  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965