BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029M22

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355233.1|  PREDICTED: threonine--tRNA ligase, mitochond...    400   2e-132   Solanum tuberosum [potatoes]
ref|XP_009622103.1|  PREDICTED: threonine--tRNA ligase, mitochond...    394   1e-129   Nicotiana tomentosiformis
ref|XP_004246064.1|  PREDICTED: threonine--tRNA ligase, mitochond...    393   2e-129   Solanum lycopersicum
ref|XP_009794575.1|  PREDICTED: threonine--tRNA ligase, mitochond...    393   7e-129   Nicotiana sylvestris
ref|XP_004170956.1|  PREDICTED: threonine--tRNA ligase, mitochond...    370   1e-125   
ref|XP_006355966.1|  PREDICTED: threonine--tRNA ligase, mitochond...    384   2e-125   Solanum tuberosum [potatoes]
gb|KGN49712.1|  hypothetical protein Csa_5G080780                       370   2e-125   Cucumis sativus [cucumbers]
ref|XP_004238685.1|  PREDICTED: threonine--tRNA ligase, mitochond...    383   5e-125   Solanum lycopersicum
gb|KDO82534.1|  hypothetical protein CISIN_1g0066801mg                  366   5e-124   Citrus sinensis [apfelsine]
ref|XP_010274327.1|  PREDICTED: threonine--tRNA ligase, mitochond...    379   2e-123   Nelumbo nucifera [Indian lotus]
ref|XP_006438443.1|  hypothetical protein CICLE_v100308251mg            365   3e-123   
gb|EPS72288.1|  hypothetical protein M569_02470                         377   4e-123   Genlisea aurea
ref|XP_011076219.1|  PREDICTED: threonine--tRNA ligase, mitochond...    377   6e-123   Sesamum indicum [beniseed]
ref|XP_010272819.1|  PREDICTED: threonine--tRNA ligase, mitochond...    376   2e-122   Nelumbo nucifera [Indian lotus]
ref|XP_008460557.1|  PREDICTED: threonine--tRNA ligase, mitochond...    371   2e-120   Cucumis melo [Oriental melon]
emb|CDP00192.1|  unnamed protein product                                370   5e-120   Coffea canephora [robusta coffee]
ref|XP_004142299.1|  PREDICTED: threonine--tRNA ligase, mitochond...    369   1e-119   Cucumis sativus [cucumbers]
gb|ADE77216.1|  unknown                                                 352   1e-119   Picea sitchensis
ref|XP_002265302.1|  PREDICTED: threonine--tRNA ligase, mitochond...    367   3e-119   Vitis vinifera
ref|XP_010644571.1|  PREDICTED: threonine--tRNA ligase, mitochond...    365   2e-118   Vitis vinifera
gb|EYU25062.1|  hypothetical protein MIMGU_mgv1a002240mg                364   3e-118   Erythranthe guttata [common monkey flower]
ref|XP_010100498.1|  Threonine--tRNA ligase                             362   7e-118   
ref|XP_006483810.1|  PREDICTED: threonine--tRNA ligase, mitochond...    364   7e-118   Citrus sinensis [apfelsine]
ref|XP_003613276.1|  Threonyl-tRNA synthetase                           363   2e-117   Medicago truncatula
gb|KHN12091.1|  Threonine--tRNA ligase, mitochondrial                   358   8e-117   Glycine soja [wild soybean]
ref|XP_004489863.1|  PREDICTED: threonine--tRNA ligase, mitochond...    361   8e-117   Cicer arietinum [garbanzo]
ref|XP_003519592.1|  PREDICTED: threonine--tRNA ligase, mitochond...    359   4e-116   Glycine max [soybeans]
ref|XP_006346202.1|  PREDICTED: threonine--tRNA ligase, mitochond...    350   4e-116   Solanum tuberosum [potatoes]
ref|XP_010533069.1|  PREDICTED: threonine--tRNA ligase, mitochond...    359   5e-116   Tarenaya hassleriana [spider flower]
gb|KDO82533.1|  hypothetical protein CISIN_1g0066801mg                  347   5e-116   Citrus sinensis [apfelsine]
gb|KHN00337.1|  Threonine--tRNA ligase, mitochondrial                   358   1e-115   Glycine soja [wild soybean]
ref|XP_003517788.1|  PREDICTED: threonine--tRNA ligase, mitochond...    358   2e-115   Glycine max [soybeans]
ref|XP_007157476.1|  hypothetical protein PHAVU_002G072800g             358   2e-115   Phaseolus vulgaris [French bean]
ref|XP_009412586.1|  PREDICTED: threonine--tRNA ligase, mitochond...    358   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836673.1|  hypothetical protein AMTR_s00088p00069780          358   2e-115   
ref|XP_004296467.2|  PREDICTED: threonine--tRNA ligase, mitochond...    358   3e-115   Fragaria vesca subsp. vesca
gb|KDP21323.1|  hypothetical protein JCGZ_21794                         356   4e-115   Jatropha curcas
ref|XP_009360487.1|  PREDICTED: threonine--tRNA ligase, mitochond...    355   9e-115   Pyrus x bretschneideri [bai li]
ref|XP_010913364.1|  PREDICTED: threonine--tRNA ligase, mitochond...    355   2e-114   Elaeis guineensis
ref|XP_002311580.2|  Threonyl-tRNA synthetase family protein            355   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_008340003.1|  PREDICTED: threonine--tRNA ligase, mitochond...    353   5e-114   
ref|XP_011025470.1|  PREDICTED: threonine--tRNA ligase, mitochond...    354   6e-114   Populus euphratica
ref|XP_010551550.1|  PREDICTED: threonine--tRNA ligase, mitochond...    353   8e-114   Tarenaya hassleriana [spider flower]
ref|XP_008361801.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    354   9e-114   
ref|XP_006378416.1|  Threonyl-tRNA synthetase family protein            353   1e-113   
gb|KJB48103.1|  hypothetical protein B456_008G053600                    348   1e-113   Gossypium raimondii
gb|EEC83306.1|  hypothetical protein OsI_28675                          338   4e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_007225203.1|  hypothetical protein PRUPE_ppa002055mg             351   8e-113   Prunus persica
ref|XP_008802022.1|  PREDICTED: threonine--tRNA ligase, mitochond...    351   1e-112   Phoenix dactylifera
ref|XP_008221771.1|  PREDICTED: threonine--tRNA ligase, mitochond...    351   1e-112   Prunus mume [ume]
ref|XP_009599596.1|  PREDICTED: threonine--tRNA ligase, mitochond...    339   8e-112   Nicotiana tomentosiformis
gb|KJB48102.1|  hypothetical protein B456_008G053600                    347   2e-111   Gossypium raimondii
ref|XP_010688668.1|  PREDICTED: threonine--tRNA ligase, mitochond...    345   8e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007044584.1|  Threonyl-tRNA synthetase isoform 3                 345   8e-111   
ref|XP_007044582.1|  Threonyl-tRNA synthetase isoform 1                 345   1e-110   
emb|CAC79651.1|  threonyl-tRNA synthetase                               337   3e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011021655.1|  PREDICTED: threonine--tRNA ligase, mitochond...    340   6e-109   Populus euphratica
gb|EEE68426.1|  hypothetical protein OsJ_26793                          339   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659275.1|  PREDICTED: threonine--tRNA ligase, mitochond...    338   3e-108   Oryza brachyantha
ref|NP_001061475.1|  Os08g0295300                                       340   3e-108   
dbj|BAI39857.1|  putative threonyl-tRNA synthetase                      340   4e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_004510448.1|  PREDICTED: threonine--tRNA ligase, mitochond...    330   7e-108   
ref|XP_010044651.1|  PREDICTED: threonine--tRNA ligase, mitochond...    338   2e-107   Eucalyptus grandis [rose gum]
ref|XP_004973168.1|  PREDICTED: threonine--tRNA ligase, mitochond...    334   5e-106   Setaria italica
ref|XP_006394912.1|  hypothetical protein EUTSA_v10003725mg             333   8e-106   Eutrema salsugineum [saltwater cress]
dbj|BAJ93554.1|  predicted protein                                      330   1e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX80596.1|  BnaC07g28480D                                          330   1e-104   
ref|XP_009151164.1|  PREDICTED: threonine--tRNA ligase, mitochond...    330   2e-104   Brassica rapa
ref|XP_004500860.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   2e-104   Cicer arietinum [garbanzo]
ref|XP_009111770.1|  PREDICTED: threonine--tRNA ligase, mitochond...    329   2e-104   Brassica rapa
gb|KFK26446.1|  hypothetical protein AALP_AA8G249500                    328   3e-104   Arabis alpina [alpine rockcress]
ref|XP_004968434.1|  PREDICTED: threonine--tRNA ligase, mitochond...    329   5e-104   Setaria italica
emb|CDX87030.1|  BnaC09g03450D                                          327   2e-103   
ref|XP_002464119.1|  hypothetical protein SORBIDRAFT_01g012680          327   2e-103   Sorghum bicolor [broomcorn]
ref|XP_008664856.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    327   2e-103   Zea mays [maize]
ref|XP_003573669.1|  PREDICTED: threonine--tRNA ligase, mitochond...    327   2e-103   Brachypodium distachyon [annual false brome]
gb|AAK82468.1|  AT5g26830/F2P16_90                                      325   3e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDM81189.1|  unnamed protein product                                326   3e-103   Triticum aestivum [Canadian hard winter wheat]
ref|NP_198035.2|  threonyl-tRNA synthetase                              325   6e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74705.1|  threonyl-tRNA synthetase                               325   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872240.1|  AT5g26830/F2P16_90                                 324   2e-102   Arabidopsis lyrata subsp. lyrata
ref|XP_002521030.1|  threonyl-tRNA synthetase, putative                 323   2e-102   
ref|XP_006289423.1|  hypothetical protein CARUB_v10002922mg             323   3e-102   Capsella rubella
ref|XP_008644625.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   5e-102   
ref|XP_010027611.1|  PREDICTED: threonine--tRNA ligase, mitochond...    313   2e-101   
ref|XP_010027610.1|  PREDICTED: threonine--tRNA ligase, mitochond...    313   3e-101   Eucalyptus grandis [rose gum]
gb|KCW54156.1|  hypothetical protein EUGRSUZ_I00127                     312   7e-101   Eucalyptus grandis [rose gum]
ref|XP_008237148.1|  PREDICTED: threonine--tRNA ligase, mitochond...    318   1e-100   
ref|XP_010493938.1|  PREDICTED: threonine--tRNA ligase, mitochond...    319   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010027608.1|  PREDICTED: threonine--tRNA ligase, mitochond...    312   4e-100   Eucalyptus grandis [rose gum]
ref|XP_007199721.1|  hypothetical protein PRUPE_ppa002288mg             317   5e-100   Prunus persica
ref|XP_010455043.1|  PREDICTED: threonine--tRNA ligase, mitochond...    317   8e-100   Camelina sativa [gold-of-pleasure]
gb|AAB61048.1|  Similar to threonyl-tRNA synthetase; coded for by...    316   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007200687.1|  hypothetical protein PRUPE_ppa017189mg             315   3e-99    Prunus persica
ref|XP_001784310.1|  predicted protein                                  315   3e-99    
gb|EMT11254.1|  Threonyl-tRNA synthetase, mitochondrial                 317   6e-97    
gb|KDO82535.1|  hypothetical protein CISIN_1g0066801mg                  295   1e-96    Citrus sinensis [apfelsine]
emb|CDY19754.1|  BnaA09g04070D                                          303   1e-95    Brassica napus [oilseed rape]
ref|XP_010497266.1|  PREDICTED: probable threonine--tRNA ligase, ...    291   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010476961.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    290   3e-92    Camelina sativa [gold-of-pleasure]
gb|EMS59266.1|  Threonyl-tRNA synthetase, mitochondrial                 303   5e-92    Triticum urartu
ref|XP_002890262.1|  hypothetical protein ARALYDRAFT_889225             291   6e-91    
ref|XP_002989766.1|  hypothetical protein SELMODRAFT_447798             290   1e-90    
ref|XP_006303967.1|  hypothetical protein CARUB_v10008857mg             286   9e-90    
ref|XP_002892976.1|  hypothetical protein ARALYDRAFT_472010             283   1e-89    
ref|XP_010480524.1|  PREDICTED: probable threonine--tRNA ligase, ...    284   2e-87    
ref|XP_004304268.2|  PREDICTED: threonine--tRNA ligase, mitochond...    286   2e-87    Fragaria vesca subsp. vesca
ref|XP_006303165.1|  hypothetical protein CARUB_v10008521mg             283   4e-87    Capsella rubella
emb|CDY21715.1|  BnaA09g44660D                                          280   2e-86    Brassica napus [oilseed rape]
ref|XP_009117622.1|  PREDICTED: threonine--tRNA ligase, mitochond...    279   5e-86    Brassica rapa
ref|XP_001696198.1|  hypothetical protein CHLREDRAFT_167047             276   2e-84    Chlamydomonas reinhardtii
ref|XP_002946221.1|  hypothetical protein VOLCADRAFT_102823             274   1e-83    Volvox carteri f. nagariensis
ref|XP_005844334.1|  hypothetical protein CHLNCDRAFT_49107              270   6e-83    Chlorella variabilis
ref|XP_007044585.1|  Threonyl-tRNA synthetase isoform 4                 270   2e-82    
ref|XP_007044583.1|  Threonyl-tRNA synthetase isoform 2                 270   2e-82    
ref|XP_002989765.1|  hypothetical protein SELMODRAFT_130418             269   6e-82    
dbj|BAN16553.1|  ADB6244                                                260   7e-82    Acytostelium subglobosum
ref|NP_173238.1|  threonyl-tRNA synthetase                              263   8e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991732.1|  hypothetical protein SELMODRAFT_134156             268   1e-81    
ref|XP_007514880.1|  threonyl-tRNA synthetase                           268   5e-81    Bathycoccus prasinos
ref|XP_004933460.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    267   1e-80    Bombyx mori [silk moth]
ref|XP_003080220.1|  putative threonyl-tRNA synthetase (ISS)            266   1e-80    
ref|XP_005648591.1|  threonyl-tRNA synthetase                           268   2e-80    Coccomyxa subellipsoidea C-169
ref|XP_004933459.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    266   2e-80    Bombyx mori [silk moth]
emb|CEF98631.1|  Anticodon-binding                                      266   2e-80    Ostreococcus tauri
ref|XP_006071988.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   4e-80    
ref|XP_002677200.1|  threonyl-tRNA synthetase                           264   1e-79    Naegleria gruberi strain NEG-M
ref|XP_004182642.1|  hypothetical protein TBLA_0J01260                  265   2e-79    Tetrapisispora blattae CBS 6284
ref|XP_004531261.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    262   5e-79    Ceratitis capitata [medfly]
ref|XP_003288175.1|  threonyl-tRNA synthetase                           263   6e-79    Dictyostelium purpureum
ref|XP_003058283.1|  predicted protein                                  262   8e-79    Micromonas pusilla CCMP1545
ref|XP_011212426.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    261   8e-79    Bactrocera dorsalis [papaya fruit fly]
ref|XP_003397155.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    262   9e-79    
pdb|4HWT|A  Chain A, Crystal Structure Of Human Threonyl-trna Syn...    254   9e-79    Homo sapiens [man]
ref|XP_636821.1|  threonyl-tRNA synthetase                              262   1e-78    Dictyostelium discoideum AX4
pdb|4P3N|A  Chain A, Structural Basis For Full-spectrum Inhibitio...    254   1e-78    Homo sapiens [man]
gb|KGK38420.1|  hypothetical protein JL09_g2427                         262   1e-78    Pichia kudriavzevii
ref|XP_003489967.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    261   1e-78    
ref|XP_001989177.1|  GH11579                                            256   1e-78    Drosophila grimshawi
ref|XP_004531260.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    263   1e-78    Ceratitis capitata [medfly]
gb|EDL82978.1|  threonyl-tRNA synthetase, isoform CRA_b                 254   2e-78    Rattus norvegicus [brown rat]
ref|XP_001623293.1|  predicted protein                                  257   2e-78    Nematostella vectensis
gb|EFA05822.1|  hypothetical protein TcasGA2_TC008604                   260   2e-78    
ref|XP_011499017.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    260   3e-78    Ceratosolen solmsi marchali
ref|XP_001418868.1|  predicted protein                                  260   3e-78    Ostreococcus lucimarinus CCE9901
ref|XP_011212417.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    262   3e-78    Bactrocera dorsalis [papaya fruit fly]
ref|XP_009117636.1|  PREDICTED: threonine--tRNA ligase, mitochond...    254   3e-78    Brassica rapa
ref|XP_001965104.1|  GF21565                                            261   3e-78    Drosophila ananassae
dbj|GAM29123.1|  hypothetical protein SAMD00019534_122990               260   3e-78    Acytostelium subglobosum LB1
ref|XP_008198247.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    260   3e-78    Tribolium castaneum [rust-red flour beetle]
ref|XP_967345.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic ...    260   4e-78    Tribolium castaneum [rust-red flour beetle]
ref|XP_011397153.1|  Threonine-tRNA ligase, mitochondrial               261   4e-78    Auxenochlorella protothecoides
emb|CDJ83831.1|  Aminoacyl-tRNA synthetase and Anticodon-binding ...    252   5e-78    Haemonchus contortus [red stomach worm]
ref|XP_001658309.1|  AAEL001206-PA                                      260   6e-78    Aedes aegypti
ref|XP_319682.4|  AGAP008929-PA                                         261   6e-78    Anopheles gambiae str. PEST
ref|NP_723726.1|  Threonyl-tRNA synthetase, isoform C                   259   8e-78    Drosophila melanogaster
gb|AAH04621.1|  Tars protein                                            253   8e-78    Mus musculus [mouse]
gb|EPY73150.1|  threonine--tRNA ligase, cytoplasmic                     258   8e-78    Camelus ferus
gb|AAN71609.1|  RH56418p                                                259   9e-78    Drosophila melanogaster
ref|XP_005650255.1|  threonyl-tRNA synthetase                           263   1e-77    Coccomyxa subellipsoidea C-169
ref|XP_004088253.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   1e-77    
ref|XP_001950747.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    259   1e-77    
ref|XP_449908.1|  hypothetical protein                                  259   1e-77    [Candida] glabrata
ref|XP_004351232.1|  threonyl-tRNA synthetase                           259   1e-77    Cavenderia fasciculata
ref|XP_010208524.1|  PREDICTED: probable threonine--tRNA ligase 2...    246   1e-77    Colius striatus
ref|XP_009238891.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   1e-77    
ref|XP_002002014.1|  GI17149                                            258   1e-77    
gb|EHJ63622.1|  hypothetical protein KGM_17077                          259   1e-77    
ref|XP_002052626.1|  GJ17652                                            259   1e-77    Drosophila virilis
ref|XP_001969762.1|  GG23767                                            259   2e-77    Drosophila erecta
gb|ETN67379.1|  threonyl-tRNA synthetase                                258   2e-77    Anopheles darlingi [American malaria mosquito]
ref|XP_002595927.1|  hypothetical protein BRAFLDRAFT_268618             258   2e-77    Branchiostoma floridae
ref|XP_001642915.1|  hypothetical protein Kpol_411p2                    259   2e-77    Vanderwaltozyma polyspora DSM 70294
ref|NP_723725.1|  Threonyl-tRNA synthetase, isoform A                   259   2e-77    Drosophila melanogaster
gb|AAM50188.1|  GH20022p                                                259   2e-77    Drosophila melanogaster
ref|XP_011192188.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    258   2e-77    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_002079196.1|  GD23818                                            259   2e-77    Drosophila simulans
ref|XP_002042027.1|  GM26732                                            259   2e-77    Drosophila sechellia
ref|XP_005556719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-77    
emb|CDF89359.1|  ZYBA0S04-02388g1_1                                     258   3e-77    Zygosaccharomyces bailii CLIB 213
ref|XP_003503703.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     258   3e-77    Cricetulus griseus [Chinese hamsters]
ref|XP_002088448.1|  Aats-thr                                           258   3e-77    Drosophila yakuba
ref|XP_004088252.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   3e-77    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009812579.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    249   3e-77    Gavia stellata
ref|XP_003955557.1|  hypothetical protein KAFR_0B01230                  258   4e-77    Kazachstania africana CBS 2517
ref|XP_004059038.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   4e-77    
gb|KFB38665.1|  AGAP008929-PA-like protein                              258   4e-77    Anopheles sinensis
ref|XP_005556718.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   4e-77    
ref|XP_005325709.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    258   4e-77    Ictidomys tridecemlineatus
ref|NP_001125825.1|  threonine--tRNA ligase, cytoplasmic                254   5e-77    Pongo abelii [orang utan]
ref|XP_004059037.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   5e-77    
ref|XP_003729486.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   5e-77    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006194878.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     257   5e-77    Camelus ferus
ref|XP_004990683.1|  threonyl-tRNA synthetase isoform 2                 258   5e-77    Salpingoeca rosetta
ref|XP_002714160.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     257   5e-77    Oryctolagus cuniculus [domestic rabbit]
ref|XP_002014541.1|  GL19239                                            258   6e-77    Drosophila persimilis
gb|EDL03283.1|  threonyl-tRNA synthetase, isoform CRA_a                 253   6e-77    Mus musculus [mouse]
gb|EFB17446.1|  hypothetical protein PANDA_008118                       256   6e-77    Ailuropoda melanoleuca
gb|EFA77297.1|  threonyl-tRNA synthetase                                257   6e-77    Heterostelium album PN500
ref|XP_008472446.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     253   6e-77    
ref|XP_005003846.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   7e-77    
ref|XP_006875438.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   7e-77    Chrysochloris asiatica
ref|XP_011290653.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   7e-77    Musca domestica
ref|XP_003470228.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   7e-77    
ref|XP_005325710.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    258   7e-77    
dbj|BAG59361.1|  unnamed protein product                                254   8e-77    Homo sapiens [man]
ref|XP_008213480.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   8e-77    Nasonia vitripennis
ref|XP_004088251.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   8e-77    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005178933.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   8e-77    Musca domestica
ref|XP_004385288.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   8e-77    
ref|XP_001603180.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   8e-77    Nasonia vitripennis
ref|XP_011192187.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    258   9e-77    
ref|XP_004698143.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   9e-77    Echinops telfairi [lesser hedgehog tenrec]
gb|ELK31735.1|  Threonyl-tRNA synthetase, cytoplasmic                   255   9e-77    Myotis davidii
ref|XP_004059036.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   9e-77    
ref|XP_011342020.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   1e-76    Ooceraea biroi
gb|EAX10803.1|  threonyl-tRNA synthetase, isoform CRA_a                 254   1e-76    Homo sapiens [man]
ref|XP_004325399.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   1e-76    
ref|XP_006875437.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   1e-76    Chrysochloris asiatica
ref|XP_008690887.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   1e-76    Ursus maritimus [white bear]
ref|XP_002919483.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   1e-76    Ailuropoda melanoleuca
ref|XP_004385287.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   1e-76    
ref|XP_009117635.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   1e-76    Brassica rapa
ref|XP_004678135.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   1e-76    Condylura cristata
dbj|BAG53144.1|  unnamed protein product                                254   1e-76    Homo sapiens [man]
ref|XP_006148565.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   1e-76    Tupaia chinensis
ref|XP_005178932.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    257   2e-76    Musca domestica
ref|XP_003703597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    
ref|XP_002499537.1|  predicted protein                                  256   2e-76    Micromonas commoda
ref|XP_010168916.1|  PREDICTED: probable threonine--tRNA ligase 2...    248   2e-76    Antrostomus carolinensis
ref|XP_004412948.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   2e-76    Odobenus rosmarus divergens
ref|XP_011342019.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    Ooceraea biroi
ref|XP_011264917.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   2e-76    Camponotus floridanus
ref|XP_009447608.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   2e-76    
ref|XP_006996688.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   2e-76    Peromyscus maniculatus bairdii
ref|XP_003274971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    
ref|XP_009206493.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   2e-76    Papio anubis [baboon]
ref|XP_005556717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    Macaca fascicularis [crab eating macaque]
ref|XP_011264916.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    Camponotus floridanus
ref|XP_004349538.1|  threonyl-tRNA synthetase                           256   2e-76    Capsaspora owczarzaki ATCC 30864
ref|XP_007959499.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   2e-76    Chlorocebus sabaeus
ref|XP_006761862.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   2e-76    
ref|XP_010166514.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   2e-76    Antrostomus carolinensis
emb|CDW52205.1|  threonyl tRNA synthetase, cytoplasmic                  255   3e-76    Trichuris trichiura
ref|XP_008046647.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   3e-76    Carlito syrichta
gb|EDZ71519.1|  YIL078Wp-like protein                                   255   3e-76    Saccharomyces cerevisiae AWRI1631
ref|XP_005983077.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    253   3e-76    Pantholops hodgsonii [Tibetan antelope]
gb|AJR37072.1|  Ths1p                                                   256   3e-76    Saccharomyces cerevisiae YJM195
ref|XP_011264915.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   3e-76    Camponotus floridanus
gb|AJR47138.1|  Ths1p                                                   256   3e-76    Saccharomyces cerevisiae YJM1342
ref|XP_006559719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   3e-76    Apis mellifera [bee]
ref|XP_004059034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   3e-76    
ref|XP_006199708.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    255   3e-76    
ref|XP_002069231.1|  GK21088                                            255   3e-76    
ref|XP_005872671.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     255   3e-76    Myotis brandtii
gb|AJR45798.1|  Ths1p                                                   256   3e-76    Saccharomyces cerevisiae YJM1307
gb|EDN61420.1|  threonyl-tRNA synthetase                                256   3e-76    Saccharomyces cerevisiae YJM789
ref|XP_006559720.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   3e-76    Apis mellifera [bee]
ref|NP_116578.3|  threonine--tRNA ligase THS1                           256   3e-76    Saccharomyces cerevisiae S288C
emb|CDK25861.1|  unnamed protein product                                255   3e-76    Kuraishia capsulata CBS 1993
gb|AJR39322.1|  Ths1p                                                   256   3e-76    Saccharomyces cerevisiae YJM470
ref|XP_006090155.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     255   3e-76    Myotis lucifugus
ref|XP_006612937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   4e-76    Apis dorsata [rock honeybee]
gb|EHN06623.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EGA78432.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae Vin13
ref|NP_983365.1|  ACL039Wp                                              255   4e-76    Eremothecium gossypii ATCC 10895
gb|EDV09560.1|  threonyl-tRNA synthetase                                255   4e-76    Saccharomyces cerevisiae RM11-1a
ref|XP_003674309.1|  hypothetical protein NCAS_0A13710                  256   4e-76    Naumovozyma castellii CBS 4309
ref|NP_001006977.1|  threonine--tRNA ligase, cytoplasmic                254   4e-76    Rattus norvegicus [brown rat]
gb|EIW09934.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae CEN.PK113-7D
gb|EWG95461.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae R103
ref|XP_007959500.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   4e-76    Chlorocebus sabaeus
gb|AJR38945.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae YJM453
gb|EEU08659.1|  Ths1p                                                   255   4e-76    Saccharomyces cerevisiae JAY291
emb|CAA26666.1|  unnamed protein product                                255   4e-76    Saccharomyces cerevisiae [brewer's yeast]
ref|XP_006612938.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   4e-76    Apis dorsata [rock honeybee]
gb|KFV55276.1|  Threonine--tRNA ligase, cytoplasmic                     246   4e-76    Gavia stellata
ref|XP_008153034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   4e-76    
ref|XP_005556716.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    256   4e-76    Macaca fascicularis [crab eating macaque]
ref|XP_008833678.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     255   4e-76    
gb|AJR53093.1|  Ths1p                                                   255   4e-76    
ref|NP_001029542.1|  threonine--tRNA ligase, cytoplasmic                255   5e-76    
ref|XP_004088250.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   5e-76    
ref|XP_005320129.1|  PREDICTED: probable threonine--tRNA ligase 2...    255   5e-76    
ref|XP_005774035.1|  threonine-tRNA ligase                              254   5e-76    
ref|XP_005694881.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     255   5e-76    
ref|XP_008990455.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   5e-76    
gb|ABM82342.1|  threonyl-tRNA synthetase                                254   5e-76    
gb|EHH26432.1|  hypothetical protein EGK_16408                          255   5e-76    
gb|EHN01906.1|  Ths1p                                                   255   5e-76    
gb|KHJ41146.1|  hypothetical protein D918_08732                         254   5e-76    
gb|EHH54185.1|  hypothetical protein EGM_14968                          255   5e-76    
ref|XP_006232130.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   5e-76    
gb|AIC63184.1|  TARS                                                    254   5e-76    
ref|XP_007466902.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    253   5e-76    
ref|XP_005758375.1|  threonine-tRNA ligase                              254   6e-76    
ref|XP_003899597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   6e-76    
ref|XP_010586388.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    254   6e-76    
ref|XP_008153032.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   6e-76    
ref|XP_536509.3|  PREDICTED: threonine--tRNA ligase, cytoplasmic        254   6e-76    
ref|XP_001498225.2|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   7e-76    
ref|NP_689508.3|  threonine--tRNA ligase, cytoplasmic isoform 1         254   7e-76    
ref|XP_001153971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   7e-76    
ref|XP_007192302.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   7e-76    
gb|AAH10578.2|  Threonyl-tRNA synthetase                                254   7e-76    
ref|XP_004059035.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   7e-76    
ref|XP_003691478.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    254   7e-76    
gb|EPQ11689.1|  Threonyl-tRNA synthetase, cytoplasmic                   255   7e-76    
ref|XP_010852134.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   7e-76    
dbj|BAD96524.1|  threonyl-tRNA synthetase variant                       254   8e-76    
ref|XP_010148223.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   8e-76    
ref|XP_007097493.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   8e-76    
ref|XP_003936261.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   8e-76    
ref|XP_004583694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   8e-76    
ref|XP_005887778.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    255   9e-76    
ref|XP_010354694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   9e-76    
ref|XP_001513531.2|  PREDICTED: probable threonine--tRNA ligase 2...    254   9e-76    
ref|XP_008561545.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    250   1e-75    
ref|XP_003793022.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   1e-75    
dbj|BAO41767.1|  threonyl-tRNA synthetase                               254   1e-75    
ref|XP_004385286.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   1e-75    
ref|XP_004879581.1|  PREDICTED: probable threonine--tRNA ligase 2...    253   1e-75    
ref|XP_005356692.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   1e-75    
ref|XP_009206495.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   1e-75    
ref|XP_004017114.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     254   1e-75    
ref|XP_004266073.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   1e-75    
gb|AAH55371.1|  Threonyl-tRNA synthetase                                254   1e-75    
ref|XP_002745122.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    254   1e-75    
emb|CDY21726.1|  BnaA09g44770D                                          247   1e-75    
dbj|BAB26799.1|  unnamed protein product                                254   1e-75    
ref|NP_149065.2|  threonine--tRNA ligase, cytoplasmic                   254   1e-75    
ref|XP_005320128.1|  PREDICTED: probable threonine--tRNA ligase 2...    255   1e-75    
ref|XP_005983076.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    253   2e-75    
ref|XP_003981521.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     253   2e-75    
ref|XP_010141938.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     252   2e-75    
ref|NP_001245367.1|  threonine--tRNA ligase, cytoplasmic isoform 2      254   2e-75    
ref|XP_007535845.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     253   2e-75    
ref|XP_009927442.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    245   2e-75    
gb|KFQ16963.1|  putative threonine--tRNA ligase 2, cytoplasmic          252   2e-75    
ref|XP_005320127.1|  PREDICTED: probable threonine--tRNA ligase 2...    255   2e-75    
ref|XP_008561546.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   2e-75    
gb|KFZ50404.1|  Threonine--tRNA ligase, cytoplasmic                     246   2e-75    
ref|XP_009695024.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   2e-75    
gb|KFO94418.1|  Threonine--tRNA ligase, cytoplasmic                     252   2e-75    
ref|XP_003760006.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     256   2e-75    
ref|XP_007466903.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    253   3e-75    
dbj|BAG38072.1|  unnamed protein product                                253   3e-75    
ref|XP_011158574.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    253   3e-75    
ref|XP_003667634.1|  hypothetical protein NDAI_0A02330                  253   3e-75    
ref|XP_004372697.1|  PREDICTED: probable threonine--tRNA ligase 2...    254   3e-75    
dbj|BAE31895.1|  unnamed protein product                                253   3e-75    
gb|EHH61622.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        247   3e-75    
ref|XP_007440622.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    250   3e-75    
ref|XP_001845897.1|  threonyl-tRNA synthetase                           252   3e-75    
ref|XP_002195014.2|  PREDICTED: probable threonine--tRNA ligase 2...    253   3e-75    
ref|XP_003688670.1|  hypothetical protein TPHA_0P00780                  253   4e-75    
gb|EKC29157.1|  Threonyl-tRNA synthetase, cytoplasmic                   241   4e-75    
ref|XP_007954753.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     253   4e-75    
ref|XP_011158573.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    252   4e-75    
gb|EOA97118.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        252   4e-75    
gb|EDL07239.1|  threonyl-tRNA synthetase-like 2, isoform CRA_b          249   4e-75    
gb|AGO11222.1|  AaceriACL039Wp                                          253   4e-75    
gb|KFV63505.1|  putative threonine--tRNA ligase 2, cytoplasmic          251   4e-75    
gb|EFZ18882.1|  hypothetical protein SINV_16250                         254   4e-75    
ref|XP_008554535.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    252   4e-75    
ref|XP_010224537.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     253   4e-75    
ref|XP_007872125.1|  hypothetical protein PNEG_00254                    251   5e-75    
gb|KGL73538.1|  Threonine--tRNA ligase, cytoplasmic                     251   5e-75    
ref|XP_003133916.3|  PREDICTED: threonine--tRNA ligase, cytoplasm...    251   5e-75    
gb|KFP63323.1|  putative threonine--tRNA ligase 2, cytoplasmic          251   5e-75    
ref|XP_010007069.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   5e-75    
ref|XP_009163294.1|  hypothetical protein T265_01087                    252   6e-75    
ref|XP_002942619.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    252   6e-75    
ref|XP_005521510.1|  PREDICTED: probable threonine--tRNA ligase 2...    253   6e-75    
ref|XP_004852724.1|  PREDICTED: probable threonine--tRNA ligase 2...    253   6e-75    
gb|KFQ42737.1|  putative threonine--tRNA ligase 2, cytoplasmic          251   6e-75    
gb|KFP03020.1|  putative threonine--tRNA ligase 2, cytoplasmic          251   7e-75    
gb|AJR38174.1|  Ths1p                                                   252   7e-75    
ref|XP_004852723.1|  PREDICTED: probable threonine--tRNA ligase 2...    253   7e-75    
ref|XP_008554533.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    252   7e-75    
gb|KFO53391.1|  putative threonine--tRNA ligase 2, cytoplasmic          251   7e-75    
ref|XP_010014179.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   7e-75    
ref|XP_008494852.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   7e-75    
ref|XP_006003382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   8e-75    
ref|XP_005152060.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   8e-75    
ref|XP_005025500.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   8e-75    
ref|XP_006020081.1|  PREDICTED: probable threonine--tRNA ligase 2...    252   8e-75    
ref|XP_007120316.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    251   8e-75    
gb|KFW03653.1|  Threonine--tRNA ligase, cytoplasmic                     246   8e-75    
ref|XP_004605618.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   9e-75    
ref|XP_009044100.1|  hypothetical protein LOTGIDRAFT_103202             251   9e-75    
ref|XP_008942445.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    252   9e-75    
ref|XP_004894553.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   9e-75    
emb|CCK69517.1|  hypothetical protein KNAG_0C04150                      251   1e-74    
ref|XP_004738119.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   1e-74    
ref|XP_003683234.1|  hypothetical protein TDEL_0H01640                  251   1e-74    
ref|XP_007855570.1|  threonyl-trna synthetase                           251   1e-74    
ref|XP_009096163.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   1e-74    
ref|XP_009876628.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   1e-74    
ref|XP_003648097.1|  hypothetical protein Ecym_7461                     251   1e-74    
ref|XP_006268868.1|  PREDICTED: probable threonine--tRNA ligase 2...    252   1e-74    
ref|XP_008636148.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   1e-74    
ref|XP_008930351.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   1e-74    
ref|XP_009909554.1|  PREDICTED: probable threonine--tRNA ligase 2...    252   1e-74    
ref|XP_002193839.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   1e-74    
gb|EMC80410.1|  Threonyl-tRNA synthetase, cytoplasmic                   251   1e-74    
ref|XP_455348.1|  hypothetical protein                                  251   1e-74    
dbj|GAA47460.1|  threonyl-tRNA synthetase                               251   1e-74    
ref|XP_010393447.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   2e-74    
ref|XP_011298382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    251   2e-74    
ref|XP_007487558.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   2e-74    
ref|XP_010282424.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   2e-74    
ref|XP_008847768.1|  PREDICTED: probable threonine--tRNA ligase 2...    252   2e-74    
gb|KFV92314.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   2e-74    
ref|XP_005488843.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   2e-74    
ref|XP_004623299.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    251   2e-74    
dbj|BAC27235.1|  unnamed protein product                                250   2e-74    
ref|XP_010606023.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   2e-74    
gb|KFD48788.1|  hypothetical protein M513_10343                         258   2e-74    
ref|XP_009645675.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     251   2e-74    
ref|XP_004652577.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   2e-74    
gb|KFP70847.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   3e-74    
gb|KFD69339.1|  hypothetical protein M514_10343                         258   3e-74    
gb|EJW79603.1|  hypothetical protein WUBG_09488                         241   3e-74    
emb|CDO95602.1|  unnamed protein product                                251   3e-74    
ref|XP_011298380.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    250   3e-74    
ref|XP_010187513.1|  PREDICTED: probable threonine--tRNA ligase 2...    247   3e-74    
ref|XP_004422764.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    250   3e-74    
ref|XP_006733411.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   3e-74    
gb|KFU86013.1|  Threonine--tRNA ligase, cytoplasmic                     249   3e-74    
ref|XP_009678905.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   3e-74    
ref|XP_009466320.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   3e-74    
emb|CDX81854.1|  BnaC08g37470D                                          243   3e-74    
ref|XP_003978376.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    250   3e-74    
ref|XP_007375178.1|  hypothetical protein SPAPADRAFT_61003              250   3e-74    
ref|XP_009576132.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   3e-74    
ref|XP_009076978.1|  PREDICTED: probable threonine--tRNA ligase 2...    250   3e-74    
gb|KFP47497.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   3e-74    
ref|XP_010389512.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    251   3e-74    
gb|EHB09296.1|  Threonyl-tRNA synthetase, cytoplasmic                   251   3e-74    
ref|XP_004349666.1|  threonine-tRNA ligase                              249   4e-74    
emb|CEJ02300.1|  Putative Threonyl-tRNA synthetase                      237   4e-74    
ref|XP_006019179.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     250   4e-74    
ref|XP_011055937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   4e-74    
gb|KFM08256.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   4e-74    
ref|XP_005419820.1|  PREDICTED: probable threonine--tRNA ligase 2...    251   4e-74    
ref|XP_005528046.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   4e-74    
emb|CBK21096.2|  unnamed protein product                                251   4e-74    
ref|XP_009088363.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    251   4e-74    
ref|NP_001001219.1|  threonine--tRNA ligase, cytoplasmic                249   4e-74    
gb|KFV95622.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   4e-74    
dbj|BAB71554.1|  unnamed protein product                                243   4e-74    
ref|XP_011055929.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   4e-74    
ref|XP_010562280.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   4e-74    
ref|XP_002432585.1|  Threonyl-tRNA synthetase, cytoplasmic, putative    249   5e-74    
gb|KFW87793.1|  Threonine--tRNA ligase, cytoplasmic                     249   5e-74    
ref|XP_002172490.1|  cytoplasmic threonine-tRNA ligase Trs1             249   5e-74    
gb|KFU87220.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   5e-74    
ref|XP_011274772.1|  threonyl-tRNA synthetase                           250   5e-74    
gb|KGL77238.1|  putative threonine--tRNA ligase 2, cytoplasmic          249   5e-74    
gb|KFQ51603.1|  Threonine--tRNA ligase, cytoplasmic                     248   5e-74    
ref|XP_009679777.1|  PREDICTED: probable threonine--tRNA ligase 2...    246   5e-74    
ref|XP_010201666.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   5e-74    
gb|KFQ99509.1|  putative threonine--tRNA ligase 2, cytoplasmic          248   6e-74    
gb|KFO72069.1|  putative threonine--tRNA ligase 2, cytoplasmic          248   6e-74    
ref|XP_006267829.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   6e-74    
ref|XP_004431940.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   6e-74    
ref|XP_008685800.1|  PREDICTED: probable threonine--tRNA ligase 2...    248   6e-74    
ref|XP_003475575.2|  PREDICTED: probable threonine--tRNA ligase 2...    249   6e-74    
ref|XP_009283503.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   6e-74    
gb|KFV84254.1|  Threonine--tRNA ligase, cytoplasmic                     248   6e-74    
ref|XP_006896868.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   6e-74    
gb|EPQ10677.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        246   6e-74    
ref|XP_006733410.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   6e-74    
ref|XP_005060582.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   7e-74    
gb|KFP82727.1|  Threonine--tRNA ligase, cytoplasmic                     248   7e-74    
ref|XP_010606022.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   7e-74    
ref|XP_009971626.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     248   7e-74    
ref|XP_010598480.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   7e-74    
gb|KFR17860.1|  Threonine--tRNA ligase, cytoplasmic                     248   7e-74    
emb|CCD74804.1|  unnamed protein product                                236   7e-74    
ref|XP_008685799.1|  PREDICTED: probable threonine--tRNA ligase 2...    248   7e-74    
gb|KFV55285.1|  putative threonine--tRNA ligase 2, cytoplasmic          248   7e-74    
ref|XP_003738717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    248   7e-74    
ref|XP_009911729.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     248   7e-74    
gb|AAH74887.1|  TARSL2 protein                                          243   7e-74    
ref|XP_005487937.1|  PREDICTED: probable threonine--tRNA ligase 2...    250   8e-74    
ref|XP_005386220.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    249   8e-74    
gb|KFP96981.1|  putative threonine--tRNA ligase 2, cytoplasmic          248   8e-74    
ref|XP_005999419.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   8e-74    
ref|XP_010155633.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   8e-74    
ref|XP_009278712.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   8e-74    
ref|XP_009992825.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   8e-74    
ref|XP_005999418.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    249   9e-74    
gb|KFP23006.1|  Threonine--tRNA ligase, cytoplasmic                     248   9e-74    
ref|XP_009968247.1|  PREDICTED: probable threonine--tRNA ligase 2...    248   9e-74    
ref|XP_009941932.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     248   9e-74    
ref|XP_001508543.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     249   9e-74    
ref|XP_009553641.1|  PREDICTED: probable threonine--tRNA ligase 2...    249   9e-74    
ref|XP_010015045.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     248   1e-73    



>ref|XP_006355233.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=676

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAEAAL++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATL
Sbjct  463  PEKYLGDIETWVKAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATL  522

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  523  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  582

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKSQ+Y ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EAT
Sbjct  583  MVCPVSDKSQSYALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEAT  642

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD PDH+VMTVD LLAHFKD++AS++
Sbjct  643  SGQVSVRVRDKPDHQVMTVDVLLAHFKDMVASFQ  676



>ref|XP_009622103.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana tomentosiformis]
Length=721

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLESW KAE +L +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATL
Sbjct  508  PEKYLGDLESWNKAEDSLAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATL  567

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  568  QLDFQLPQRFNLSYSAEDENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  627

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKSQ+Y +ELR+RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA+
Sbjct  628  MVCPVSDKSQSYALELRERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEAS  687

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            + +VSVRVRD PDH+VMTVD+LL HFKD++AS++
Sbjct  688  SRQVSVRVRDKPDHQVMTVDDLLGHFKDMVASFQ  721



>ref|XP_004246064.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=676

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+ +W KAEAAL++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATL
Sbjct  463  PEKFLGDIATWVKAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATL  522

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  523  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  582

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKSQ+Y ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA+
Sbjct  583  MVCPVSDKSQSYALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEAS  642

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD PDH+VMTVD LLA FKD++AS++
Sbjct  643  SGQVSVRVRDKPDHQVMTVDVLLAQFKDMVASFQ  676



>ref|XP_009794575.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana sylvestris]
Length=725

 Score =   393 bits (1009),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLESW KAE AL +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATL
Sbjct  512  PEKYLGDLESWNKAEDALAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATL  571

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNL+YSAEDE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  572  QLDFQLPQRFNLAYSAEDENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  631

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKSQ+Y +ELR+RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA+
Sbjct  632  MVCPVSDKSQSYALELRERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEAS  691

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            + +VSVRVRD PDH+VMTV +LLAHFKD++AS++
Sbjct  692  SRQVSVRVRDKPDHQVMTVGDLLAHFKDMVASFQ  725



>ref|XP_004170956.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=305

 Score =   370 bits (950),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  92   PEKYLGDLETWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATL  151

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  152  QLDFQLPARFELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  211

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  212  IVCPVSEKSQSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEAN  271

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HFK+ +A++
Sbjct  272  TGQVSVRVRDKADHSVMSIESLLNHFKEEVAAF  304



>ref|XP_006355966.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=725

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLESWEKAEAAL +ALNEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATL
Sbjct  512  PEKYLGDLESWEKAEAALAEALNEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATL  571

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  572  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  631

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKS +Y  ELR+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE E +
Sbjct  632  MVCPVSDKSLSYAFELRERIHDAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEVS  691

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVR  PDH+VMTVD LL HFKDL+AS++
Sbjct  692  SGQVSVRVRSKPDHEVMTVDGLLTHFKDLVASFQ  725



>gb|KGN49712.1| hypothetical protein Csa_5G080780 [Cucumis sativus]
Length=321

 Score =   370 bits (951),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  108  PEKYLGDLETWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATL  167

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  168  QLDFQLPARFELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  227

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  228  IVCPVSEKSQSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEAN  287

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HFK+ +A++
Sbjct  288  TGQVSVRVRDKADHSVMSIESLLNHFKEEVAAF  320



>ref|XP_004238685.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=725

 Score =   383 bits (983),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLESWEKAEAAL +ALNEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATL
Sbjct  512  PEKYLGDLESWEKAEAALAEALNEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATL  571

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA
Sbjct  572  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  631

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVSDKS +Y  ELR+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE EA+
Sbjct  632  MVCPVSDKSLSYAFELRERIHDAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEAS  691

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVR   DH+VMTVD LL HFKDL+AS++
Sbjct  692  SGQVSVRVRSKSDHEVMTVDGLLTHFKDLVASFQ  725



>gb|KDO82534.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=291

 Score =   366 bits (939),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  78   PEKYLGDLATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATL  137

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  138  QLDFQLPDRFNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  197

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  198  IVCPVSEKSQPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAK  257

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD  DH  M++++LL HFK+ + +++
Sbjct  258  SGQVSVRVRDQGDHSNMSIEDLLKHFKEKLEAFQ  291



>ref|XP_010274327.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=729

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  516  PEKYLGEIETWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATL  575

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  576  QLDFQLPSRFNLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  635

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  636  VVCPVSEKSQPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEAN  695

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH V +++ELL HFK+ +A++
Sbjct  696  TGQVSVRVRDKSDHSVKSIEELLTHFKEEVAAF  728



>ref|XP_006438443.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
 gb|ESR51683.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
Length=315

 Score =   365 bits (936),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  102  PEKYLGDLATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATL  161

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  162  QLDFQLPDRFNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  221

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  222  IVCPVSEKSQPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAK  281

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD  DH  M++++LL HFK+ + +++
Sbjct  282  SGQVSVRVRDQGDHSNMSIEDLLKHFKEKLEAFQ  315



>gb|EPS72288.1| hypothetical protein M569_02470 [Genlisea aurea]
Length=690

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAAL DALNEFGKPWEINE DGAFYGPKIDISV DAMKRKFQCATL
Sbjct  477  PEKYLGDLETWEKAEAALADALNEFGKPWEINEADGAFYGPKIDISVSDAMKRKFQCATL  536

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  537  QLDFQLPARFNLSYSAEDETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  596

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVSDKSQ+Y +E+++RIH+AG++VDVDT+DRTI KKVREAQVAQYNYILVVGEKE  
Sbjct  597  IVCPVSDKSQSYALEVKNRIHDAGYYVDVDTTDRTINKKVREAQVAQYNYILVVGEKEVG  656

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+V+VRVRD  D  +M++D+LL  FK  +A+++
Sbjct  657  TGQVAVRVRDNSDTNLMSIDDLLNRFKSEVAAHR  690



>ref|XP_011076219.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Sesamum indicum]
Length=722

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLESWE+AEAAL DALNEFGKPWEINEGDGAFYGPKIDISV DAM+RKFQCATL
Sbjct  509  PEKYLGDLESWERAEAALADALNEFGKPWEINEGDGAFYGPKIDISVSDAMRRKFQCATL  568

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  569  QLDFQLPARFNLSYSAEDETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  628

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVSDKS +Y +++RDRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  
Sbjct  629  IVCPVSDKSHSYALQVRDRIHDAGFYVDVDTTDRTINKKVREAQLAQYNYILVVGEKEVG  688

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+V+VRVRD  D  + ++D+LL +FKD +A+++
Sbjct  689  TGQVAVRVRDNFDANLKSIDDLLNYFKDEVAAFR  722



>ref|XP_010272819.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nelumbo 
nucifera]
Length=726

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E+WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  513  PEKFLGDIETWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATL  572

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  573  QLDFQLPSRFNLSYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  632

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  633  IVCPVSEKSQPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEAN  692

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  DH V ++ +LL HFK+ +A+++
Sbjct  693  TGQVSVRVRDKADHSVKSIQDLLTHFKEEVAAFR  726



>ref|XP_008460557.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cucumis melo]
Length=724

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  511  PEKYLGDLETWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATL  570

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  571  QLDFQLPTRFELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  630

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y M++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  631  IVCPVSEKSQSYAMKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEAN  690

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+V+ LL HFK+ +A++
Sbjct  691  TGQVSVRVRDKADHSVMSVESLLNHFKEEVAAF  723



>emb|CDP00192.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   370 bits (950),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAAL +ALNEFGKPW+INEGDGAFYGPKIDISV DAM+R+FQCATL
Sbjct  514  PEKYLGDLETWEKAEAALKEALNEFGKPWQINEGDGAFYGPKIDISVNDAMRRQFQCATL  573

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY+AEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  574  QLDFQLPSRFNLSYTAEDENKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  633

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y ++LRD+IH+AG++VDVD +DRTIQKKVREAQVAQYNYILVVGE+EA 
Sbjct  634  IVCPVSEKSQPYALKLRDQIHDAGYYVDVDATDRTIQKKVREAQVAQYNYILVVGEEEAK  693

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD   H V +V+ELL+  K+ +A+++
Sbjct  694  TGQVSVRVRDKASHSVKSVEELLSDLKNEVAAFR  727



>ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=724

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  511  PEKYLGDLETWEKAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATL  570

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  571  QLDFQLPARFELYYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  630

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  631  IVCPVSEKSQSYALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEAN  690

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HFK+ +A++
Sbjct  691  TGQVSVRVRDKADHSVMSIESLLNHFKEEVAAF  723



>gb|ADE77216.1| unknown [Picea sitchensis]
Length=215

 Score =   352 bits (902),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGDLE+W++AEAALT+ALN FGKPW+INEGDGAFYGPKIDI+V DA+KRKFQCAT+
Sbjct  2    PEKHLGDLETWQRAEAALTEALNAFGKPWQINEGDGAFYGPKIDITVFDALKRKFQCATI  61

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSYS EDE+KRERPVMIHRAILGSVERM AILLEH+ GKWPFWLSPRQA
Sbjct  62   QLDFQLPIRFDLSYSTEDEAKRERPVMIHRAILGSVERMLAILLEHYAGKWPFWLSPRQA  121

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KS  Y + +RD+IH+AG++VDVDTSDR IQKK+REAQ+AQYNYILVVGE+EA 
Sbjct  122  IVCPVSEKSSDYALRVRDQIHQAGYYVDVDTSDRKIQKKIREAQLAQYNYILVVGEEEAN  181

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVR+RD   H+V ++DELL  F++ + ++
Sbjct  182  TGQVSVRIRDKSAHEVRSMDELLKLFREEIEAF  214



>ref|XP_002265302.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Vitis vinifera]
 emb|CBI32119.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+AL++ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  473  PEKYLGDLETWEKAEAALTEALDQSGKPWEINEGDGAFYGPKIDISVSDALSRKFQCATL  532

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  533  QLDFQLPSRFDLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  592

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  593  IVCPVSEKSQPYALKVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEAN  652

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL+ FK  +A++
Sbjct  653  TGQVSVRVRDKGDHSVMSMENLLSFFKSEIAAF  685



>ref|XP_010644571.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Vitis 
vinifera]
 emb|CBI39735.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+WEKAEAALT+ALN+ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  473  PEKYLGDLETWEKAEAALTEALNQSGKPWEINEGDGAFYGPKIDISVSDALNRKFQCATL  532

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  533  QLDFQLPSRFDLSYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  592

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  593  IVCPVSEKSQPYALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAN  652

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T +VSVRVRD  DH VM+++ LL++FK   A++
Sbjct  653  TRQVSVRVRDKGDHSVMSMENLLSYFKSETAAF  685



>gb|EYU25062.1| hypothetical protein MIMGU_mgv1a002240mg [Erythranthe guttata]
Length=696

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAEAAL +ALNEFGKPW+INE DGAFYGPKIDI+V DAM R FQCATL
Sbjct  483  PEKYLGDIVTWDKAEAALEEALNEFGKPWKINEADGAFYGPKIDITVFDAMGRDFQCATL  542

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  543  QLDFQLPARFNLSYSAEDETKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  602

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +E+RDRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  
Sbjct  603  IVCPVSEKSQQYALEVRDRIHDAGFYVDVDTTDRTINKKVREAQMAQYNYILVVGEKEVG  662

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+V+VRVRDI D  + ++D++L  FKD  AS+K
Sbjct  663  TGQVAVRVRDINDANLQSIDDVLNRFKDETASFK  696



>ref|XP_010100498.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXB82632.1| Threonine--tRNA ligase [Morus notabilis]
Length=625

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+L +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  412  PEKYLGELATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  471

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRE PVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  472  QLDFQLPARFELYYSAEDEAKREAPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  531

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  532  IVCPVSEKSQSYALKVRDQIHDAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAN  591

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFK  87
            TG+VSVR+R+  DH VM+++ELL HFK
Sbjct  592  TGQVSVRLRNSYDHSVMSMEELLQHFK  618



>ref|XP_006483810.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=718

 Score =   364 bits (935),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  505  PEKYLGDLATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATL  564

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  565  QLDFQLPDRFNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  624

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  625  IVCPVSEKSQPYALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAK  684

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD  DH  M++++LL HFK+ + +++
Sbjct  685  SGQVSVRVRDQGDHSNMSIEDLLKHFKEKLEAFQ  718



>ref|XP_003613276.1| Threonyl-tRNA synthetase [Medicago truncatula]
 gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=711

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+WEKAEA+L +AL+EFGKPW++NEGDGAFYGPKIDISV DA++RKFQCATL
Sbjct  498  PEKYLGNIETWEKAEASLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALRRKFQCATL  557

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  558  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  617

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            ++CPVS+KSQAY +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  618  ILCPVSEKSQAYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAK  677

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKD  84
            TG+VSVRVRD  DH VMT++ LL HFKD
Sbjct  678  TGQVSVRVRDKADHSVMTIENLLEHFKD  705



>gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=599

 Score =   358 bits (919),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  386  PEKYLGDIATWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATL  445

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  446  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  505

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  506  IVCPVSEKSQSYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEAN  565

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD+ +HKVM++++LL HF+D  A+++
Sbjct  566  SGQVSVRVRDLAEHKVMSIEKLLEHFRDKTAAFE  599



>ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=719

 Score =   361 bits (927),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+WEKAE +L +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  506  PEKYLGDIETWEKAENSLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATL  565

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  566  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  625

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            ++CPVS+KSQAY +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  626  ILCPVSEKSQAYALKVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAN  685

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HF+D +A++
Sbjct  686  TGQVSVRVRDKADHSVMSIENLLKHFEDEVAAF  718



>ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=710

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  497  PEKYLGDIATWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATL  556

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  557  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  616

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQAY +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  617  IVCPVSEKSQAYALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAN  676

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD+ +HKVM++++LL HF+D  A+++
Sbjct  677  TGQVSVRVRDLAEHKVMSIEKLLEHFRDKAAAFE  710



>ref|XP_006346202.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=413

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G+L+SW+KAE AL +ALNEFGKPWEIN+GDGAFYGPKIDISV DAMKR  QCATL
Sbjct  200  PEKYIGNLQSWKKAEDALAEALNEFGKPWEINKGDGAFYGPKIDISVSDAMKRNLQCATL  259

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNL Y AE +  RERPVMIHRAILGSVERMFAIL EH+KGKWPFWLSPRQA
Sbjct  260  QLDFQLPERFNLLYVAEYDQIRERPVMIHRAILGSVERMFAILFEHYKGKWPFWLSPRQA  319

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y  E+  R+H+A +HVD+D SD+T+ KKVREAQ+ QYNYILVVGE+EA 
Sbjct  320  IVCPVSNKSQSYAFEIWKRLHDARYHVDIDVSDKTVGKKVREAQLVQYNYILVVGEEEAK  379

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
             G+VSVRVRD  DH+VMTVDELL  FKD++AS++
Sbjct  380  NGQVSVRVRDKRDHQVMTVDELLDQFKDMVASFQ  413



>ref|XP_010533069.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=714

 Score =   359 bits (922),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W++AE AL +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  501  PEKYLGDLVTWDRAENALKEALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATL  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  561  QLDFQLPDRFKLEYSAEDEAKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KS  Y +++++++H AG++VDVDTSDR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  621  IVCPVSEKSSPYALKVKEQVHNAGYYVDVDTSDRKIQKKVREAQLAQYNFILVVGEEEAA  680

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DHKVM++++LL HFKD +A+Y
Sbjct  681  TGQVSVRVRDKSDHKVMSIEDLLNHFKDEVAAY  713



>gb|KDO82533.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=325

 Score =   347 bits (889),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 196/248 (79%), Gaps = 34/248 (14%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  78   PEKYLGDLATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATL  137

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  138  QLDFQLPDRFNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  197

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKK---------------------  231
            +VCPVS+KSQ Y +++RD I+ AG++VDVDT+DR IQKK                     
Sbjct  198  IVCPVSEKSQPYALQVRDHIYRAGYYVDVDTTDRKIQKKPNSFVHARSTYIEVVFSCWEE  257

Query  230  -------------VREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHF  90
                         VREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  DH  M++++LL HF
Sbjct  258  LVAGINIYPIRVSVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQGDHSNMSIEDLLKHF  317

Query  89   KDLMASYK  66
            K+ + +++
Sbjct  318  KEKLEAFQ  325



>gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=725

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  512  PEKYLGDIATWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATL  571

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  572  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  631

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQAY +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  632  IVCPVSEKSQAYALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAN  691

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD+ +HKVM++++LL HF+D  A+++
Sbjct  692  TGQVSVRVRDLAEHKVMSIEKLLEHFRDKAAAFE  725



>ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=717

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  504  PEKYLGDIATWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATL  563

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  564  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  623

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  624  IVCPVSEKSQSYALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEAN  683

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD+ +HKVM++++LL HF+D  A+++
Sbjct  684  SGQVSVRVRDLAEHKVMSIEKLLEHFRDKTAAFE  717



>ref|XP_007157476.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
 gb|ESW29470.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
Length=707

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +W+KAE+AL +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  494  PEKYLGDIATWDKAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATL  553

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  554  QLDFQLPDRFKLEFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  613

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQAY +++RD+IH+AG+ VD DT+DR IQKKVREAQ+AQ+NYILVVGE+EA 
Sbjct  614  IVCPVSEKSQAYALQVRDQIHQAGYQVDADTTDRKIQKKVREAQLAQFNYILVVGEEEAN  673

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DHKVM++++LL HF+D  A++
Sbjct  674  TGQVSVRVRDKGDHKVMSIEDLLKHFRDEAAAF  706



>ref|XP_009412586.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W+KAEAAL++ALNEFG+PW+INEGDGAFYGPKIDI V DA+ RKFQCATL
Sbjct  518  PEKYLGDIETWDKAEAALSEALNEFGRPWQINEGDGAFYGPKIDIGVFDALNRKFQCATL  577

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  578  QLDFQLPLRFKLSYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  637

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y  ++ D+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  638  IVCPVSEKSQSYAQQVHDKIHQAGYYVDADLTDRKIQKKVREAQLAQYNYILVVGEEEAK  697

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HFK+ +A++
Sbjct  698  TGQVSVRVRDGSDHSVMSLEALLEHFKEEVAAF  730



>ref|XP_006836673.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
 gb|ERM99526.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
Length=723

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W+KAE AL +AL+EFG+ WEIN GDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  510  PEKYLGDIETWDKAEGALKEALDEFGRDWEINTGDGAFYGPKIDISVFDALKRKFQCATL  569

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  570  QLDFQLPARFNLTYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  629

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQAY +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  630  IVCPVSEKSQAYALKVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEAN  689

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            T +VSVRVRD  DH V  +++LL  F++  A+++
Sbjct  690  TNQVSVRVRDKSDHSVKFMEDLLTQFREDTAAFR  723



>ref|XP_004296467.2| PREDICTED: threonine--tRNA ligase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 192/214 (90%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  518  PEKYLGDIETWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  577

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQ
Sbjct  578  QLDFQLPARFELYYSAEGEEGKREAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQ  637

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y  ++RDRI +AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  638  AIVCPVSDKSQPYAQQVRDRIFQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEV  697

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
             TG+VSVRVRD  D  VM++D LL HFK+ + ++
Sbjct  698  KTGQVSVRVRDKGDSNVMSMDGLLEHFKNEVEAF  731



>gb|KDP21323.1| hypothetical protein JCGZ_21794 [Jatropha curcas]
Length=676

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+WEKAE AL  AL+EFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  463  PEKYLGKLETWEKAEDALKLALDEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  522

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  523  QLDFQLPDRFELEYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  582

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y  +++ +IH+AG+HVDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  583  IVCPVSEKSQPYAEQVQAQIHKAGYHVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAK  642

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM+++ LL HF+D +A++
Sbjct  643  TGQVSVRVRDKGDHSVMSMESLLKHFEDEVAAF  675



>ref|XP_009360487.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009363511.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=676

 Score =   355 bits (911),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK++GDL +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATL
Sbjct  462  PEKHMGDLATWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATL  521

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLPQ+F L+YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQ
Sbjct  522  QLDFQLPQKFELNYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQ  581

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y +E+RDRIH+AG++VDVDT+DRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  582  AIVCPVSDKSQPYALEVRDRIHQAGYYVDVDTTDRTIQKKVREAQIAQYNYILVVGEEEV  641

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
             TG+VS+RVRD  D  VMT+D LL HFK
Sbjct  642  KTGQVSLRVRDKGDVSVMTMDNLLQHFK  669



>ref|XP_010913364.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Elaeis guineensis]
Length=727

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W++AEAALTDALNEFG+PW+INEGDGAFYGPKIDI V DA+KRKFQC TL
Sbjct  514  PEKYLGDIETWDQAEAALTDALNEFGRPWQINEGDGAFYGPKIDIGVFDALKRKFQCGTL  573

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  574  QLDFQLPLRFKLSYSAEDEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  633

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS+KS+ Y  ++RD+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  634  IVCNVSEKSEDYAKQVRDQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAK  693

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH  M+++ LL HFK+  A+Y
Sbjct  694  TGQVSVRVRDGSDHSTMSMEALLTHFKEEAAAY  726



>ref|XP_002311580.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE88947.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=715

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+W++AE ALT+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  502  PEKYLGVLETWDEAEKALTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATL  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE++ E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  562  QLDFQLPDRFKLEYSAEDEARSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IHEAG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ 
Sbjct  622  IVCPVSEKSQSYALQVRDQIHEAGYYVDVDATDRKIQKKVREAQLAQYNYILVVGEEESK  681

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  DH VM+++ LL  FK+L+A ++
Sbjct  682  TGQVSVRVRDNADHSVMSIESLLGLFKELVADFR  715



>ref|XP_008340003.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Malus 
domestica]
Length=676

 Score =   353 bits (906),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK++GDL +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATL
Sbjct  462  PEKHMGDLATWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATL  521

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLPQ+F L YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQ
Sbjct  522  QLDFQLPQKFELYYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQ  581

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  582  AIVCPVSDKSQPYAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEV  641

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
             TG+VS+RVRD  D  VMT++ LL HFK
Sbjct  642  KTGQVSLRVRDHGDVTVMTMENLLQHFK  669



>ref|XP_011025470.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=715

 Score =   354 bits (908),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+W++AE ALT+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  502  PEKYLGVLETWDEAEKALTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATL  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF + YSAEDE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  562  QLDFQLPDRFKVEYSAEDEAKSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IHEAG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ 
Sbjct  622  IVCPVSEKSQSYALQVRDQIHEAGYFVDVDATDRKIQKKVREAQLAQYNYILVVGEEESK  681

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  DH VM+++ LL  FK+L+A ++
Sbjct  682  TGQVSVRVRDNADHSVMSIESLLGLFKELVADFR  715



>ref|XP_010551550.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=717

 Score =   353 bits (907),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W++AE AL +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  504  PEKYLGDLATWDRAENALKEALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATL  563

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  564  QLDFQLPDRFKLEYSAEDEAKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  623

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KS  Y +++RD+IH+AG++VDVD SDR IQKKVREAQ+AQYNYILVVGE EA 
Sbjct  624  IVCPVSEKSSPYALKVRDQIHDAGYYVDVDLSDRKIQKKVREAQLAQYNYILVVGEDEAK  683

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH V +++ LL  FKD  A+Y
Sbjct  684  TGQVSVRVRDKSDHSVKSIEGLLQQFKDEAAAY  716



>ref|XP_008361801.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Malus domestica]
Length=731

 Score =   354 bits (908),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK++GDL +WEKAEAAL DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATL
Sbjct  517  PEKHMGDLATWEKAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATL  576

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLPQ+F L YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQ
Sbjct  577  QLDFQLPQKFELYYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQ  636

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  637  AIVCPVSDKSQPYAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEV  696

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
             TG+VS+RVRD  D  VMT++ LL HFK
Sbjct  697  KTGQVSLRVRDHGDVTVMTMENLLQHFK  724



>ref|XP_006378416.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP56213.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=696

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+WE+AE  L +ALNEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  483  PEKYLGALETWEEAEKDLAEALNEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATL  542

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  543  QLDFQLPDRFKLEYSAEDEAKSETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  602

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y ++++D+IHEAG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  603  IVCPVSEKSQSYALQVQDQIHEAGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAK  662

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD  DH VM+++ LL  FKD +A ++
Sbjct  663  TGQVSVRMRDNADHSVMSIESLLKLFKDAVADFR  696



>gb|KJB48103.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=533

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W +AEAALT+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  320  PEKYLGDLETWNRAEAALTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  379

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  380  QLDFQLPERFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  439

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y M++RD IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  
Sbjct  440  IVCPVSEKSQQYAMQVRDWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMN  499

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFK  87
            T +VSVRVRD  D   M++++LL HF+
Sbjct  500  TKKVSVRVRDSGDFSGMSIEDLLNHFQ  526



>gb|EEC83306.1| hypothetical protein OsI_28675 [Oryza sativa Indica Group]
Length=306

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  93   PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  152

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  153  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  212

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  213  IVCSISSNSVEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAE  272

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  273  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  306



>ref|XP_007225203.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
 gb|EMJ26402.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
Length=724

 Score =   351 bits (901),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +WEKAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  510  PEKYLGDVATWEKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATL  569

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQ
Sbjct  570  QLDFQLPTRFELYYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQ  629

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  630  AIVCPVSDKSQPYALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEV  689

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
             TG+VS+RVRD  D  VM+++ LL HFK
Sbjct  690  KTGQVSLRVRDKGDVTVMSMENLLQHFK  717



>ref|XP_008802022.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Phoenix dactylifera]
Length=727

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W+KAEAAL+DALNEFG+PW INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  514  PEKYLGDIETWDKAEAALSDALNEFGRPWLINEGDGAFYGPKIDIGVFDALKRKFQCATL  573

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  574  QLDFQLPLRFKLSYSAEDEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  633

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS+KS+ Y  ++RD+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  634  IVCNVSEKSEDYAKQVRDQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAK  693

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH   +++ LL H K+ +A+Y
Sbjct  694  TGQVSVRVRDGSDHSTKSMEALLTHLKEEVAAY  726



>ref|XP_008221771.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Prunus 
mume]
Length=721

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +WEKAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  507  PEKYLGDVATWEKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATL  566

Query  527  QLDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQ
Sbjct  567  QLDFQLPARFELYYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQ  626

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVSDKSQ Y +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E 
Sbjct  627  AIVCPVSDKSQPYALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEV  686

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
             TG+VS+RVRD  D  VM+++ LL HFK
Sbjct  687  KTGQVSLRVRDKGDVTVMSMENLLQHFK  714



>ref|XP_009599596.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   339 bits (869),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE  +GD E+WEKAE AL +AL EFGKPW   EGDGAFYGPKIDI+V DAM R+FQCATL
Sbjct  193  PENSIGDEETWEKAEGALVEALEEFGKPWGRKEGDGAFYGPKIDITVSDAMNREFQCATL  252

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RF L+Y AED S  ERPVMIHRAILGSVERMFAIL EHF+GKWPFWLSPRQA
Sbjct  253  QLDFQLPERFELTYKAEDGSD-ERPVMIHRAILGSVERMFAILCEHFEGKWPFWLSPRQA  311

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MVCPVS+KSQ+Y +ELR +IH+AG++VDV+TSD+T+QKKVREAQ A+YNYILVVGE EA 
Sbjct  312  MVCPVSNKSQSYALELRKQIHDAGYYVDVETSDKTLQKKVREAQEAKYNYILVVGEAEAK  371

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VSVRVRD  D +VMTVD+LL HFKD++AS++
Sbjct  372  SGQVSVRVRDNRDIQVMTVDDLLHHFKDIVASFQ  405



>gb|KJB48102.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=714

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W +AEAALT+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  501  PEKYLGDLETWNRAEAALTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  561  QLDFQLPERFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y M++RD IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  
Sbjct  621  IVCPVSEKSQQYAMQVRDWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMN  680

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFK  87
            T +VSVRVRD  D   M++++LL HF+
Sbjct  681  TKKVSVRVRDSGDFSGMSIEDLLNHFQ  707



>ref|XP_010688668.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=688

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E+W+KAEAALT+ALNE GKPW++NEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  475  PEKFLGDIETWDKAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALKRKFQCATL  534

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYSAEDE+KRERPV+IHRAILGSVERMFAILLEH+KGKWP WLSPRQA
Sbjct  535  QLDFQLPLRFNLSYSAEDEAKRERPVIIHRAILGSVERMFAILLEHYKGKWPLWLSPRQA  594

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS+KS AY  E+ D+IH+AG+ VDVDTSDRTI KKVREAQ++QYNYILVVGEK+A 
Sbjct  595  IVCNVSEKSSAYAHEVCDQIHKAGYFVDVDTSDRTINKKVREAQLSQYNYILVVGEKDAE  654

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
               V+VRVRD  +H  M+V+ LL HF + + +Y
Sbjct  655  NRVVTVRVRDKNEHSPMSVENLLKHFGEEVKAY  687



>ref|XP_007044584.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
 gb|EOY00416.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
Length=686

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WE+AEAALT+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  473  PEKYLGDLATWERAEAALTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  532

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  533  QLDFQLPDRFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  592

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS KSQ Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  
Sbjct  593  IVCPVSAKSQDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMN  652

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T +VSVRVRD  D   M+++ LL H KD +A++
Sbjct  653  TKQVSVRVRDKGDLTSMSIEGLLQHLKDEIAAF  685



>ref|XP_007044582.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY00414.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=715

 Score =   345 bits (886),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WE+AEAALT+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  502  PEKYLGDLATWERAEAALTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  562  QLDFQLPDRFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS KSQ Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  
Sbjct  622  IVCPVSAKSQDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMN  681

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T +VSVRVRD  D   M+++ LL H KD +A++
Sbjct  682  TKQVSVRVRDKGDLTSMSIEGLLQHLKDEIAAF  714



>emb|CAC79651.1| threonyl-tRNA synthetase [Oryza sativa Japonica Group]
Length=531

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  318  PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  377

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  378  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  437

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+ YILVVG +EA 
Sbjct  438  IVCSISSNSVEYAKQVRVRIHEAGFHVAIDETDRTIQKKVREAQLAQFKYILVVGAQEAE  497

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  498  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  531



>ref|XP_011021655.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=678

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+WE+AE AL +ALNEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  465  PEKYLGTLETWEEAEKALAEALNEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATL  524

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+K E PVMIHRAILGSVERMFA+LLEH+KGKWPFWLSPRQA
Sbjct  525  QLDFQLPDRFKLEYSAEDEAKSETPVMIHRAILGSVERMFAVLLEHYKGKWPFWLSPRQA  584

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y ++++D+IHEAG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  585  IVCPVSEKSQSYALQVQDQIHEAGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAK  644

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  DH VM+++ LL  FKD ++ ++
Sbjct  645  TGQVSVRVRDNADHSVMSIESLLKLFKDAVSDFR  678



>gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group]
Length=701

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  488  PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  547

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  548  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  607

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  608  IVCSISSNSVEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAE  667

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  668  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  701



>ref|XP_006659275.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Oryza 
brachyantha]
Length=696

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  483  PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  542

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  543  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  602

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  603  IVCSISSNSVEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAE  662

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  663  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  696



>ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score =   340 bits (871),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  532  PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  591

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  592  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  651

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  652  IVCSISSNSVEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAE  711

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  712  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  745



>dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group]
Length=749

 Score =   340 bits (871),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  536  PEKYLGDIETWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  595

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  596  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  655

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  656  IVCSISSNSVEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAE  715

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVRVRD  +   +++D+++  FK+ +A+YK
Sbjct  716  TGQVSVRVRDKAELATVSIDDIITRFKEEVAAYK  749



>ref|XP_004510448.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=458

 Score =   330 bits (847),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK   DLE WEKAE  L +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQC TL
Sbjct  244  PEKIFKDLEMWEKAENELREALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCGTL  303

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP  F L +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA
Sbjct  304  QLDFQLPDSFKLEFSTEDEAKIERPVMIHRSILGSVESMFAILLEHYKGKWPFWLSPRQA  363

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            ++CPVS+KSQAY +++RD+IHE G+HVD DT+D  IQKKV EA++AQYNYILVVGE EA 
Sbjct  364  ILCPVSEKSQAYALQVRDQIHEEGYHVDADTTDMEIQKKVEEARLAQYNYILVVGEDEAN  423

Query  167  TGEVSVRVRDIPDHK-VMTVDELLAHFKDLMASY  69
            TG+VSV+VRD  DH  +M+++ LL HFKD +A++
Sbjct  424  TGQVSVQVRDNEDHSIIMSIENLLKHFKDEVAAF  457



>ref|XP_010044651.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW86747.1| hypothetical protein EUGRSUZ_B03357 [Eucalyptus grandis]
Length=737

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+ +WEKAEAAL +ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  524  PEKYLGDIVTWEKAEAALAEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  583

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  584  QLDFQLPARFELSYSAEDEGKTETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  643

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ+Y +++RD+IH+AG++VDVD +DR IQKKVREAQ+AQYN+ILVVGE+EA 
Sbjct  644  IVCPVSEKSQSYALKVRDQIHDAGYYVDVDETDRKIQKKVREAQLAQYNFILVVGEEEAN  703

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD  DH VM V++LL  F++ +A++
Sbjct  704  TGQVSVRVRDKSDHSVMRVEDLLKFFQEEVAAF  736



>ref|XP_004973168.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=739

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+++W KAE  LT+ALNEFGKPW+IN+GDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  526  PEKYLGDIDTWNKAEQQLTEALNEFGKPWQINKGDGAFYGPKIDIGVFDALKRKFQCATL  585

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  586  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  645

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  ++  R+HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  646  IVCSVSSGSVEYAKQVLARLHEAGFHVDIDMSDRTIQKKVREAQMAQFNYILVVGAQEAE  705

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG V VRVRD  D   M VD L+  F++  A++K
Sbjct  706  TGNVCVRVRDSADLATMNVDGLITRFREETAAFK  739



>ref|XP_006394912.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
 gb|ESQ32198.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
Length=712

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  499  PEKYLGDLETWDKAEKDLKVALDAFGKKWQLNEGDGAFYGPKIDITVSDAMNRKFQCATL  558

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  559  QLDFQLPDRFKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  618

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y +E+  +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  619  IVCPISKKSEEYALEVEKKIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAK  678

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V ++++LL  FK   A Y+
Sbjct  679  TGQVSVRLRDSAAHSVKSIEDLLEEFKTKTAEYQ  712



>dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATL
Sbjct  498  PEKYLGDIETWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATL  557

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  558  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  617

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S AY  E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA 
Sbjct  618  IVCCVSSNSLAYAKEVHAQIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAE  677

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+V +RVRD  D    ++ +++A F D +AS+K
Sbjct  678  SGKVVLRVRDKADLSTESIADVIARFSDEVASFK  711



>emb|CDX80596.1| BnaC07g28480D [Brassica napus]
Length=714

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATL
Sbjct  501  PEKYLGDLATWDKAENDLKVALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATL  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YS +DE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  561  QLDFQLPDRFKLEYSGDDEAKRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y ++++++IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  621  IVCPISKKSEEYALKVKEQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAA  680

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V ++D+LL  FK   A Y+
Sbjct  681  TGQVSVRIRDSAAHSVKSIDDLLEEFKTKTAEYQ  714



>ref|XP_009151164.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
 emb|CDX88245.1| BnaA06g28360D [Brassica napus]
Length=718

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W+KAE  L  AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATL
Sbjct  505  PEKYLGDLATWDKAENDLKVALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATL  564

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YS +DE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  565  QLDFQLPDRFKLEYSGDDEAKRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  624

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y ++++++IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  625  IVCPISKKSEEYALKVKEQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAA  684

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V ++D+LL  FK   A Y+
Sbjct  685  TGQVSVRIRDSAAHSVKSIDDLLEEFKTKTAEYQ  718



>ref|XP_004500860.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=508

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE+   D E WEK E AL +AL+EFGKPW++ EG+GAFYGPKIDISV DA  RKFQC TL
Sbjct  295  PERCFRDFEMWEKTENALREALDEFGKPWQLIEGEGAFYGPKIDISVSDAFSRKFQCGTL  354

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP  F L +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA
Sbjct  355  QLDFQLPDSFKLEFSTEDEAKTERPVMIHRSILGSVEHMFAILLEHYKGKWPFWLSPRQA  414

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            ++CPVS+KSQAY +++RD+IH+AG++VDVDT+D  IQKKV EA+V QYNYILVVGE+EA 
Sbjct  415  ILCPVSEKSQAYALQVRDQIHQAGYYVDVDTTDSKIQKKVHEARVTQYNYILVVGEEEAN  474

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKD  84
            TG+VSV++RD  DH V+++++LL HFKD
Sbjct  475  TGQVSVQLRDKEDHCVLSIEDLLKHFKD  502



>ref|XP_009111770.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brassica rapa]
Length=707

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  494  PEKYLGDLAAWDKAENDLKIALDAFGKTWVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  553

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  554  QLDFQLPDRFKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  613

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y ++++ +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  614  IVCPISKKSEEYALQVKKQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAA  673

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V +++ LL  FK   A Y+
Sbjct  674  TGQVSVRIRDSAAHSVKSIENLLEEFKTKTAEYQ  707



>gb|KFK26446.1| hypothetical protein AALP_AA8G249500 [Arabis alpina]
Length=714

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD E+W+KAE  L  AL+ FGKPW +N GDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  501  PEKYLGDSETWDKAEKDLKVALDAFGKPWLLNPGDGAFYGPKIDITVSDAMNRKFQCATL  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y+AEDE+K ERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  561  QLDFQLPDRFKLEYAAEDEAKIERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y +++++RIH+AG++VD D SDR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  621  IVCPISKKSEIYALQVKERIHQAGYYVDADISDRKIDKKVREAQLAQYNYILVVGETEAA  680

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V ++D+LL  FK   A Y+
Sbjct  681  TGQVSVRLRDSAAHLVKSIDDLLEDFKAKTAEYQ  714



>ref|XP_004968434.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=741

 Score =   329 bits (843),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W K E  LT+ALNEFG PW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  528  PEKYLGDIETWNKPEQQLTEALNEFGMPWQINEGDGAFYGPKIDIGVFDALKRKFQCATL  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  588  QLDFQLPLRFKLSYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  647

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  ++  R+HEAGFHVD+D SDRTIQKKVREAQVAQ+NY LVVG +EA 
Sbjct  648  IVCSVSSGSVEYAKQVLARLHEAGFHVDIDMSDRTIQKKVREAQVAQFNYTLVVGAQEAE  707

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG VSVRVR       M++D L+  F++ +A++K
Sbjct  708  TGNVSVRVRGSDGLATMSLDGLITRFREEIAAFK  741



>emb|CDX87030.1| BnaC09g03450D [Brassica napus]
Length=719

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  506  PEKYLGDLATWDKAENDLKIALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  565

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSA+DE+KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  566  QLDFQLPDRFKLEYSADDEAKRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  625

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y ++++ +IHEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  626  IVCPISKKSEEYALQVKKQIHEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAA  685

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V +++ LL  FK   + Y+
Sbjct  686  TGQVSVRIRDSAAHSVKSIENLLEEFKTKTSEYQ  719



>ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
 gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
Length=739

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  526  PEKYLGEIETWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATL  585

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  586  QLDFQLPIRFKLAYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  645

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  ++   +HEAGFH D+D SDRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  646  IVCSVSSGSVEYAKQVLATLHEAGFHADIDASDRTIQKKVREAQLAQFNYILVVGAQEAE  705

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG + VRVRD  D   M+VD  +   K+ +A+++
Sbjct  706  TGNICVRVRDNADLATMSVDGFVTRLKEEIAAFR  739



>ref|XP_008664856.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Zea mays]
Length=737

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  524  PEKYLGEIETWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATL  583

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  584  QLDFQLPIRFKLTYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  643

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  ++   +HEA FHVD+D SDRTIQKKVREAQVAQ+NYILVVG +EA 
Sbjct  644  IVCSVSSGSVEYAKQVLAMLHEADFHVDIDVSDRTIQKKVREAQVAQFNYILVVGAQEAE  703

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG V VRVRD  D   M+VD L+   ++ + ++K
Sbjct  704  TGNVCVRVRDNADLATMSVDGLITRLREEIVAFK  737



>ref|XP_003573669.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=736

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+AL+EFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  523  PEKYLGDIETWNKAEQQLTEALDEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATL  582

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  583  QLDFQLPLRFKLSYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  642

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA 
Sbjct  643  IVCCVSSNSLEYAKEVHAKIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAE  702

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+V +RVRD  +    ++ +++  F D +AS++
Sbjct  703  TGKVVLRVRDKAELSTESIADVITRFSDEIASFQ  736



>gb|AAK82468.1| AT5g26830/F2P16_90 [Arabidopsis thaliana]
 gb|AAO64760.1| At5g26830/F2P16_90 [Arabidopsis thaliana]
Length=676

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  463  PEKYLGDLETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  522

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  523  QLDFQLPIRFNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  582

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  583  IVCPISEKSQQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  642

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD   H V ++++LL  FK   A +
Sbjct  643  TGQVSVRVRDNAAHSVKSIEDLLEEFKAKTAEF  675



>emb|CDM81189.1| unnamed protein product [Triticum aestivum]
Length=706

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATL
Sbjct  493  PEKYLGDIETWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATL  552

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  553  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  612

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA 
Sbjct  613  IVCCVSANSLTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAE  672

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            +G+VS+RVRD  D    ++ +++A F D +AS++
Sbjct  673  SGKVSLRVRDRADLSTESIADVIARFNDEVASFQ  706



>ref|NP_198035.2| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O04630.3|SYTM_ARATH RecName: Full=Threonine--tRNA ligase, mitochondrial; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93610.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  496  PEKYLGDLETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  555

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  556  QLDFQLPIRFNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  615

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  616  IVCPISEKSQQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  675

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD   H V ++++LL  FK   A +
Sbjct  676  TGQVSVRVRDNAAHSVKSIEDLLEEFKAKTAEF  708



>emb|CAA74705.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  496  PEKYLGDLETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  555

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  556  QLDFQLPIRFNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  615

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  616  IVCPISEKSQQYAEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  675

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVRVRD   H V ++++LL  FK   A +
Sbjct  676  TGQVSVRVRDNAAHSVKSIEDLLEEFKAKTAEF  708



>ref|XP_002872240.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48499.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  500  PEKYLGELETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  559

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL Y+AEDE+K+ +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  560  QLDFQLPIRFNLEYAAEDEAKKAKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  619

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++  IH+AGF++D D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  620  IVCPISEKSQKYAEKVQKEIHDAGFYIDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  679

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVR+RD   H V ++++LL  FK  +A +
Sbjct  680  TGQVSVRLRDSAAHSVKSIEDLLEEFKAKIAEF  712



>ref|XP_002521030.1| threonyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF41447.1| threonyl-tRNA synthetase, putative [Ricinus communis]
Length=691

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAE++L  AL++FGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATL
Sbjct  501  PEKYLGDLATWEKAESSLKSALDDFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATL  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  561  QLDFQLPDRFELEYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+KSQ Y ++++D+IH+AG+++DVD +DR IQKKVREAQ+AQYNYILVVGE+EA 
Sbjct  621  IVCPVSEKSQEYAVQVQDQIHKAGYYIDVDLTDRKIQKKVREAQLAQYNYILVVGEEEAK  680

Query  167  TGEVS  153
            TG+V+
Sbjct  681  TGQVA  685



>ref|XP_006289423.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
 gb|EOA22321.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
Length=713

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG LE+W+KAE  L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  500  PEKYLGTLETWDKAEEDLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  559

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RF L Y+AEDE+KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  560  QLDFQLPERFKLEYAAEDEAKRGRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  619

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++ +IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  620  IVCPISEKSQKYAEKVQKQIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  679

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVR+RD   H V ++++LL  FK   A +
Sbjct  680  TGQVSVRLRDSAAHSVKSIEDLLEEFKSKTAEF  712



>ref|XP_008644625.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Zea mays]
 gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays]
Length=739

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+W KAE  LT+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATL
Sbjct  526  PEKYLGEVETWNKAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATL  585

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERM AILLEH+ GKWP WLSPRQA
Sbjct  586  QLDFQLPIRFKLAYSAEDEAKIERPVMIHRAILGSVERMLAILLEHYNGKWPLWLSPRQA  645

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  ++   +HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA 
Sbjct  646  IVCSVSSGSVEYAKQVLATLHEAGFHVDIDASDRTIQKKVREAQLAQFNYILVVGAQEAE  705

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG + VRVRD  D    +VD  +   ++ +A++K
Sbjct  706  TGNICVRVRDNADLVTTSVDGFITRLREEIAAFK  739



>ref|XP_010027611.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X3 [Eucalyptus grandis]
Length=418

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y+GD  +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATL
Sbjct  205  PENYIGDERTWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATL  264

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA
Sbjct  265  QLDFQLPVRFGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQA  324

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PVS+KS++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A 
Sbjct  325  IVFPVSEKSRSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAG  384

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+V+V  RD  D  VMT+ +LL  FK+  A++
Sbjct  385  TGQVTVHARDEADKIVMTIADLLKVFKEKSAAF  417



>ref|XP_010027610.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Eucalyptus grandis]
Length=432

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y+GD  +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATL
Sbjct  219  PENYIGDERTWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATL  278

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA
Sbjct  279  QLDFQLPVRFGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQA  338

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PVS+KS++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A 
Sbjct  339  IVFPVSEKSRSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAG  398

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+V+V  RD  D  VMT+ +LL  FK+  A++
Sbjct  399  TGQVTVHARDEADKIVMTIADLLKVFKEKSAAF  431



>gb|KCW54156.1| hypothetical protein EUGRSUZ_I00127 [Eucalyptus grandis]
Length=448

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y+GD  +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATL
Sbjct  235  PENYIGDERTWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATL  294

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA
Sbjct  295  QLDFQLPVRFGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQA  354

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PVS+KS++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A 
Sbjct  355  IVFPVSEKSRSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAG  414

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+V+V  RD  D  VMT+ +LL  FK+  A++
Sbjct  415  TGQVTVHARDEADKIVMTIADLLKVFKEKSAAF  447



>ref|XP_008237148.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like, partial 
[Prunus mume]
Length=648

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE ++GDL +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATL
Sbjct  434  PESHMGDLATWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATL  493

Query  527  QLDFQLPQRFNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQ
Sbjct  494  QLDFQLPDRFKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQ  553

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVS  +  Y +++RD+IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E 
Sbjct  554  AIVCPVSHTALPYALQVRDQIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEV  613

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
              G+VSVRVRD  D  VM+++ LL HFKD + ++
Sbjct  614  QNGQVSVRVRDKGDVTVMSMESLLQHFKDQVEAF  647



>ref|XP_010493938.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Camelina 
sativa]
Length=712

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KYLG +E+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  499  PDKYLGSVETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  558

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y+AEDE+KR +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  559  QLDFQLPDRFKLEYAAEDEAKRVKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  618

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++  IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  619  IVCPISEKSQKYAEKVQKEIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  678

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVR+RD   H V ++++LL  FK   A +
Sbjct  679  TGQVSVRLRDSAAHSVKSIEDLLEEFKAKTAEF  711



>ref|XP_010027608.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010027609.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
Length=505

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y+GD  +WEKAE+ALT+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATL
Sbjct  292  PENYIGDERTWEKAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATL  351

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF LSY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA
Sbjct  352  QLDFQLPVRFGLSYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQA  411

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PVS+KS++Y +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A 
Sbjct  412  IVFPVSEKSRSYSLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAG  471

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+V+V  RD  D  VMT+ +LL  FK+  A++
Sbjct  472  TGQVTVHARDEADKIVMTIADLLKVFKEKSAAF  504



>ref|XP_007199721.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
 gb|EMJ00920.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
Length=691

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 179/214 (84%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE ++GDL +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATL
Sbjct  477  PESHMGDLATWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATL  536

Query  527  QLDFQLPQRFNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQ
Sbjct  537  QLDFQLPDRFKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQ  596

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVS  +  Y +++RD IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E 
Sbjct  597  AIVCPVSHTALPYALQVRDCIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEV  656

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
              G+VSVRVRD  D  VM+++ LL HFKD + ++
Sbjct  657  QNGQVSVRVRDKGDVTVMSMESLLQHFKDQVEAF  690



>ref|XP_010455043.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Camelina sativa]
Length=716

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KYLGD E+W+KAEA L +A+  FGKP  +N+GDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  503  PDKYLGDEETWDKAEADLKEAIEAFGKPLVLNKGDGAFYGPKIDITVSDAMNRKFQCATL  562

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y+AEDE++R +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  563  QLDFQLPARFKLEYAAEDEAQRGKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  622

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S+KSQ Y  +++  IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA 
Sbjct  623  IVCPISEKSQKYAEKVQKEIHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAA  682

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+VSVR+RD   H V ++++LL  FK   A +
Sbjct  683  TGQVSVRLRDSAAHSVKSIEDLLEEFKAKTAEF  715



>gb|AAB61048.1| Similar to threonyl-tRNA synthetase; coded for by A. thaliana 
cDNA R65376 [Arabidopsis thaliana]
Length=702

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 180/226 (80%), Gaps = 13/226 (6%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W+KAEA L +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  476  PEKYLGDLETWDKAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  535

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA
Sbjct  536  QLDFQLPIRFNLEYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQA  595

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKK-------------VREAQVAQ  207
            +VCP+S+KSQ Y  +++ +I +AGF+VD D +DR I KK             VREAQ+AQ
Sbjct  596  IVCPISEKSQQYAEKVQKQIKDAGFYVDADLTDRKIDKKVNDFGSCSKFCSVVREAQLAQ  655

Query  206  YNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            YNYILVVGE EA TG+VSVRVRD   H V ++++LL  FK   A +
Sbjct  656  YNYILVVGETEAATGQVSVRVRDNAAHSVKSIEDLLEEFKAKTAEF  701



>ref|XP_007200687.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
 gb|EMJ01886.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
Length=689

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE ++GDL +W+KAEAAL +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATL
Sbjct  475  PESHMGDLATWKKAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALNRDHQLATL  534

Query  527  QLDFQLPQRFNLSYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF L YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQ
Sbjct  535  QLDFQLPDRFKLYYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQ  594

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+VCPVS  +  Y +++RD++H+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E 
Sbjct  595  AIVCPVSHTALPYALQVRDQLHQAGYYVDVDTSDKTIQKKVRQAQMAQYNYILVVGAEEV  654

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
              G+VSVRVRD  D  VM+++ LL HF+D + ++
Sbjct  655  QNGQVSVRVRDKGDVTVMSMEGLLQHFEDQVEAF  688



>ref|XP_001784310.1| predicted protein [Physcomitrella patens]
 gb|EDQ50872.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E+W +AE AL  ALN FGKPW+INE DGAFYGPKIDI+V DA+KRKFQCAT+
Sbjct  472  PEKYLGEIETWNRAEKALEAALNAFGKPWQINEADGAFYGPKIDITVFDALKRKFQCATI  531

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSYS EDE+KRE+PV+IHRAILGSVERMFAILLEH+ GKWPFWLSPRQ 
Sbjct  532  QLDFQLPIRFNLSYSTEDEAKREKPVIIHRAILGSVERMFAILLEHYAGKWPFWLSPRQC  591

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS+K   Y +E+RD I+ AG+  + D +DR +QKK+REAQ+AQ+NYILVVGE+E +
Sbjct  592  IVCPVSEKFTHYAVEVRDAINAAGYFCEADVTDRKLQKKIREAQLAQFNYILVVGEEETS  651

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
              +V++R RD   H   +V ELLA F+   A Y+
Sbjct  652  KKQVNIRTRDNVVHGTKSVTELLADFQKETAEYR  685



>gb|EMT11254.1| Threonyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1098

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATL
Sbjct  428  PEKYLGDIETWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATL  487

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  488  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  547

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA 
Sbjct  548  IVCCVSANSLTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAE  607

Query  167  TGEVSVRVRDIPDHKVMTVDELLA  96
            +G+VS+RVRD  D    ++ +++A
Sbjct  608  SGKVSLRVRDRADLSTESIADVIA  631



>gb|KDO82535.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=266

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WEKAEAALT+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATL
Sbjct  78   PEKYLGDLATWEKAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATL  137

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  138  QLDFQLPDRFNLGYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  197

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKV  228
            +VCPVS+KSQ Y +++RD I+ AG++VDVDT+DR IQKKV
Sbjct  198  IVCPVSEKSQPYALQVRDHIYRAGYYVDVDTTDRKIQKKV  237



>emb|CDY19754.1| BnaA09g04070D [Brassica napus]
Length=609

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 172/214 (80%), Gaps = 6/214 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W+KAE  L  AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATL
Sbjct  402  PEKYLGDLATWDKAENDLKIALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATL  461

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSA+DE+KR+RPVMIHRA+LGSVERMFAI+LEH+KGKWPFWLSPRQA
Sbjct  462  QLDFQLPDRFKLEYSADDEAKRQRPVMIHRAVLGSVERMFAIVLEHYKGKWPFWLSPRQA  521

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCP+S KS+ Y ++++ +IHEAG++      +  +   VREAQ+AQYNYILVVGE EA 
Sbjct  522  IVCPISKKSEEYALQVKKQIHEAGYY------ETILGLGVREAQLAQYNYILVVGETEAA  575

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
            TG+VSVR+RD   H V +++ LL  FK   A Y+
Sbjct  576  TGQVSVRIRDSAAHSVKSIENLLEEFKTKTAEYQ  609



>ref|XP_010497266.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic, partial 
[Camelina sativa]
Length=260

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 171/217 (79%), Gaps = 5/217 (2%)
 Frame = -1

Query  704  EKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQ  525
            E Y+G LE W+ AE  L  AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQ
Sbjct  43   ENYIGTLEEWDMAEKDLKKALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQ  102

Query  524  LDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            LDFQLP+RF L Y  +  + K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  103  LDFQLPERFKLKYKTKVKQDKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  162

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S+   +Y  E++ +IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEAT
Sbjct  163  IVCSLSENYSSYAKEVQKQIHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEAT  222

Query  167  TGEVSVRVRDIP----DHKVMTVDELLAHFKDLMASY  69
            TG+V+VR+R+ P    D   M++D LL  FK    +Y
Sbjct  223  TGQVTVRLREDPAGRKDLPEMSIDSLLDEFKYKTVNY  259



>ref|XP_010476961.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=453

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 171/217 (79%), Gaps = 5/217 (2%)
 Frame = -1

Query  704  EKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQ  525
            E Y+G LE W+ AE  L  AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQ
Sbjct  236  ENYIGTLEEWDMAEKDLKKALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQ  295

Query  524  LDFQLPQRFNLSYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            LDFQLP+RF L Y  +  + K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  296  LDFQLPERFKLKYKTKVKQDKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQA  355

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S+   +Y  E++ +IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEAT
Sbjct  356  IVCSLSENYSSYAKEVQKQIHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEAT  415

Query  167  TGEVSVRVRDIP----DHKVMTVDELLAHFKDLMASY  69
            TG+V+VR+R+ P    D   M++D LL  FK    +Y
Sbjct  416  TGQVTVRLREDPAGRKDLPEMSIDSLLDEFKYKTVNY  452



>gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu]
Length=1047

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E+W KAE  LT+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATL
Sbjct  449  PEKYLGDIETWNKAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATL  508

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L+YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA
Sbjct  509  QLDFQLPLRFKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQA  568

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS  S  Y  E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA 
Sbjct  569  IVCCVSANSLTYAKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAE  628

Query  167  TGEV  156
            +G++
Sbjct  629  SGKI  632



>ref|XP_002890262.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66521.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
Length=620

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KYLGDLE W+KAE  L +ALN+FGK W  N+GDG FYGPKIDI+V DAMKRKFQCAT+
Sbjct  411  PKKYLGDLEKWDKAEKDLEEALNDFGKTWVKNKGDGEFYGPKIDITVYDAMKRKFQCATI  470

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDF LP RF L YSAEDE++ E  V+IHRA+LGSVER+FAILLE +KGK PFWLSPRQA
Sbjct  471  QLDFHLPDRFKLEYSAEDETEIESSVLIHRAVLGSVERLFAILLEQYKGKLPFWLSPRQA  530

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC VS+ S++Y  ++RD+IHEAG++VDVDT+DRT+ +KV+EAQVAQYNYIL VG++EA 
Sbjct  531  IVCSVSEDSRSYANKVRDQIHEAGYYVDVDTTDRTVSEKVQEAQVAQYNYILAVGDEEAR  590

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            TG+V+V +RD    ++M+ + LL  FK   A++
Sbjct  591  TGQVTVWLRD----EMMSFETLLDEFKLKTANF  619



>ref|XP_002989766.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
 gb|EFJ09243.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
Length=564

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+   W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+
Sbjct  349  PENFLGESSLWDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATI  408

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQ P RF LSYSAEDE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA
Sbjct  409  QLDFQSPIRFKLSYSAEDEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQA  468

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  +S+K + Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E  
Sbjct  469  IVLTISEKFKDYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQE  528

Query  167  TGEVSVRVRDIPDHK-VMTVDELLAHFKDLMASY  69
             GEV+VR R     +  +T+++L+A F+DL+A+Y
Sbjct  529  KGEVNVRTRGSKGQRGCITIEKLIAEFQDLVANY  562



>ref|XP_006303967.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
 gb|EOA36865.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
Length=521

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 172/217 (79%), Gaps = 4/217 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W + E  L  AL EFGKP+ +N+GDG F GPKIDI++ DAMK+  QC TL
Sbjct  304  PEKYLGDLETWVRVEEDLKKALEEFGKPFLLNKGDGEFCGPKIDITIFDAMKKNIQCGTL  363

Query  527  QLDFQLPQRFNLSYSA--EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP  F L YS+  EDE KRERPVMIHRA+LGSVE M AILLEH++GKWPFWLSPR
Sbjct  364  QLDFQLPDSFKLEYSSSTEDEVKRERPVMIHRAVLGSVEHMIAILLEHYEGKWPFWLSPR  423

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            QA+VC  S K  +Y  ++RD+IHEAG++VDVD SDR I++KVREAQVAQYN++LVVG++E
Sbjct  424  QAIVCSSSKKHHSYAEKVRDQIHEAGYYVDVDVSDRDIREKVREAQVAQYNFVLVVGDEE  483

Query  173  ATTGEVSVRVR--DIPDHKVMTVDELLAHFKDLMASY  69
            ATTG+V+V++R  D     VM+++ LL  FK   A+Y
Sbjct  484  ATTGQVTVQLREEDGSYFPVMSIETLLDVFKLKSANY  520



>ref|XP_002892976.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69235.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 171/210 (81%), Gaps = 5/210 (2%)
 Frame = -1

Query  704  EKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQ  525
            +KY+GDLE+W+KAE  L  AL+ FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQ
Sbjct  243  KKYIGDLETWDKAEKDLEKALDNFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQ  302

Query  524  LDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAM  345
            LDFQLP  F L Y  + ++++ERPVMIHRA+LGS+ERMFAILLEH+KG WPFWLSPRQA+
Sbjct  303  LDFQLPACFKLKYITK-KNEKERPVMIHRAVLGSIERMFAILLEHYKGIWPFWLSPRQAI  361

Query  344  VCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATT  165
            VC +S+   +Y  +++ +I EAG++VD+D SDR+I KKV +A+ A YNYILVVG+KEATT
Sbjct  362  VCSLSEDYSSYAKQVQKQIQEAGYYVDIDESDRSICKKVADARAAPYNYILVVGQKEATT  421

Query  164  GEVSVRVRDIP----DHKVMTVDELLAHFK  87
            G+V+VR+R+ P    D   M++D LL  FK
Sbjct  422  GQVTVRLREDPAGRKDLPEMSIDSLLDEFK  451



>ref|XP_010480524.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=668

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KY+GDLE W+KAE AL  AL +FGKP+ IN+GDG  YGPKIDI++ DAMKR FQCATL
Sbjct  457  PKKYIGDLEKWDKAEVALEKALKDFGKPFLINKGDGEIYGPKIDITLSDAMKRNFQCATL  516

Query  527  QLDFQLPQRFNLSYS--AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP+ F L YS  AEDE+K E+PV+IHRA+LGSVERMF+ILLE  KGKWPFWLSPR
Sbjct  517  QLDFQLPESFTLEYSSSAEDETKSEQPVLIHRAVLGSVERMFSILLEQCKGKWPFWLSPR  576

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            QA+VC  S   ++Y  ++RD+IH+AG++VD DT+DR + +KV+EAQVA+YNYILVVGE++
Sbjct  577  QAIVCSSSKDDRSYADKVRDQIHKAGYYVDADTTDRNVSEKVKEAQVARYNYILVVGEED  636

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            A  G+V+V +RD    +VM+++ LL  FK   A++
Sbjct  637  ARRGQVTVWLRD----EVMSIEALLDEFKLKTANF  667



>ref|XP_004304268.2| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467923.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467924.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=746

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 172/217 (79%), Gaps = 4/217 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y G   +W+KAEA LT+ALN+FG PW+INEGDGAFYGPKID  VC+A+K+KFQCAT+
Sbjct  529  PESYHGGRATWDKAEAILTEALNDFGMPWQINEGDGAFYGPKIDFGVCNALKKKFQCATI  588

Query  527  QLDFQLPQ--RFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP   +F+L Y+++ + K E+PVMIHRA+ GS ER   ILLEH+KGKWPFWLSPR
Sbjct  589  QLDFQLPDCAQFDLHYTSDKQGKGEKPVMIHRAVFGSFERFIGILLEHYKGKWPFWLSPR  648

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            Q +VC V+ + +AY +++++RI   G+HVDVD SDR++ KK+REAQVAQYNY+LVVG+KE
Sbjct  649  QLIVCSVTQEFEAYAVQVQERIRRDGYHVDVDISDRSMSKKIREAQVAQYNYVLVVGDKE  708

Query  173  ATTGEVSVRVRDIPDH--KVMTVDELLAHFKDLMASY  69
            A + +VSVR RD  D    VM++D+LL   K+ + ++
Sbjct  709  AKSDQVSVRARDKQDELMGVMSIDDLLRELKNKVEAF  745



>ref|XP_006303165.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
 gb|EOA36063.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
Length=664

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KY+GDLE W++AE AL  AL +FGKP+ +N+GDGAF+GPK+DI+V DAMKR FQCATL
Sbjct  453  PKKYIGDLEKWDRAEGALEKALKDFGKPFFVNKGDGAFHGPKVDITVSDAMKRNFQCATL  512

Query  527  QLDFQLPQRFNLSYS--AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP  F L YS  AEDE+KRE+PV+IHRA+LGSVERMFAILLE  KGKWPFWLSPR
Sbjct  513  QLDFQLPDCFKLEYSSLAEDETKREKPVLIHRAVLGSVERMFAILLEQNKGKWPFWLSPR  572

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            Q +VC +    ++Y  ++RD+IH+AG++ DVDT+DR I +KV EAQVA+YNYILVVG++E
Sbjct  573  QVIVCSLLKDDRSYAEKVRDQIHQAGYYDDVDTTDRNISEKVEEAQVARYNYILVVGDEE  632

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            A  G+V+V +RD    +VM+++ LL  FK   A++
Sbjct  633  ARRGQVTVWLRD----EVMSIETLLDEFKLKTANF  663



>emb|CDY21715.1| BnaA09g44660D [Brassica napus]
Length=628

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W++AE  L +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATL
Sbjct  413  PEKYLGDLTTWDRAERDLEEALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATL  472

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP  F L Y+A  E   + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA
Sbjct  473  QLDFQLPALFELEYTAMAEGSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQA  532

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R++IHEAG++VDVD +DR I KKVREAQVAQYNYILVVG +E T
Sbjct  533  IVCSLSKDSHEYAEKVREQIHEAGYYVDVDITDRNISKKVREAQVAQYNYILVVGAEETT  592

Query  167  TGEVSVRVR--DIPDHKVMTVDELLAHFKDLMASY  69
            TG V+VR R  D+ +  V++V+ LL  FK   A++
Sbjct  593  TGHVTVRRRNEDLSEFPVLSVENLLDEFKLKTANF  627



>ref|XP_009117622.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
Length=628

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W++AE  L +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATL
Sbjct  413  PEKYLGDLTTWDRAERDLEEALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATL  472

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP  F L Y+A  E   + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA
Sbjct  473  QLDFQLPALFELEYTAMAEGSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQA  532

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S  S  Y  ++R++IHEAG++VDVD +DR I KKVREAQVAQYNYIL+VG +E T
Sbjct  533  IVCSLSKDSHEYAEKVREQIHEAGYYVDVDITDRNISKKVREAQVAQYNYILLVGAEETT  592

Query  167  TGEVSVRVR--DIPDHKVMTVDELLAHFKDLMASY  69
            TG V+VR R  D+ +  V++V+ LL  FK   A++
Sbjct  593  TGHVTVRRRNEDLSEFPVLSVENLLDEFKLKTANF  627



>ref|XP_001696198.1| hypothetical protein CHLREDRAFT_167047 [Chlamydomonas reinhardtii]
 gb|EDP08175.1| predicted protein [Chlamydomonas reinhardtii]
Length=688

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLGD+E W KAE ALTDALN  GK W +N GDGAFYGPKIDI+V DA++RKFQCAT+
Sbjct  453  PEGYLGDIELWNKAEQALTDALNSTGKAWVLNPGDGAFYGPKIDITVYDALRRKFQCATV  512

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y++E     ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ 
Sbjct  513  QLDFQLPIRFGLEYASE-AGTLERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQV  571

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MV P+S+ S  Y   +R  +  AG H DVD++DR +QKKVREAQ+AQYNYILVVGE E T
Sbjct  572  MVVPISENSVEYAFTVRKELRSAGLHCDVDSTDRKMQKKVREAQLAQYNYILVVGEAEKT  631

Query  167  TGEVSVRVRDIPDH---KVMTVDELL  99
               V+VR RD   H   K+  V EL+
Sbjct  632  AQTVNVRTRDNVVHGMFKLSDVRELM  657



>ref|XP_002946221.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
 gb|EFJ53216.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
Length=691

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 156/202 (77%), Gaps = 1/202 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLGD+E W +AE ALT+ALN  G+ W +N GDGAFYGPKIDI+V DA++RKFQCAT+
Sbjct  456  PEGYLGDIELWNRAETALTEALNSTGREWVLNPGDGAFYGPKIDITVYDALRRKFQCATV  515

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y++E  +  ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ 
Sbjct  516  QLDFQLPIRFGLEYASESGT-LERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQV  574

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MV P+S+ S  Y  ++R  +  AG HVDVD SDR +QKKVREAQ+AQYNYILVVGE E  
Sbjct  575  MVVPISENSSQYAFDVRRELRAAGLHVDVDASDRKMQKKVREAQLAQYNYILVVGEAEKA  634

Query  167  TGEVSVRVRDIPDHKVMTVDEL  102
               V+VR RD   H +  ++++
Sbjct  635  EQTVNVRTRDNVVHGMFKLEDV  656



>ref|XP_005844334.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
 gb|EFN52232.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
Length=570

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 160/211 (76%), Gaps = 5/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W +AEAAL +ALN  G+ WE+N GDGAFYGPKIDI+V DA++RK+QCAT+
Sbjct  336  PEGYLGELEVWNQAEAALEEALNATGREWEMNPGDGAFYGPKIDITVFDALRRKYQCATV  395

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQ P RFNL Y AED S R+RPV++HRAILGS ERMFAIL EH+ GKWP W+SPRQ 
Sbjct  396  QLDFQFPIRFNLEYVAEDGS-RQRPVIVHRAILGSAERMFAILTEHWGGKWPLWISPRQV  454

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            M+ P+S+    Y   +R ++  AGFHVD D +DR +QKKVREAQ++QYNYILVVGE+E  
Sbjct  455  MIVPISEAVYDYASAVRRQLRSAGFHVDADMADRKMQKKVREAQLSQYNYILVVGEEERV  514

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMA  75
             G V+VR RD   H + +    LA   D+M+
Sbjct  515  AGTVNVRTRDNQVHGMHS----LAGVIDVMS  541



>ref|XP_007044585.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
 gb|EOY00417.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
Length=616

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 158/213 (74%), Gaps = 31/213 (15%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WE+AEAALT+ALNE GKPW                               
Sbjct  434  PEKYLGDLATWERAEAALTEALNESGKPW-------------------------------  462

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  463  QLDFQLPDRFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  522

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS KSQ Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  
Sbjct  523  IVCPVSAKSQDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMN  582

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T +VSVRVRD  D   M+++ LL H KD +A++
Sbjct  583  TKQVSVRVRDKGDLTSMSIEGLLQHLKDEIAAF  615



>ref|XP_007044583.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
 gb|EOY00415.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
Length=645

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 158/213 (74%), Gaps = 31/213 (15%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +WE+AEAALT+ALNE GKPW                               
Sbjct  463  PEKYLGDLATWERAEAALTEALNESGKPW-------------------------------  491

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L YSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA
Sbjct  492  QLDFQLPDRFKLEYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQA  551

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VCPVS KSQ Y  E++++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  
Sbjct  552  IVCPVSAKSQDYAREVQEQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMN  611

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T +VSVRVRD  D   M+++ LL H KD +A++
Sbjct  612  TKQVSVRVRDKGDLTSMSIEGLLQHLKDEIAAF  644



>ref|XP_002989765.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
 gb|EFJ09242.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
Length=647

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+   W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+
Sbjct  457  PENFLGESSLWDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATI  516

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQ P RF LSYSAEDE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA
Sbjct  517  QLDFQSPIRFKLSYSAEDEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQA  576

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  +S+K + Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E  
Sbjct  577  IVLTISEKFKDYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQE  636

Query  167  TGEVSVR  147
             GEV  +
Sbjct  637  KGEVRTK  643



>dbj|BAN16553.1| ADB6244 [Acytostelium subglobosum]
Length=339

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+   W+ AE  L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+
Sbjct  126  PENHLGEASQWDMAENQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATI  185

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ 
Sbjct  186  QLDFQLPIRFELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQV  245

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  VS+K   YG ++   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T
Sbjct  246  LVATVSEKYIEYGQQVAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETT  305

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
               V+VR RD      ++V  L+   K +   +K
Sbjct  306  NKTVNVRTRDNAVRGSISVQALIDELKQVSKEFK  339



>ref|NP_173238.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|Q8GZ45.2|SYTC_ARATH RecName: Full=Probable threonine--tRNA ligase, cytoplasmic; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS [Arabidopsis 
thaliana]
 gb|AAF97275.1|AC034106_18 Strong similarity to threonyl-tRNA synthetase from Arabidopsis 
thaliana gb|Y14329 and is a member of the tRNA synthetase 
PF|00587 class II [Arabidopsis thaliana]
 gb|AEE29656.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=458

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 165/211 (78%), Gaps = 5/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ ++GDLE+W KAE  L  AL++FGKPW I EGDGAFYGPKIDI+V DA  RKFQCAT+
Sbjct  242  PKDHIGDLETWAKAENDLEKALDDFGKPWVIKEGDGAFYGPKIDITVSDARNRKFQCATI  301

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP  F L Y +E +++ E PVMIH A+LGS+ERMFAILLEH+KG WPFWLSPRQA
Sbjct  302  QLDFQLPACFKLKYLSE-KNEMEAPVMIHSAVLGSIERMFAILLEHYKGIWPFWLSPRQA  360

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +VC +S+   +Y  +++ +I+E G++VD+D SDR+++KKV +A+ A YNYILVVG+KE  
Sbjct  361  IVCSLSEDCSSYAKQVQKQINEVGYYVDIDESDRSLRKKVADARDAPYNYILVVGQKEVA  420

Query  167  TGEVSVRVRDIP----DHKVMTVDELLAHFK  87
            TG+V+VR+R+ P    D   M+++ LL  FK
Sbjct  421  TGQVTVRLREDPEGRKDLPEMSIESLLDEFK  451



>ref|XP_002991732.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
 gb|EFJ07136.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
Length=647

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+   W++AE AL DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+
Sbjct  457  PENFLGESALWDRAEGALADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATI  516

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQ P RF LSYSAEDE+K ERPV+IHRAILGSVERMFAILLE   GKWPFWLSPRQA
Sbjct  517  QLDFQSPIRFKLSYSAEDEAKIERPVIIHRAILGSVERMFAILLEDNVGKWPFWLSPRQA  576

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  +S+K + Y  E+R ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E  
Sbjct  577  IVLTISEKFKDYAEEVRAKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQE  636

Query  167  TGEVSVR  147
             GEV  +
Sbjct  637  KGEVRTK  643



>ref|XP_007514880.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO15120.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
Length=715

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE+W KAE AL  AL   GK WE+N GDGAFYGPKIDI+V DA++R+FQCAT+
Sbjct  477  PEGYLGELETWNKAEMALEGALKASGKEWELNPGDGAFYGPKIDIAVFDALRRRFQCATV  536

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+L+Y  E  ++ ERP++IHRA+LGSVERMFAIL EH+ GKWP+WLSPRQ 
Sbjct  537  QLDFQLPIRFDLAYQNE-HNEDERPIIIHRAVLGSVERMFAILTEHYAGKWPYWLSPRQV  595

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            M+ P+S+ S  Y  ++R RI +AG HV+VD SDR +QKKVREAQ+ Q+NYILVVGE+E T
Sbjct  596  MIVPISELSLEYAKDVRRRIRKAGHHVEVDASDRKMQKKVREAQLEQFNYILVVGEQEKT  655

Query  167  TGEVSVRVRDIPDHKVMTVDELL  99
               V+VR RD   H    +++L+
Sbjct  656  NDTVNVRTRDNQVHGERKLEDLI  678



>ref|XP_004933460.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Bombyx mori]
Length=713

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W +AE AL D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+
Sbjct  491  PEKYLGDLETWNQAEKALEDSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATI  550

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNL+Y +E   K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ 
Sbjct  551  QLDFQLPERFNLTYVSETGDKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQL  609

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
             V PV      Y +++ D++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E 
Sbjct  610  RVVPVGPAFDDYAVQVNDKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREK  669

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
             +G V+VR RD   H  M+V+ L+ H  +L+   K
Sbjct  670  NSGTVNVRTRDNKVHGEMSVEALIEHLNNLVREKK  704



>ref|XP_003080220.1| putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
Length=673

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W+KAEAALT ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+
Sbjct  451  PEGYLGELEVWDKAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATV  510

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q 
Sbjct  511  QLDFQLPIRFDLSYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQV  569

Query  347  MVCPVSDKSQA-YGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            M+ P+SD +   Y ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E 
Sbjct  570  MIVPISDSASGEYCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEK  629

Query  170  TTGEVSVRVRDIPDHKVMTVDELLA  96
                V+VR RD   H    V++L+ 
Sbjct  630  VNRTVNVRTRDNKVHGEHKVEDLIT  654



>ref|XP_005648591.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE24047.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=765

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG LE W+ AEA+L  AL+  G+PWE+N  DGAFYGPKIDI+V DA++RKFQCAT+
Sbjct  530  PESYLGTLEQWDAAEASLKQALDSTGQPWELNPADGAFYGPKIDITVFDALRRKFQCATV  589

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y+ +  ++ ERPV++HRAILGSVERMFAIL EH+ GKWPFWLSPRQ 
Sbjct  590  QLDFQLPIRFGLQYATDKLNEFERPVIVHRAILGSVERMFAILTEHYAGKWPFWLSPRQV  649

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MV P+S+ S  Y  E+R  +  A F VDVD +D  +QKKVREAQ+AQYNYILVVGEKE  
Sbjct  650  MVVPISEASAEYAQEVRRTLRNARFFVDVDLADNKMQKKVREAQLAQYNYILVVGEKERE  709

Query  167  TGEVSVRVRDIPDHKVMTVDELL  99
               V+VR RD   H    + E++
Sbjct  710  QKTVNVRTRDNVVHGEHALSEVV  732



>ref|XP_004933459.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Bombyx mori]
Length=720

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDLE+W +AE AL D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+
Sbjct  498  PEKYLGDLETWNQAEKALEDSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATI  557

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNL+Y +E   K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ 
Sbjct  558  QLDFQLPERFNLTYVSETGDKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQL  616

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
             V PV      Y +++ D++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E 
Sbjct  617  RVVPVGPAFDDYAVQVNDKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREK  676

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLM  78
             +G V+VR RD   H  M+V+ L+ H  +L+
Sbjct  677  NSGTVNVRTRDNKVHGEMSVEALIEHLNNLV  707



>emb|CEF98631.1| Anticodon-binding [Ostreococcus tauri]
Length=693

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W+KAEAALT ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+
Sbjct  471  PEGYLGELEVWDKAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATV  530

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q 
Sbjct  531  QLDFQLPIRFDLSYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQV  589

Query  347  MVCPVSDKSQA-YGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            M+ P+SD +   Y ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E 
Sbjct  590  MIVPISDSASGEYCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEK  649

Query  170  TTGEVSVRVRDIPDHKVMTVDELLA  96
                V+VR RD   H    V++L+ 
Sbjct  650  VNRTVNVRTRDNKVHGEHKVEDLIT  674



>ref|XP_006071988.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Bubalus bubalis]
Length=367

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  146  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  205

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   +++PV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  206  QLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  265

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  266  MVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  325

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   T+ E +   + L  S
Sbjct  326  TSGTVNIRTRDNKVHGERTISETIERLQQLKHS  358



>ref|XP_002677200.1| threonyl-tRNA synthetase [Naegleria gruberi]
 gb|EFC44456.1| threonyl-tRNA synthetase [Naegleria gruberi]
Length=672

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++  W++AE  L  ALNEFG  W+ NEGDGAFYGPKIDI + DA+KR+ QCAT+
Sbjct  459  PEKYLGEISQWDEAEGQLEAALNEFGHSWQKNEGDGAFYGPKIDILISDALKREHQCATV  518

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+L+Y+AED+++  RPV++HRAI GS+ER  AI  EHF GKWPFWLSPRQA
Sbjct  519  QLDFQLPIRFDLTYAAEDKTE-SRPVIVHRAIFGSLERFLAIATEHFGGKWPFWLSPRQA  577

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PVS+K   Y  +++ R+HEA ++VDVD S   I KK+R AQ++QYNYILVVG KE  
Sbjct  578  IVVPVSNKCNEYAEKVQKRLHEAKYYVDVDLSSNRIDKKIRNAQLSQYNYILVVGPKEME  637

Query  167  TGEVSVRVRDI-PDHKVMTVDELLAHFKDLMASYK  66
            +  V++R+RD   +  V T++ELL  F+     +K
Sbjct  638  SDSVNIRIRDSDKEQGVKTIEELLIEFEGNKVQFK  672



>ref|XP_004182642.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
 emb|CCH63123.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
Length=741

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 155/217 (71%), Gaps = 7/217 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G+LE+W  AE  L  AL  +G  WEINEGDGAFYGPKIDI + DA++R  QCAT+
Sbjct  515  PEKYVGELETWNAAETKLASALKSWGGKWEINEGDGAFYGPKIDIMISDALRRWHQCATI  574

Query  527  QLDFQLPQRFNLSYSAED---ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSP  357
            QLDFQLP RF L + A+D   E   ERPVMIHRAILGSVERM AIL EHF GKWPFWLSP
Sbjct  575  QLDFQLPNRFELEFKAQDNKSEEAYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSP  634

Query  356  RQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEK  177
            RQ +V PV  K Q+Y  E+RD+ H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+
Sbjct  635  RQILVVPVGVKYQSYAQEIRDKFHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQ  694

Query  176  EATTGEVSVRVRDIPDHK----VMTVDELLAHFKDLM  78
            E     V++R RDI + +     + VD +L   K+L+
Sbjct  695  EMNENSVNIRNRDIMEQQGKNATVNVDVVLKQMKNLL  731



>ref|XP_004531261.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Ceratitis capitata]
 ref|XP_004531262.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X3 
[Ceratitis capitata]
Length=689

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 156/203 (77%), Gaps = 2/203 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  470  PEKYLGELEQWNTAEKALAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  529

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  530  QLDFQLPVRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  588

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  589  MVVPVGPQFDEYAQTVRDELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKER  648

Query  170  TTGEVSVRVRDIPDHKVMTVDEL  102
            ++  V+VR RD   H  ++VD+L
Sbjct  649  SSNTVNVRTRDNKVHGEVSVDDL  671



>ref|XP_003288175.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
 gb|EGC35308.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
Length=713

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 161/215 (75%), Gaps = 1/215 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG++  W +AE +L  ALN FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+
Sbjct  499  PENFLGEISQWNEAEKSLEKALNRFGKPWQLNPGDGAFYGPKIDIQIYDCLKRAHQCATI  558

Query  527  QLDFQLPQRFNLSYSAEDESK-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF+L Y ++D +  ++RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQ
Sbjct  559  QLDFQLPIRFDLEYQSDDATDVKKRPVIIHRAILGSVERMMAILMEHTAGKWPFWVSPRQ  618

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+V  V+ +   YG ++  +I E G++ D+D SD+TI KKVREAQ+AQYNYILVVG++E 
Sbjct  619  AIVVTVAKQHNEYGHKVAKQISELGYYCDIDESDKTIGKKVREAQLAQYNYILVVGQEEI  678

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
               +V+VR RD      ++V+EL+A F  L   +K
Sbjct  679  DNNKVNVRTRDNVVRGSISVEELVAEFAVLSKEFK  713



>ref|XP_003058283.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58234.1| predicted protein [Micromonas pusilla CCMP1545]
Length=725

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W +AE AL +ALN+ GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+
Sbjct  477  PEGYLGELEVWNQAEDALRNALNKSGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATV  536

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E+ ++  RP++IHRAILGSVERMFAIL EHF GK+P+WLSP+Q 
Sbjct  537  QLDFQLPIRFNLSYVTEN-NEPARPIIIHRAILGSVERMFAILTEHFAGKYPYWLSPKQV  595

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            M+ P+S+ S+ Y +E++ ++ +AG H  VD +DR +QKKVREAQ+  +NYILVVGE E T
Sbjct  596  MLVPISEASREYALEVKKQLRKAGHHAQVDETDRKMQKKVREAQLEHWNYILVVGEGEKT  655

Query  167  TGEVSVRVRDIPDHKVMTVDELLA  96
               V+VR RD   H  + ++EL+ 
Sbjct  656  NRTVNVRTRDNVVHGEVKLEELMT  679



>ref|XP_011212426.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
 ref|XP_011212434.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
Length=689

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  470  PEKYLGELEQWNTAEKALAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  529

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  530  QLDFQLPQRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  588

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  589  MVVPVGPQYDEYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKER  648

Query  170  TTGEVSVRVRDIPDHKVMTVDELLA  96
            ++  V+VR RD   H  +++ +L+ 
Sbjct  649  SSDTVNVRTRDNKVHGEVSITDLIT  673



>ref|XP_003397155.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
terrestris]
Length=725

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+GD+E W++AE AL ++L+ FG+PW+IN  DGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  505  PEKYMGDIEMWDQAEKALAESLDAFGEPWKINPEDGAFYGPKIDITIMDALKRHHQCATI  564

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  565  QLDFQLPIRFNLSYINES-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQV  623

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PVS +   Y  +++D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  624  MVIPVSSQFDEYAEQVKDKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKEL  683

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V+VR RD   H  + VD+L+A FK
Sbjct  684  NAGTVNVRTRDNVVHGEILVDDLIAKFK  711



>pdb|4HWT|A Chain A, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
 pdb|4HWT|B Chain B, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
Length=413

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  184  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  243

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  244  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  303

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  304  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  363

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  364  ISGTVNIRTRDNKVHGERTISETIERLQQL  393



>ref|XP_636821.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
 sp|Q54J66.1|SYTC1_DICDI RecName: Full=Probable threonine--tRNA ligase 1, cytoplasmic; 
AltName: Full=Threonyl-tRNA synthetase; Short=ThrRS [Dictyostelium 
discoideum]
 gb|EAL63315.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
Length=710

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 1/215 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ +LG++  W+ AEA+L  ALN+FGKPW++N  DGAFYGPKIDI + D +KR  QCAT+
Sbjct  496  PDNFLGEIAQWDIAEASLEKALNKFGKPWKLNPKDGAFYGPKIDIHITDCLKRSHQCATI  555

Query  527  QLDFQLPQRFNLSYSAEDESK-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  351
            QLDFQLP RF+L Y ++D ++ ++RPV+IHRAILGSVERM AIL+EH  GKWP W+SPRQ
Sbjct  556  QLDFQLPIRFDLEYQSDDAAELKKRPVIIHRAILGSVERMMAILIEHTGGKWPLWVSPRQ  615

Query  350  AMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  171
            A+V  V+     YG ++   I +AGF+ D+D SD+TI KKVREAQ+AQYNYILVVG++E 
Sbjct  616  AIVVTVNKTHNEYGQKVCKEISDAGFYCDIDDSDKTISKKVREAQLAQYNYILVVGQEEI  675

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
                V+VR RD      +TV++L++ FK L+  +K
Sbjct  676  NGNTVNVRTRDNVVRGSLTVNDLISEFKQLVKEFK  710



>pdb|4P3N|A Chain A, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|B Chain B, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|C Chain C, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|D Chain D, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
Length=415

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  194  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  253

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  254  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  313

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  314  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  373

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  374  ISGTVNIRTRDNKVHGERTISETIERLQQL  403



>gb|KGK38420.1| hypothetical protein JL09_g2427 [Pichia kudriavzevii]
Length=725

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 157/216 (73%), Gaps = 4/216 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+GDLE+W  AEA L +ALN++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  502  PEKYVGDLETWNGAEAKLEEALNKWGGDWEINAGDGAFYGPKIDIMISDALRRWHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L +  ++E+   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ 
Sbjct  562  QLDFQLPNRFELEFKGKEETNAVRPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V PV  K   Y  E++ ++H AGF  DVD +  T+QKKVR  QV +YN+I +VGE+E+T
Sbjct  622  LVVPVGVKYFEYAEEVQQKLHNAGFFADVDVTGNTLQKKVRNGQVQKYNFIFIVGEQEST  681

Query  167  TGEVSVRVRDIPD----HKVMTVDELLAHFKDLMAS  72
               V++R RDI D    ++ +++D ++A    L  S
Sbjct  682  EKSVNIRNRDIQDLQGKNEAVSLDTVIAQLLKLKES  717



>ref|XP_003489967.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
impatiens]
Length=690

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+GD+E W++AE AL ++L+ FG+PW++N  DGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  470  PEKYMGDIEMWDQAEKALAESLDAFGEPWKLNPEDGAFYGPKIDITIMDALKRHHQCATI  529

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  530  QLDFQLPIRFNLSYINES-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQV  588

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PVS +   Y  +++D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  589  MVIPVSSQFDEYAEQVKDKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKEL  648

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V+VR RD   H  + VD+L+A FK
Sbjct  649  NAGTVNVRTRDNVVHGEILVDDLIAKFK  676



>ref|XP_001989177.1| GH11579 [Drosophila grimshawi]
 gb|EDW04044.1| GH11579 [Drosophila grimshawi]
Length=493

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 159/211 (75%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE+YLG+LE W+ AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+
Sbjct  274  PEQYLGELEQWDAAEKALAESLDEFGMPWKENHGDGAFYGPKIDITIMDALKRPFQCATI  333

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  334  QLDFQLPIRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  392

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  393  MVVPVGPAYDEYAKSVRDQLYAAGFMSESDCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  451

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL++  + +
Sbjct  452  RSSNTVNVRTRDNKVHGEVSVAELISKLQKI  482



>ref|XP_004531260.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Ceratitis capitata]
Length=785

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 156/203 (77%), Gaps = 2/203 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  566  PEKYLGELEQWNTAEKALAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  625

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  626  QLDFQLPVRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  684

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  685  MVVPVGPQFDEYAQTVRDELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKER  744

Query  170  TTGEVSVRVRDIPDHKVMTVDEL  102
            ++  V+VR RD   H  ++VD+L
Sbjct  745  SSNTVNVRTRDNKVHGEVSVDDL  767



>gb|EDL82978.1| threonyl-tRNA synthetase, isoform CRA_b [Rattus norvegicus]
Length=433

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 151/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  212  PEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  271

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  272  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  331

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R   H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  332  MVVPVGPTCDEYAQKVRQEFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  391

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV E +   + L
Sbjct  392  ASGTVNIRTRDNKVHGERTVGETVERLQQL  421



>ref|XP_001623293.1| predicted protein [Nematostella vectensis]
 gb|EDO31193.1| predicted protein [Nematostella vectensis]
Length=559

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 152/212 (72%), Gaps = 1/212 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG +E W +AE  L  ALN FG+ W +N GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  338  PEKYLGKIELWNQAEKELEAALNGFGQAWVLNPGDGAFYGPKIDIQIQDALRRYHQCATI  397

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNL+Y   +  +R+RPV++HRAILGSVERM AIL E F GKWPFWLSPRQA
Sbjct  398  QLDFQLPERFNLTYVTGEGDERKRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQA  457

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V P+  K   Y  ++   I  AG+HVD D     T+ KKVR AQ+AQYN+I VVGEKEA
Sbjct  458  IVIPIGPKYDEYAQKVMSDILAAGYHVDADLDHGTTLNKKVRNAQLAQYNFIFVVGEKEA  517

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMA  75
            TTG V+VR RD   H   +V+ +L  F  L +
Sbjct  518  TTGTVNVRTRDNKVHGEFSVEAVLNKFATLTS  549



>gb|EFA05822.1| hypothetical protein TcasGA2_TC008604 [Tribolium castaneum]
Length=685

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL  WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+
Sbjct  466  PEKYLGDLAMWEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTI  525

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQA
Sbjct  526  QLDFQLPIRFNLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQA  584

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  585  MVIPVGPTYDEYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKER  644

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            ++  V+VR RD   H  ++V+ L+  FK L  +Y
Sbjct  645  SSQTVNVRTRDNIVHGEISVEGLIEKFKVLQENY  678



>ref|XP_011499017.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, cytoplasmic 
[Ceratosolen solmsi marchali]
Length=700

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 160/213 (75%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK++G+  SW+ AE AL+++L+ FG+PW +N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  480  PEKFMGETTSWDAAEKALSESLDTFGQPWTLNPGDGAFYGPKIDITIMDALKRPHQCATI  539

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   ++ RPV+IHRAILGSVERM AILLE + GKWPFWLSPRQA
Sbjct  540  QLDFQLPIRFNLSYVNE-AGEKTRPVIIHRAILGSVERMIAILLESYAGKWPFWLSPRQA  598

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            +V PV      Y +E+RDRI + GF  +V+     T+ KK+R AQ+ Q+NYILVVGEKE 
Sbjct  599  IVIPVGPSVDDYALEVRDRIFKCGFMTEVNVDHSVTLNKKIRNAQLDQFNYILVVGEKEK  658

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            ++  V+VR RD   H  + +DEL+  F++L+ +
Sbjct  659  SSSTVNVRTRDNKVHGQIEIDELMKKFENLIET  691



>ref|XP_001418868.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97161.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=674

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 158/207 (76%), Gaps = 1/207 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W+KAEAAL  AL+  G+ W++NEGDGAFYGPKIDI+V DA+KR+FQCAT+
Sbjct  467  PEGYLGELEVWDKAEAALKSALDRSGREWKLNEGDGAFYGPKIDITVFDALKRRFQCATV  526

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+LSY  E+ S   RP++IHRAILGSVERMFAIL EHF GKWP+WLSP+Q 
Sbjct  527  QLDFQLPIRFDLSYVDENNSS-VRPIIIHRAILGSVERMFAILTEHFAGKWPYWLSPKQV  585

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            M+ P+S+ S+ Y  E++ ++ +AG   +VD +DR +QKKVREAQ+ Q+NYILV GE E  
Sbjct  586  MIVPISEASRDYCYEVKRQLRKAGHFAEVDVTDRKMQKKVREAQLDQFNYILVCGESEKA  645

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFK  87
               V+VR RD   H ++  +  +  F+
Sbjct  646  NETVNVRTRDNKVHVIIRGETAITRFR  672



>ref|XP_011212417.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Bactrocera 
dorsalis]
Length=784

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  565  PEKYLGELEQWNTAEKALAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  624

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  625  QLDFQLPQRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  683

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  684  MVVPVGPQYDEYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKER  743

Query  170  TTGEVSVRVRDIPDHKVMTVDELLA  96
            ++  V+VR RD   H  +++ +L+ 
Sbjct  744  SSDTVNVRTRDNKVHGEVSITDLIT  768



>ref|XP_009117636.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Brassica rapa]
Length=435

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 162/235 (69%), Gaps = 31/235 (13%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE+   DL+ WE++E  L +AL EFGKP+ +N G+GAF GPKIDI++ DAMKRKFQCA++
Sbjct  197  PEENTKDLQRWEESENDLVEALQEFGKPFIVNRGEGAFCGPKIDITLSDAMKRKFQCASI  256

Query  527  QLDFQLPQRFNLSYSAEDESKRE------------------RPVMIHRAILGSVERMFAI  402
            QLDFQLP  F L YS  DE K+E                  RPVMIHR +LGS ERM AI
Sbjct  257  QLDFQLPDHFKLRYSPSDEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLAI  316

Query  401  LLEHFKGKWPFWLSPRQAMVCPVSDKS--QAYGMELRDRIHEAGFHVDVDTSDRTIQKKV  228
            LL H+KGKWPFW+SPRQ +VC  S+    ++Y  E+R +IHEAG+HVDVDT+DR I +KV
Sbjct  317  LLNHYKGKWPFWISPRQVIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEKV  376

Query  227  REAQVAQYNYILVVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  87
             EA++AQYNYILVVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  377  GEAEIAQYNYILVVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  428



>ref|XP_001965104.1| GF21565 [Drosophila ananassae]
 gb|EDV33238.1| GF21565 [Drosophila ananassae]
Length=749

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  530  PEKYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  589

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  590  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  648

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  649  MVVPVGPAYDQYAQSVRDQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  707

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  708  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  738



>dbj|GAM29123.1| hypothetical protein SAMD00019534_122990 [Acytostelium subglobosum 
LB1]
Length=708

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+   W+ AE  L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+
Sbjct  495  PENHLGEASQWDMAENQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATI  554

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ 
Sbjct  555  QLDFQLPIRFELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQV  614

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  VS+K   YG ++   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T
Sbjct  615  LVATVSEKYIEYGQQVAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETT  674

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  66
               V+VR RD      ++V  L+   K +   +K
Sbjct  675  NKTVNVRTRDNAVRGSISVQALIDELKQVSKEFK  708



>ref|XP_008198247.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Tribolium 
castaneum]
Length=712

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL  WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+
Sbjct  493  PEKYLGDLAMWEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTI  552

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQA
Sbjct  553  QLDFQLPIRFNLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQA  611

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  612  MVIPVGPTYDEYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKER  671

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            ++  V+VR RD   H  ++V+ L+  FK L  +Y
Sbjct  672  SSQTVNVRTRDNIVHGEISVEGLIEKFKVLQENY  705



>ref|XP_967345.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Tribolium 
castaneum]
Length=707

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL  WE+AE AL++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+
Sbjct  488  PEKYLGDLAMWEQAEKALSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTI  547

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY +E   K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQA
Sbjct  548  QLDFQLPIRFNLSYVSESGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQA  606

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  +++ +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  607  MVIPVGPTYDEYAQDVKKKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKER  666

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            ++  V+VR RD   H  ++V+ L+  FK L  +Y
Sbjct  667  SSQTVNVRTRDNIVHGEISVEGLIEKFKVLQENY  700



>ref|XP_011397153.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24266.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
Length=727

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG    W+ AE AL +AL+  G  WE+NEGDGAFYGPKIDI+V DA++RKFQCAT+
Sbjct  501  PEGFLGTPGQWDAAEGALRNALDASGHAWELNEGDGAFYGPKIDITVHDALRRKFQCATV  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y AED    + PV+IHRA+LGSVERMFAIL E+F G+WP WLSPRQ 
Sbjct  561  QLDFQLPLRFGLQYVAED-GGFQVPVIIHRAVLGSVERMFAILTENFAGRWPLWLSPRQV  619

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            MV P+SD S  Y +E+RD +  AGFHV+VD +DR +QKKVREAQVAQ+NYILVVG  E  
Sbjct  620  MVVPISDSSYDYALEVRDAVRGAGFHVEVDLADRKMQKKVREAQVAQFNYILVVGAAERE  679

Query  167  TGEVSVRVRDIPDHKVMTVDELL  99
               V+VR RD   H    +D++L
Sbjct  680  QRTVNVRTRDNQVHGQRQLDDVL  702



>emb|CDJ83831.1| Aminoacyl-tRNA synthetase and Anticodon-binding domain containing 
protein, partial [Haemonchus contortus]
Length=390

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 163/215 (76%), Gaps = 4/215 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LG+L +W++AE+ L  ALNE G+PW++NEGDGAFYGPKIDIS+ DA++R  QCAT+
Sbjct  158  PEGFLGELSTWDEAESDLKAALNESGRPWKLNEGDGAFYGPKIDISIQDALRRNHQCATI  217

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLPQRF+LSY  E + +++RPVMIHRA+LGSVERM AIL E++ GKWPFWLSPRQA
Sbjct  218  QLDFQLPQRFDLSYFDE-KGEKQRPVMIHRAVLGSVERMAAILTENYGGKWPFWLSPRQA  276

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVD--TSDRTIQKKVREAQVAQYNYILVVGEKE  174
             V  V +    Y  +++++++ AGF V+ D   SD T+ K++R AQ+AQ+N+ILVVG+KE
Sbjct  277  KVITVHESVNPYARQVKEKLYNAGFEVEFDEGCSD-TLNKQIRNAQLAQFNFILVVGQKE  335

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
               G V+VR RD      +++D+LLA F+     Y
Sbjct  336  VEHGTVNVRTRDNAVRGEVSIDDLLAKFRRFADEY  370



>ref|XP_001658309.1| AAEL001206-PA [Aedes aegypti]
 gb|EAT47704.1| AAEL001206-PA [Aedes aegypti]
Length=716

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 162/211 (77%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E W +AE AL ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  497  PEKYLGDIEVWNEAEKALAESLDKFGQPWKENPGDGAFYGPKIDITIMDALKRNHQCATI  556

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D  +++RPV+IHRA+LGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  557  QLDFQLPIRFNLNY-IDDSGEKKRPVIIHRAVLGSVERMIAILTESYAGKWPFWLSPRQV  615

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV  +   Y  ++R R+HEAGF    D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE
Sbjct  616  MVVPVGPQYDDYADKVRQRLHEAGFMAEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKE  674

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++VD+L+A  + L
Sbjct  675  RSSETVNVRTRDNKVHGEVSVDDLVAKLRRL  705



>ref|XP_319682.4| AGAP008929-PA [Anopheles gambiae str. PEST]
 gb|EAA14818.5| AGAP008929-PA [Anopheles gambiae str. PEST]
Length=761

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 162/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E W +AE AL D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  542  PEKYLGEIEVWNEAEKALADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATI  601

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  602  QLDFQLPIRFNLNY-IDDSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQV  660

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y  ++R R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE
Sbjct  661  MVVPVGPAYDDYADQVRQRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKE  719

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
             ++  V+VR RD   H  +TV++L+     L   Y
Sbjct  720  RSSETVNVRTRDNKVHGEVTVNDLVTKLSKLRDEY  754



>ref|NP_723726.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
 ref|NP_524839.3| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAF53167.1| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAN10805.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
Length=690

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  471  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  530

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  531  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  589

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  590  MVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  648

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  649  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  679



>gb|AAH04621.1| Tars protein, partial [Mus musculus]
Length=457

 Score =   253 bits (646),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 151/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  236  PEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  295

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  296  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  355

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  356  MVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  415

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV+E +   + L
Sbjct  416  ASGTVNIRTRDNKVHGERTVEETVRRLQQL  445



>gb|EPY73150.1| threonine--tRNA ligase, cytoplasmic [Camelus ferus]
Length=628

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  407  PEKFLGDVEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  466

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  467  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  526

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++  + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  527  MVVPVGPTCDEYAQKVWQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  586

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T+G V++R RD   H   TV E +   + L  SY
Sbjct  587  TSGTVNIRTRDNKVHGERTVSETIERLQQLKQSY  620



>gb|AAN71609.1| RH56418p [Drosophila melanogaster]
 gb|ACL87841.1| Aats-thr-PB, partial [synthetic construct]
Length=711

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  492  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  551

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  552  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  610

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  611  MVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  669

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  670  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  700



>ref|XP_005650255.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE25711.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=1049

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG LE W+ AEAALT AL+  GK WE+NE DGAFYGPKIDI+V DA++RKFQCAT+
Sbjct  495  PDSYLGTLEQWDAAEAALTQALDATGKAWELNEADGAFYGPKIDITVFDALRRKFQCATI  554

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+L Y    E+  ERPV++HRAILGSVERM AIL E+F GKWP WLSPRQ 
Sbjct  555  QLDFQLPVRFDLQYKGASEAF-ERPVIVHRAILGSVERMLAILTENFAGKWPLWLSPRQV  613

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V P+S+ S  Y   +R ++  A  HV+VD SDR +QKKVREAQ+AQ+NYILVVGEKE  
Sbjct  614  IVVPISEASVGYARRVRAQLRAAKLHVEVDDSDRKMQKKVREAQLAQFNYILVVGEKEEA  673

Query  167  TGEVSVRVRDIPDHKVMTVD  108
             G V+VR RD   H +  +D
Sbjct  674  EGTVNVRTRDNIVHGMHALD  693



>ref|XP_004088253.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=559

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  338  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  397

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  398  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  457

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  458  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  517

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  518  ISGTVNIRTRDNKVHGERTISETIERLQQLKQS  550



>ref|XP_001950747.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Acyrthosiphon 
pisum]
Length=714

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 155/213 (73%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE WE AE  L D+LN FG+PW +N GDGAFYGPKIDI++ DA+KR+ QCAT+
Sbjct  494  PEKYLGELEMWENAEKQLADSLNSFGEPWTLNPGDGAFYGPKIDITISDALKRQHQCATI  553

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ +E   K+ RPV+IHRAI GSVERM AIL E F GKWPFWLSPRQA
Sbjct  554  QLDFQLPIRFNLNFISESGEKK-RPVIIHRAIFGSVERMIAILTESFAGKWPFWLSPRQA  612

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V PV  +   Y  +++  I+EAGF  DVD     T+ KK+R AQ+AQYN+ILVVG+KE 
Sbjct  613  IVIPVGPQFDEYSEKVKKEIYEAGFMCDVDVDHGDTLNKKIRNAQLAQYNFILVVGDKEK  672

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T   V+VR RD   H   +++E +   + L  S
Sbjct  673  TANTVNVRTRDNNVHGEFSIEETIQRLQKLKIS  705



>ref|XP_449908.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG62888.1| unnamed protein product [Candida glabrata]
Length=726

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G+LE+W+ AE  L +ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  500  PEKYVGELETWDAAEKKLENALNKWGGAWELNPGDGAFYGPKIDIMISDALRRWHQCATI  559

Query  527  QLDFQLPQRFNLSYSAEDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSP  357
            QLDFQLPQRF L + A+D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSP
Sbjct  560  QLDFQLPQRFELEFKAKDTEESENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSP  619

Query  356  RQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEK  177
            RQ +V PV  K Q Y  ++RD++H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE 
Sbjct  620  RQILVVPVGVKYQEYAQQVRDKMHNAGFYADVDLTGNTLQKKVRTGQLMKYNFIFIVGET  679

Query  176  EATTGEVSVRVRDIPDHK----VMTVDELLAHFKDLMA  75
            E     V++R RD+ + +     + VD +L   + L A
Sbjct  680  EMNENSVNIRNRDVMEQQGKNATVNVDIVLEQLQKLKA  717



>ref|XP_004351232.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
 gb|EGG14724.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
Length=706

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 150/206 (73%), Gaps = 0/206 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE  LG  E W+KAE +L  AL  FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+
Sbjct  493  PENRLGSDEMWDKAEKSLEVALTNFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATI  552

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y  +     +RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQA
Sbjct  553  QLDFQLPIRFELEYMTDKAEDLQRPVIIHRAILGSVERMMAILIEHTGGKWPFWVSPRQA  612

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            ++ PVS +   Y  +L+ +I +AGF+ DVD SD+T+ KKVREAQ+AQYNYILVVG+KE  
Sbjct  613  IIVPVSQQFNEYADQLQKKIVDAGFYCDVDGSDKTLPKKVREAQLAQYNYILVVGQKEKD  672

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHF  90
               V VR RD      +++D LLA F
Sbjct  673  ENTVGVRTRDNVVRDAISLDALLAEF  698



>ref|XP_010208524.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Colius striatus]
Length=254

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 149/214 (70%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W+ AE  L ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  33   PENYLGELEIWDHAEKQLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATI  92

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  93   QLDFQLPIRFNLTYVGKDGDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQV  152

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV    + Y  ++  +  EAGF  DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  153  MVVPVGPTCEEYARQVCCQFFEAGFMSDVDLDPSCTLNKKIRNAQLAQYNFILVVGEKEK  212

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
                V+VR RD   H  ++V   +   K+  +S+
Sbjct  213  ANSAVNVRTRDNKVHGEISVSAAIEKLKEFKSSH  246



>ref|XP_009238891.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Pongo 
abelii]
Length=563

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  342  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  401

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  402  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  461

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  462  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  521

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  522  ISGTVNIRTRDNKVHGERTISETIERLQQLKES  554



>ref|XP_002002014.1| GI17149 [Drosophila mojavensis]
 gb|EDW11456.1| GI17149 [Drosophila mojavensis]
Length=691

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KYLG+L+ W+ AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+
Sbjct  472  PDKYLGELDQWDAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATI  531

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  KR RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  532  QLDFQLPIRFNLNYIADDGEKR-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  590

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD ++ AGF   VD D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  591  MVVPVGPAYDEYAKTVRDELYAAGFMSEVDCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  649

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL++  + +
Sbjct  650  RSSKTVNVRTRDNKVHGEVSVAELISKLQKI  680



>gb|EHJ63622.1| hypothetical protein KGM_17077 [Danaus plexippus]
Length=712

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 157/212 (74%), Gaps = 2/212 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL +W +AE AL D+LN FGK W++N GDGAFYGPKIDI++ DA++R  QCAT+
Sbjct  490  PEKYLGDLATWNQAEKALEDSLNRFGKVWQLNPGDGAFYGPKIDITIQDALRRSHQCATI  549

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNLSY +E   K+ RPV+IHRA+LGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  550  QLDFQLPERFNLSYISETGEKK-RPVIIHRAVLGSVERMIAILSESYAGKWPFWLSPRQT  608

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
             V PV      Y   + +++  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E 
Sbjct  609  CVVPVGPSFDDYATYVNEKLFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREK  668

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMA  75
            ++  V+VR RD   H  M+++ L+ H   L+A
Sbjct  669  SSNTVNVRTRDNKVHGEMSIEGLIEHLNKLVA  700



>ref|XP_002052626.1| GJ17652 [Drosophila virilis]
 gb|EDW64781.1| GJ17652 [Drosophila virilis]
Length=745

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 4/215 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+KYLG+LE W+ AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+
Sbjct  526  PDKYLGELEQWDAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATI  585

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  586  QLDFQLPIRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  644

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  645  MVVPVGPAYDEYAKSVRDQLYAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  703

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
             ++  V+VR RD   H  ++V EL+   + +   Y
Sbjct  704  RSSNTVNVRTRDNKVHGEVSVAELITKLQKIRDEY  738



>ref|XP_001969762.1| GG23767 [Drosophila erecta]
 gb|EDV58821.1| GG23767 [Drosophila erecta]
Length=746

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  527  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  586

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  587  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  645

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  646  MVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  704

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  705  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  735



>gb|ETN67379.1| threonyl-tRNA synthetase [Anopheles darlingi]
Length=706

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 162/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E W +AE AL ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  487  PEKYLGEIEVWNEAEKALAESLDKFGEPWKENPGDGAFYGPKIDITIMDALKRHHQCATI  546

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  547  QLDFQLPIRFNLNY-VDDSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQV  605

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y  ++R R+H+AGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE
Sbjct  606  MVVPVGPAYDEYADKVRLRLHDAGFTVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKE  664

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
             ++  V+VR RD   H  +TVDEL+     L   Y
Sbjct  665  RSSETVNVRTRDNKVHGEVTVDELVTKLAKLRDEY  699



>ref|XP_002595927.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
 gb|EEN51939.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
Length=681

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 3/211 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK +GD E+W++AE  L  AL++FG PW++N GDGAFYGPKIDI V DA++R  QCAT+
Sbjct  457  PEKAIGDKETWDRAEKHLASALDKFGMPWKLNPGDGAFYGPKIDIQVFDALRRAHQCATI  516

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDF  P+RFNL+Y + D  +++RPVMIHRAILGSVER  AIL E+F GKWPFWLSPRQA
Sbjct  517  QLDFNNPERFNLTYVSGDGDEKKRPVMIHRAILGSVERFIAILCENFGGKWPFWLSPRQA  576

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            M+ PVS     Y  ++R+ IHEAGF    D D  D T+ KK+R AQ+AQYN+I+VVG+KE
Sbjct  577  MIVPVSPDQNEYAQKVRNSIHEAGFMCEADCDPGD-TMNKKIRNAQLAQYNFIMVVGKKE  635

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
              +G V+VR RD   H   +V++++  FK L
Sbjct  636  VESGTVNVRTRDNKVHGERSVEDVILRFKKL  666



>ref|XP_001642915.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15057.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
Length=729

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G+LE+W  AEA L  AL ++G  WE+N GDGAFYGPKIDI + DA+KR  QCAT+
Sbjct  503  PEKYVGELETWNNAEAKLQSALEKWGGDWELNPGDGAFYGPKIDIMISDALKRWHQCATI  562

Query  527  QLDFQLPQRFNLSYSAEDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSP  357
            QLDFQLP RF L + A+D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSP
Sbjct  563  QLDFQLPNRFELEFKAKDNQENENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSP  622

Query  356  RQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEK  177
            RQ +V PV  K Q Y  E+RD++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE 
Sbjct  623  RQVLVVPVGVKYQEYAQEVRDKLHAAGFYADVDLSGNTLQKKVRTGQLLKYNFIFIVGED  682

Query  176  EATTGEVSVRVRDIPDHK  123
            E T   V++R RDI + +
Sbjct  683  ELTNKTVNIRNRDIVEQQ  700



>ref|NP_723725.1| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 ref|NP_001285868.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
 gb|AAF53166.2| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 gb|ACJ13176.1| FI05224p [Drosophila melanogaster]
 gb|AHN54382.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
Length=747

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  528  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  588  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  646

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  647  MVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  705

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  706  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  736



>gb|AAM50188.1| GH20022p [Drosophila melanogaster]
Length=747

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  528  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  588  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  646

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  647  MVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  705

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  706  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  736



>ref|XP_011192188.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
 ref|XP_011192189.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
 ref|XP_011192190.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
cucurbitae]
Length=689

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG  W+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  470  PEKYLGELEQWNAAEKALAESLDEFGMDWKENPGDGAFYGPKIDITIMDALKRAHQCATI  529

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  530  QLDFQLPERFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  588

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  589  MVVPVGPQFDEYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKER  648

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H  +++ +L+     +
Sbjct  649  SSDTVNVRTRDNKVHGEVSIKDLITKLNKI  678



>ref|XP_002079196.1| GD23818 [Drosophila simulans]
 gb|EDX04781.1| GD23818 [Drosophila simulans]
Length=747

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  528  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  588  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  646

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  647  MVVPVGPAYDQYAQAVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  705

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  706  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  736



>ref|XP_002042027.1| GM26732 [Drosophila sechellia]
 gb|EDW45894.1| GM26732 [Drosophila sechellia]
Length=747

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  528  PDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  588  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  646

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  647  MVVPVGPAYDQYAQAVRDQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  705

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  706  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  736



>ref|XP_005556719.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X4 [Macaca 
fascicularis]
Length=602

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  381  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  440

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  441  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  500

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  501  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  560

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  561  ISGTVNIRTRDNKVHGERTISETMERLQQLKES  593



>emb|CDF89359.1| ZYBA0S04-02388g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH08320.1| Threonine--tRNA ligase, cytoplasmic [Zygosaccharomyces bailii 
ISA1307]
Length=736

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 152/216 (70%), Gaps = 7/216 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE Y+G LE+W  AEA L  AL ++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  510  PESYVGKLETWNDAEATLAAALQKWGGKWELNPGDGAFYGPKIDIMISDALRRWHQCATV  569

Query  527  QLDFQLPQRFNLSYSA---EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSP  357
            QLDFQLP RF L Y +   E+    ERPVMIHRAILGSVERM AIL EHF GKWPFWLSP
Sbjct  570  QLDFQLPDRFGLEYKSKENEESESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSP  629

Query  356  RQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEK  177
            RQ +V PV  K Q Y  E+RD++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE+
Sbjct  630  RQILVVPVGVKYQPYAQEVRDKLHAAGFYADVDLSGNTLQKKVRNGQMLKYNFIFIVGEQ  689

Query  176  EATTGEVSVRVRDIPDHK----VMTVDELLAHFKDL  81
            E     V++R RD+ D +     +T+D +L   K L
Sbjct  690  EMNENSVNIRNRDVMDQQGKNATVTLDTVLEQLKKL  725



>ref|XP_003503703.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 ref|XP_007618308.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 gb|EGW00926.1| Threonyl-tRNA synthetase, cytoplasmic [Cricetulus griseus]
 gb|ERE81441.1| threonyl-tRNA synthetase, cytoplasmic isoform 1 [Cricetulus griseus]
Length=722

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  501  PEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  561  QLDFQLPIRFNLSYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  621  MVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  680

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   TV+E +   + L  S
Sbjct  681  ASGTVNIRTRDNKVHGERTVEETVERLQQLKQS  713



>ref|XP_002088448.1| Aats-thr [Drosophila yakuba]
 gb|EDW88160.1| Aats-thr [Drosophila yakuba]
Length=747

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 155/211 (73%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ YLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  528  PDNYLGELEQWNAAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  587

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  588  QLDFQLPIRFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQV  646

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   +RD++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  647  MVVPVGPAYDQYAQSVRDQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  705

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  706  RSSNTVNVRTRDNKVHGEVSVAELITKLQKI  736



>ref|XP_004088252.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=619

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  578  ISGTVNIRTRDNKVHGERTISETIERLQQLKQS  610



>ref|XP_009812579.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, cytoplasmic-like, 
partial [Gavia stellata]
Length=363

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E W +AE  L ++LN FG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  142  PEKYLGDIEVWNQAEKQLENSLNNFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  201

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D + + RPV+IHRAILGSVERM AIL E++ GKWP WLSP+Q 
Sbjct  202  QLDFQLPVRFNLTFVSHDGNDKTRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPQQV  261

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R   H AG   DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  262  MVVPVGPTCDEYAQKVRQHFHNAGLMADVDVDPGCTLNKKIRNAQLAQYNFILVVGEKEK  321

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ + +    +L  S
Sbjct  322  ASGTVNIRTRDNKVHGERTIADTVERLLELKCS  354



>ref|XP_003955557.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
 emb|CCF56422.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
Length=729

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 157/220 (71%), Gaps = 12/220 (5%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G+LE+W  AE  L  ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  501  PEKYVGELETWNAAEKKLESALNKWGGNWELNPGDGAFYGPKIDIMISDALRRWHQCATI  560

Query  527  QLDFQLPQRFNLSYSAEDESKR-----ERPVMIHRAILGSVERMFAILLEHFKGKWPFWL  363
            QLDFQLP RF L + A+D  +      ERPVMIHRAILGSVERM AIL EHF GKWPFWL
Sbjct  561  QLDFQLPNRFELEFKAKDNKEEANENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWL  620

Query  362  SPRQAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVG  183
            SPRQ +V PV  K Q Y  E+RD++H+AGF+ DVD S  T+QKKVR  Q+ +YN+I +VG
Sbjct  621  SPRQVLVVPVGVKYQDYAQEVRDQLHDAGFYADVDLSGNTLQKKVRNGQLLKYNFIFIVG  680

Query  182  EKEATTGEVSVRVRDIPDHK-------VMTVDELLAHFKD  84
            E+E T   V++R RD+ + +       + TV E L + K+
Sbjct  681  EQEMTEKSVNIRNRDVMEQQGKNATISLATVIEQLNNLKE  720



>ref|XP_004059038.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 5 [Gorilla 
gorilla gorilla]
Length=602

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  381  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATI  440

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  441  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  500

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  501  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  560

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  561  ISGTVNIRTRDNKVHGERTISETIERLQQL  590



>gb|KFB38665.1| AGAP008929-PA-like protein [Anopheles sinensis]
Length=764

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 160/211 (76%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++E W +AE AL D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  545  PEKYLGEIEVWNEAEKALADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATI  604

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  605  QLDFQLPIRFNLNY-IDDNGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQV  663

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y  ++R R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE
Sbjct  664  MVVPVGPAYDEYADKVRQRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKE  722

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
              +  V+VR RD   H  ++VD+L+     L
Sbjct  723  RNSETVNVRTRDNKVHGEVSVDDLVTKLSKL  753



>ref|XP_005556718.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Macaca 
fascicularis]
Length=639

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  418  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  477

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  478  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  537

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  538  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  597

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  598  ISGTVNIRTRDNKVHGERTISETMERLQQLKES  630



>ref|XP_005325709.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Ictidomys 
tridecemlineatus]
Length=722

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  501  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  561  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  621  MVVPVGPTCDEYAQQVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  680

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E +   + L  S
Sbjct  681  TSGTVNIRTRDNKVHGERTVSETIERLRQLKQS  713



>ref|NP_001125825.1| threonine--tRNA ligase, cytoplasmic [Pongo abelii]
 emb|CAH91401.1| hypothetical protein [Pongo abelii]
Length=563

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  342  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  401

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  402  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  461

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN ILVVGEKE 
Sbjct  462  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNLILVVGEKEK  521

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  522  ISGTVNIRTRDNKVHGERTISETIERLQQLKES  554



>ref|XP_004059037.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 4 [Gorilla 
gorilla gorilla]
Length=619

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  578  ISGTVNIRTRDNKVHGERTISETIERLQQL  607



>ref|XP_003729486.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like, partial 
[Strongylocentrotus purpuratus]
Length=591

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG++  W+ AE  L + LN+FG  W IN  DGAFYGPKIDI++ DA++R  QCAT+
Sbjct  371  PEKYLGEIAVWDSAEKQLENTLNKFGAEWRINPADGAFYGPKIDITILDALRRSHQCATI  430

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL YSA D +++ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  431  QLDFQLPIRFNLKYSAADGTEK-RPVIIHRAILGSVERMMAILTENFGGKWPFWLSPRQC  489

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V P+      Y + ++D++H AGF  + DT +  T+ KK+R  Q+AQ+N+ILVVGEKE 
Sbjct  490  IVIPIGPAFNDYAITVKDKLHNAGFSCEADTDAGDTMNKKIRNGQLAQFNFILVVGEKEK  549

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T G  +VR RD   H   ++DE++  F  L  S
Sbjct  550  TNGTANVRTRDNQVHGEKSIDEIITRFSALKDS  582



>ref|XP_006194878.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus ferus]
 ref|XP_010953863.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus bactrianus]
 ref|XP_010975928.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus dromedarius]
Length=709

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  488  PEKFLGDVEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  547

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  548  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  607

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++  + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  608  MVVPVGPTCDEYAQKVWQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  667

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T+G V++R RD   H   TV E +   + L  SY
Sbjct  668  TSGTVNIRTRDNKVHGERTVSETIERLQQLKQSY  701



>ref|XP_004990683.1| threonyl-tRNA synthetase isoform 2 [Salpingoeca rosetta]
 gb|EGD77339.1| threonyl-tRNA synthetase isoform 2 [Salpingoeca rosetta]
Length=766

 Score =   258 bits (660),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 155/212 (73%), Gaps = 3/212 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E WE+AEA+L  AL+EFG  W++N GDGAFYGPKIDI+V DA+KR FQCAT+
Sbjct  505  PEKFLGDVEVWERAEASLAKALDEFGHEWKLNPGDGAFYGPKIDITVHDALKRSFQCATI  564

Query  527  QLDFQLPQRFNLSY--SAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP RFNL Y  + ++E    RPV+IHRAILGSVERMFAIL EH+ GKWPFWLSPR
Sbjct  565  QLDFQLPIRFNLEYVPARKEEGVVYRPVIIHRAILGSVERMFAILCEHYAGKWPFWLSPR  624

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEK  177
            QA V P+  +   Y  E+R   H  GF VDVD  D  T+QKKVR A V QYN+ILVVGE 
Sbjct  625  QAQVVPIHPEFNKYAEEVRMFFHTHGFAVDVDADDSLTLQKKVRRACVEQYNFILVVGEA  684

Query  176  EATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            E     V+VR RD      +++DELL  +K L
Sbjct  685  ECKKRTVNVRTRDGSRIGELSLDELLCDWKQL  716



>ref|XP_002714160.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Oryctolagus cuniculus]
Length=723

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D  +  T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDAGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   T+ E +   + L  S
Sbjct  682  TSGTVNIRTRDNKVHGERTISETIERLQQLKQS  714



>ref|XP_002014541.1| GL19239 [Drosophila persimilis]
 ref|XP_001356405.2| GA18821 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28537.1| GL19239 [Drosophila persimilis]
 gb|EAL33469.2| GA18821 [Drosophila pseudoobscura pseudoobscura]
Length=754

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  535  PEKYLGELEQWNDAEKALEESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  594

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  595  QLDFQLPIRFNLNYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  653

Query  347  MVCPVSDKSQAYGMELRDRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            MV PV      Y   ++D++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE
Sbjct  654  MVVPVGPAYDQYAQTVKDQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKE  712

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             ++  V+VR RD   H  ++V EL+   + +
Sbjct  713  RSSNTVNVRTRDNKVHGEVSVSELITKLQKI  743



>gb|EDL03283.1| threonyl-tRNA synthetase, isoform CRA_a [Mus musculus]
Length=544

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 151/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  323  PEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  382

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  383  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  442

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  443  MVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  502

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV+E +   + L
Sbjct  503  ASGTVNIRTRDNKVHGERTVEETVRRLQQL  532



>gb|EFB17446.1| hypothetical protein PANDA_008118 [Ailuropoda melanoleuca]
Length=678

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  457  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  516

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  517  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  576

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE 
Sbjct  577  MVVPVGPTCDEYAQKVRQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEK  636

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  637  ASGTVNIRTRDNKVHGERTISETIERLQQLKQS  669



>gb|EFA77297.1| threonyl-tRNA synthetase [Polysphondylium pallidum PN500]
Length=716

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 149/207 (72%), Gaps = 0/207 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ +LG    W+ AE +L DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+
Sbjct  503  PDNHLGTAAQWDVAENSLRDALNKFGKPWKLNPGDGAFYGPKIDIQIFDVLKRAHQCATI  562

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y      +R RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQ 
Sbjct  563  QLDFQLPIRFELEYMGSGPEERHRPVIIHRAILGSVERMMAILIEHTAGKWPFWVSPRQV  622

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            +V  VS+K   Y   +   + +AGF+ DVD SD+T+ KKVREAQ++QYNYILVVGE+E  
Sbjct  623  LVATVSEKFADYAKSVTKTLTDAGFYADVDLSDKTLPKKVREAQLSQYNYILVVGEEELN  682

Query  167  TGEVSVRVRDIPDHKVMTVDELLAHFK  87
               V+VR RD      +TVD L+  FK
Sbjct  683  NNTVNVRTRDNVVRGSITVDALIEEFK  709



>ref|XP_008472446.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Diaphorina citri]
Length=559

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 154/210 (73%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W KAE  L  +LN FG+PW  N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  340  PEKYLGELEVWNKAEKQLEASLNSFGEPWTENPGDGAFYGPKIDITITDALKRPHQCATI  399

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  E + ++ RPVMIHRAILGSVERM AIL E + GKWPFW+SPRQ 
Sbjct  400  QLDFQLPIRFNLAYVNE-KGEKNRPVMIHRAILGSVERMVAILTESYAGKWPFWISPRQG  458

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V PV++    Y  +++++I  AGF  D D  S  T+ KK+R AQ++QYN+I+VVGEKE 
Sbjct  459  IVIPVAEPFNEYADQVKNKIFAAGFMCDADLDSSDTLNKKIRNAQISQYNFIMVVGEKEK  518

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H   +VD+++  F  L
Sbjct  519  SSNTVNVRTRDNIVHGEFSVDDVITRFGKL  548



>ref|XP_005003846.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cavia 
porcellus]
Length=721

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+
Sbjct  500  PEKFLGDIEIWNQAEKQLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATI  559

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q 
Sbjct  560  QLDFQLPIRFNLTFVSHDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQV  619

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  620  MVVPVGPTCDEYAQKVRQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  679

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T+G V++R RD   H   T+ E +   + L  S+
Sbjct  680  TSGTVNIRTRDNKVHGERTISETIERLQQLKQSH  713



>ref|XP_006875438.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Chrysochloris asiatica]
Length=696

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  475  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  534

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ 
Sbjct  535  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQV  594

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  595  MVVPVGPTCDEYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  654

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            ++G V++R RD   H   TV E +   + LM S
Sbjct  655  SSGTVNIRTRDNKVHGERTVSETITRLQQLMQS  687



>ref|XP_011290653.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Musca 
domestica]
Length=699

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  480  PEKYLGELEQWNAAEKALAESLDEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  539

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y ++D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  540  QLDFQLPIRFNLNYISDDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  598

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF V+ D  +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  599  MVVPVGPQFDEYAQSVRDQLHAAGFMVEADCDAGDTMNKKIRNAQLAQFNFILVVGEKER  658

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H  +++ +L+   + +
Sbjct  659  SSNTVNVRTRDNKVHGEVSIADLITKLQKI  688



>ref|XP_003470228.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cavia 
porcellus]
Length=721

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+
Sbjct  500  PEKFLGDIEIWNQAEKQLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATI  559

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q 
Sbjct  560  QLDFQLPIRFNLTFVSHDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQV  619

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  620  MVVPVGPTCDEYAQKVRQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  679

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
            T+G V++R RD   H   T+ E +   + L  S+
Sbjct  680  TSGTVNIRTRDNKVHGERTISETIERLQQLKQSH  713



>ref|XP_005325710.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Ictidomys 
tridecemlineatus]
Length=758

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  537  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  596

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  597  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  656

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  657  MVVPVGPTCDEYAQQVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  716

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E +   + L  S
Sbjct  717  TSGTVNIRTRDNKVHGERTVSETIERLRQLKQS  749



>dbj|BAG59361.1| unnamed protein product [Homo sapiens]
Length=602

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  381  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  440

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  441  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  500

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  501  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  560

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  561  ISGTVNIRTRDNKVHGERTISETIERLQQL  590



>ref|XP_008213480.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Nasonia 
vitripennis]
Length=720

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 153/208 (74%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LG++  W+ AE AL+++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  500  PEKFLGEVAVWDAAEKALSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATI  559

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  E   ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  560  QLDFQLPIRFNLNYVNET-GEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQV  618

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  + RD+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE 
Sbjct  619  MVIPVGPSLDEYATQTRDKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEK  678

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V+VR RD   H  + VD+L+  F+
Sbjct  679  AAGTVNVRTRDNKVHGEIGVDDLIQKFQ  706



>ref|XP_004088251.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=664

 Score =   256 bits (653),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  443  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  502

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  503  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  562

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  563  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  622

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  623  ISGTVNIRTRDNKVHGERTISETIERLQQLKQS  655



>ref|XP_005178933.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Musca 
domestica]
Length=713

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  494  PEKYLGELEQWNAAEKALAESLDEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  553

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y ++D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  554  QLDFQLPIRFNLNYISDDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  612

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF V+ D  +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  613  MVVPVGPQFDEYAQSVRDQLHAAGFMVEADCDAGDTMNKKIRNAQLAQFNFILVVGEKER  672

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H  +++ +L+   + +
Sbjct  673  SSNTVNVRTRDNKVHGEVSIADLITKLQKI  702



>ref|XP_004385288.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 3 [Trichechus 
manatus latirostris]
Length=602

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  381  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  440

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSP Q 
Sbjct  441  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPHQV  500

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  501  MVVPVGPMCDEYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  560

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E +   + L  S
Sbjct  561  TSGTVNIRTRDNKVHGERTVSETIERLQQLKQS  593



>ref|XP_001603180.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Nasonia 
vitripennis]
Length=705

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 153/208 (74%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LG++  W+ AE AL+++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  485  PEKFLGEVAVWDAAEKALSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATI  544

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  E   ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  545  QLDFQLPIRFNLNYVNE-TGEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQV  603

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  + RD+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE 
Sbjct  604  MVIPVGPSLDEYATQTRDKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEK  663

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V+VR RD   H  + VD+L+  F+
Sbjct  664  AAGTVNVRTRDNKVHGEIGVDDLIQKFQ  691



>ref|XP_011192187.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Bactrocera 
cucurbitae]
Length=784

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG  W+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  565  PEKYLGELEQWNAAEKALAESLDEFGMDWKENPGDGAFYGPKIDITIMDALKRAHQCATI  624

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP+RFNLSY A+D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  625  QLDFQLPERFNLSYIADDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  683

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  684  MVVPVGPQFDEYAQSVRDQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKER  743

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H  +++ +L+     +
Sbjct  744  SSDTVNVRTRDNKVHGEVSIKDLITKLNKI  773



>ref|XP_004698143.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Echinops telfairi]
Length=664

 Score =   256 bits (653),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  443  PEKFLGDIEIWNQAEKQLENSLNEFGERWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  502

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  503  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  562

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A    DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  563  MVVPVGPTCDEYAQKVRLQFHDANIMADVDLDPGCTLNKKIRHAQLAQYNFILVVGEKEK  622

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E L   K L  S
Sbjct  623  TSGTVNIRTRDNKVHGERTVSETLERLKQLKQS  655



>gb|ELK31735.1| Threonyl-tRNA synthetase, cytoplasmic [Myotis davidii]
Length=649

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W  AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  428  PEKFLGDIEVWNHAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  487

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  488  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  547

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            M+ PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  548  MIVPVGPTCDDYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  607

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV E +A  + L
Sbjct  608  ASGTVNIRTRDNKVHGERTVAETVARLQQL  637



>ref|XP_004059036.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 3 [Gorilla 
gorilla gorilla]
Length=664

 Score =   256 bits (653),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  443  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATI  502

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  503  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  562

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  563  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  622

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  623  ISGTVNIRTRDNKVHGERTISETIERLQQL  652



>ref|XP_011342020.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cerapachys 
biroi]
Length=711

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD   W++AE AL D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  491  PEKFLGDAAVWDQAERALEDSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATI  550

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQA
Sbjct  551  QLDFQLPIRFNLSYINE-AGEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQA  609

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            M+ PV+ +   Y  E+  ++  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  610  MIVPVASQFNDYAYEVEQKLWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQ  669

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
              G V++R RD   H  M V+EL+A  K L  S
Sbjct  670  IAGTVNIRTRDNVVHGEMAVEELIAKLKVLKES  702



>gb|EAX10803.1| threonyl-tRNA synthetase, isoform CRA_a [Homo sapiens]
Length=619

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  578  ISGTVNIRTRDNKVHGERTISETIERLQQL  607



>ref|XP_004325399.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Tursiops 
truncatus]
Length=619

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+  V++R RD   H   T+ E +   + L  S
Sbjct  578  TSSTVNIRTRDNKVHGERTISETIEWLQQLKQS  610



>ref|XP_006875437.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Chrysochloris asiatica]
Length=723

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            ++G V++R RD   H   TV E +   + LM S
Sbjct  682  SSGTVNIRTRDNKVHGERTVSETITRLQQLMQS  714



>ref|XP_008690887.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Ursus maritimus]
Length=723

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ASGTVNIRTRDNKVHGERTISETIERLQQLKQS  714



>ref|XP_002919483.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Ailuropoda melanoleuca]
Length=723

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ASGTVNIRTRDNKVHGERTISETIERLQQLKQS  714



>ref|XP_004385287.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 2 [Trichechus 
manatus latirostris]
Length=619

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 152/213 (71%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSP Q 
Sbjct  458  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPHQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPMCDEYAQKVRQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E +   + L  S
Sbjct  578  TSGTVNIRTRDNKVHGERTVSETIERLQQLKQS  610



>ref|XP_009117635.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Brassica rapa]
Length=436

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 162/236 (69%), Gaps = 32/236 (14%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPW-EINEGDGAFYGPKIDISVCDAMKRKFQCAT  531
            PE+   DL+ WE++E  L +AL EFGKP+  +N G+GAF GPKIDI++ DAMKRKFQCA+
Sbjct  197  PEENTKDLQRWEESENDLVEALQEFGKPFIVVNRGEGAFCGPKIDITLSDAMKRKFQCAS  256

Query  530  LQLDFQLPQRFNLSYSAEDESKRE------------------RPVMIHRAILGSVERMFA  405
            +QLDFQLP  F L YS  DE K+E                  RPVMIHR +LGS ERM A
Sbjct  257  IQLDFQLPDHFKLRYSPSDEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLA  316

Query  404  ILLEHFKGKWPFWLSPRQAMVCPVSDKS--QAYGMELRDRIHEAGFHVDVDTSDRTIQKK  231
            ILL H+KGKWPFW+SPRQ +VC  S+    ++Y  E+R +IHEAG+HVDVDT+DR I +K
Sbjct  317  ILLNHYKGKWPFWISPRQVIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEK  376

Query  230  VREAQVAQYNYILVVGEKEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  87
            V EA++AQYNYILVVG++E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  377  VGEAEIAQYNYILVVGDEEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  429



>ref|XP_004678135.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Condylura cristata]
Length=723

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   T+ E +   + L  S
Sbjct  682  TSGTVNIRTRDNKVHGERTLAEAIGRLQQLKRS  714



>dbj|BAG53144.1| unnamed protein product [Homo sapiens]
Length=619

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G +++R RD   H   T+ E +   + L
Sbjct  578  ISGTINIRTRDNKVHGERTISETIERLQQL  607



>ref|XP_006148565.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Tupaia chinensis]
Length=722

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  501  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  561  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  621  MVIPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  680

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   T+ E +   + L  S
Sbjct  681  TSGTVNIRTRDNKVHGERTISETIERLQQLKQS  713



>ref|XP_005178932.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Musca 
domestica]
Length=779

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG+LE W  AE AL ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  560  PEKYLGELEQWNAAEKALAESLDEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATI  619

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y ++D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  620  QLDFQLPIRFNLNYISDDGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQV  678

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y   +RD++H AGF V+ D  +  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  679  MVVPVGPQFDEYAQSVRDQLHAAGFMVEADCDAGDTMNKKIRNAQLAQFNFILVVGEKER  738

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
            ++  V+VR RD   H  +++ +L+   + +
Sbjct  739  SSNTVNVRTRDNKVHGEVSIADLITKLQKI  768



>ref|XP_003703597.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Megachile 
rotundata]
Length=712

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGDL  W++AE AL ++L+ FG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  496  PEKYLGDLAMWDQAEKALQESLDVFGDPWKFNPGDGAFYGPKIDITIMDALKRSHQCATI  555

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ 
Sbjct  556  QLDFQLPIRFNLSYVNE-AGEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQV  614

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PVS +   Y  E+++++  AGF  ++DT    T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  615  MVIPVSSQFDDYASEVKEKLWNAGFMAEIDTDPSDTLNKKIRNAQLAQFNFILVVGEKEL  674

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V+VR RD   H  + V++++  FK
Sbjct  675  KAGTVNVRTRDNVVHGEVAVEDIIEQFK  702



>ref|XP_002499537.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60795.1| predicted protein [Micromonas sp. RCC299]
Length=722

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE+W KAEAAL  ALN  GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+
Sbjct  473  PEGYLGELETWNKAEAALEAALNGTGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATV  532

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY +E  ++ ERP++IHRAILGSVERMFAIL EHF GKWPFWLSPRQ 
Sbjct  533  QLDFQLPIRFNLSYVSE-ANEPERPIIIHRAILGSVERMFAILTEHFAGKWPFWLSPRQV  591

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEAT  168
            M+ P+S++S+ Y  E+R  + + GF+ +VD SDR +QKKVREAQ+ Q+NYILVVGE E T
Sbjct  592  MIVPISEQSRDYAHEVRSVLRKEGFYCEVDDSDRKMQKKVREAQLEQWNYILVVGEGEKT  651

Query  167  TGEVSVRVRD  138
               V++R RD
Sbjct  652  NRTVNIRTRD  661



>ref|XP_010168916.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Caprimulgus carolinensis]
 gb|KFZ47626.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Caprimulgus 
carolinensis]
Length=395

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 150/215 (70%), Gaps = 3/215 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE YLG+LE W+ AE  L ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  174  PENYLGELEIWDHAEKQLQNSLNNFGEKWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATI  233

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y  +D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  234  QLDFQLPIRFNLTYVGKDGDDKKRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQV  293

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR--TIQKKVREAQVAQYNYILVVGEKE  174
            MV PV   S+ Y  ++     EAGF  DVD  DR  T+ KK+R AQ+AQYN+ILVVGEKE
Sbjct  294  MVVPVGPTSEEYARQVCSEFFEAGFMSDVDL-DRSCTLNKKIRNAQLAQYNFILVVGEKE  352

Query  173  ATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
                 V+VR RD   H  ++V   +   K L  S+
Sbjct  353  KANNAVNVRTRDNKVHGEISVCSAIEKLKKLKTSH  387



>ref|XP_004412948.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Odobenus rosmarus 
divergens]
Length=723

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VDVD     T+ KK+R AQ+AQYN+ILV+GEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ASGTVNIRTRDNKVHGERTIPETIERLQQLKQS  714



>ref|XP_011342019.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cerapachys 
biroi]
 gb|EZA52272.1| Threonyl-tRNA synthetase, cytoplasmic [Cerapachys biroi]
Length=716

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD   W++AE AL D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+
Sbjct  496  PEKFLGDAAVWDQAERALEDSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATI  555

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E   ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQA
Sbjct  556  QLDFQLPIRFNLSYINE-AGEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQA  614

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            M+ PV+ +   Y  E+  ++  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  615  MIVPVASQFNDYAYEVEQKLWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQ  674

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
              G V++R RD   H  M V+EL+A  K L  S
Sbjct  675  IAGTVNIRTRDNVVHGEMAVEELIAKLKVLKES  707



>ref|XP_011264917.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Camponotus 
floridanus]
 gb|EFN62386.1| Threonyl-tRNA synthetase, cytoplasmic [Camponotus floridanus]
Length=689

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG L+ W++AE AL ++LN FG+PW +N  DGAFYGPKIDI++ DA+KR  Q AT+
Sbjct  469  PEKYLGSLKVWDRAEKALEESLNAFGQPWTLNPQDGAFYGPKIDITLMDALKRAHQTATI  528

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E+  ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQA
Sbjct  529  QLDFQLPMRFNLSYVNEN-GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQA  587

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y  E++ ++ +AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  588  MVVPVVSQFDEYAYEVKQKLWDAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKER  647

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V++R RD   H  M V+EL+A  K
Sbjct  648  NAGTVNIRTRDNVVHGEMAVEELIAKLK  675



>ref|XP_009447608.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Pan 
troglodytes]
Length=664

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  443  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  502

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  503  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  562

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  563  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  622

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   T+ E +   + L
Sbjct  623  ISGTVNIRTRDNKVHGERTISETIERLQQL  652



>ref|XP_006996688.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Peromyscus maniculatus 
bairdii]
Length=722

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 154/210 (73%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  501  PEKFLGDIEIWDQAEKQLENSLNEFGEKWELNLGDGAFYGPKIDIQIKDAIGRYHQCATI  560

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  561  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  620

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  621  MVVPVGPTCDEYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  680

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV+E +   + L
Sbjct  681  ASGTVNIRTRDNKVHGERTVEETVERLQQL  710



>ref|XP_003274971.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 1 [Nomascus 
leucogenys]
Length=723

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ISGTVNIRTRDNKVHGERTISETIERLQQLKQS  714



>ref|XP_009206493.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Papio 
anubis]
 ref|XP_009206494.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Papio 
anubis]
Length=664

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  443  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNCGDGAFYGPKIDIQIKDAIGRYHQCATI  502

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  503  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  562

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  563  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  622

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  623  ISGTVNIRTRDNKVHGERTISETMERLQQLKES  655



>ref|XP_005556717.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Macaca 
fascicularis]
Length=723

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ISGTVNIRTRDNKVHGERTISETMERLQQLKES  714



>ref|XP_011264916.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Camponotus 
floridanus]
Length=710

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG L+ W++AE AL ++LN FG+PW +N  DGAFYGPKIDI++ DA+KR  Q AT+
Sbjct  490  PEKYLGSLKVWDRAEKALEESLNAFGQPWTLNPQDGAFYGPKIDITLMDALKRAHQTATI  549

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E+  ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQA
Sbjct  550  QLDFQLPMRFNLSYVNEN-GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQA  608

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y  E++ ++ +AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  609  MVVPVVSQFDEYAYEVKQKLWDAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKER  668

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V++R RD   H  M V+EL+A  K
Sbjct  669  NAGTVNIRTRDNVVHGEMAVEELIAKLK  696



>ref|XP_004349538.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91684.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
Length=726

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PE +LGD+  W+KAE  L ++LN+FG PW++N GDGAFYGPKIDI++ DA++R  QCAT+
Sbjct  495  PEGFLGDIALWDKAEKQLEESLNKFGAPWKLNPGDGAFYGPKIDITIMDALRRSHQCATI  554

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF L Y A D ++ + PV+IHRAILGSVERM AIL E+F GKWPFWLSPRQA
Sbjct  555  QLDFQLPIRFGLKYQAPDGTE-QTPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQA  613

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V  VS     Y  E++ ++H+AGFHVD D   D T+ KKVR AQ+AQYN+ILVVG +E 
Sbjct  614  LVIAVSKDCNDYAHEVQKQLHDAGFHVDYDLWPDETLNKKVRNAQLAQYNFILVVGARER  673

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +   +VR RD   H   T+ +L+A F +L  S
Sbjct  674  ESRSANVRTRDNKVHGERTIPQLIAEFTELAKS  706



>ref|XP_007959499.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Chlorocebus 
sabaeus]
Length=723

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL+Y + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ E +   + L  S
Sbjct  682  ISGTVNIRTRDNKVHGERTISETMERLQQLKES  714



>ref|XP_006761862.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Myotis davidii]
Length=725

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W  AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  504  PEKFLGDIEVWNHAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  563

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  564  QLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  623

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            M+ PV      Y  ++R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  624  MIVPVGPTCDDYAQKVRQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  683

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDL  81
             +G V++R RD   H   TV E +A  + L
Sbjct  684  ASGTVNIRTRDNKVHGERTVAETVARLQQL  713



>ref|XP_010166514.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Caprimulgus carolinensis]
Length=446

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLGD+E W +AE  L ++LN+FG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  225  PEKYLGDIEVWNQAEKQLENSLNDFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  284

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D + + RPV+IHRAILGSVERM AIL E++ GKWP WLSP+Q 
Sbjct  285  QLDFQLPVRFNLTFVSHDGNDKTRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPQQV  344

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R   H+AG   DVD     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  345  MVVPVGPTCDEYAQKVRQHFHDAGLMADVDVDPGCTLNKKIRNAQLAQYNFILVVGEKEK  404

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
             +G V++R RD   H   T+ + +    +L  S
Sbjct  405  ASGTVNIRTRDNKVHGERTIADTVERLLELKCS  437



>emb|CDW52205.1| threonyl tRNA synthetase, cytoplasmic [Trichuris trichiura]
Length=707

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 153/214 (71%), Gaps = 2/214 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            P+ +LGD+E+W  AE  L  AL+ F  PW +N GDGAFYGPKIDI V DAM+R  QCAT+
Sbjct  487  PDDFLGDIETWNDAEEQLKCALDNFNLPWTLNAGDGAFYGPKIDIIVLDAMRRGHQCATV  546

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RF+L Y+ E+  K +RPV++HRAILGS+ERM A+L E+F GKWPFWLSPRQA
Sbjct  547  QLDFQLPIRFDLHYTDENGVK-QRPVIVHRAILGSIERMIAVLTENFGGKWPFWLSPRQA  605

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            +V PV     +Y   ++D+I+EAGF  DVD  S  T  KKVR AQVAQYNYILVVGEKE 
Sbjct  606  IVVPVHPVLDSYAEAVKDKIYEAGFECDVDLDSSDTFNKKVRNAQVAQYNYILVVGEKEK  665

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASY  69
              G V+VR RD   H   TV +L+  F+ L   Y
Sbjct  666  ENGTVNVRTRDNKVHGEFTVSDLIQRFRRLKDEY  699



>ref|XP_008046647.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Tarsius syrichta]
Length=723

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 153/213 (72%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W +AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  502  PEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  561

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  562  QLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQV  621

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  ++R + H+A F  D+D     T+ KK+R AQ+AQYN+ILV+GEKE 
Sbjct  622  MVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEK  681

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   TV E +   + L  S
Sbjct  682  TSGTVNIRTRDNKVHGERTVSETIERLQQLKQS  714



>gb|EDZ71519.1| YIL078Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=689

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 158/215 (73%), Gaps = 6/215 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G +E+W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  464  PEKYVGKIETWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATI  523

Query  527  QLDFQLPQRFNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP RF L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPR
Sbjct  524  QLDFQLPNRFELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPR  583

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            Q +V PV  K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E
Sbjct  584  QVLVVPVGVKYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQE  643

Query  173  ATTGEVSVRVRDIPDHK----VMTVDELLAHFKDL  81
                 V++R RD+ + +     ++V+E+L   ++L
Sbjct  644  MNEKSVNIRNRDVMEQQGKNATVSVEEVLKQLRNL  678



>ref|XP_005983077.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Pantholops 
hodgsonii]
Length=619

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 155/213 (73%), Gaps = 1/213 (0%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEK+LGD+E W++AE  L ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+
Sbjct  398  PEKFLGDVEVWDQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATI  457

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNL++ + D   +++PV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ 
Sbjct  458  QLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQV  517

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV      Y  +++ + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE 
Sbjct  518  MVVPVGPTCDEYAQKVQQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEK  577

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  72
            T+G V++R RD   H   ++ E +   + L  S
Sbjct  578  TSGTVNIRTRDNKVHGERSISETIERLQQLKLS  610



>gb|AJR37072.1| Ths1p [Saccharomyces cerevisiae YJM195]
 gb|AJR44653.1| Ths1p [Saccharomyces cerevisiae YJM1248]
 gb|AJR50884.1| Ths1p [Saccharomyces cerevisiae YJM1439]
Length=734

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 158/215 (73%), Gaps = 6/215 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G +E+W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  509  PEKYVGKIETWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATI  568

Query  527  QLDFQLPQRFNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP RF L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPR
Sbjct  569  QLDFQLPNRFELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPR  628

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            Q +V PV  K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E
Sbjct  629  QVLVVPVGVKYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQE  688

Query  173  ATTGEVSVRVRDIPDHK----VMTVDELLAHFKDL  81
                 V++R RD+ + +     ++V+E+L   ++L
Sbjct  689  MNEKSVNIRNRDVMEQQGKNATVSVEEVLKQLRNL  723



>ref|XP_011264915.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Camponotus 
floridanus]
Length=713

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 2/208 (1%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKYLG L+ W++AE AL ++LN FG+PW +N  DGAFYGPKIDI++ DA+KR  Q AT+
Sbjct  493  PEKYLGSLKVWDRAEKALEESLNAFGQPWTLNPQDGAFYGPKIDITLMDALKRAHQTATI  552

Query  527  QLDFQLPQRFNLSYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQA  348
            QLDFQLP RFNLSY  E+  ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQA
Sbjct  553  QLDFQLPMRFNLSYVNEN-GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQA  611

Query  347  MVCPVSDKSQAYGMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEA  171
            MV PV  +   Y  E++ ++ +AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE 
Sbjct  612  MVVPVVSQFDEYAYEVKQKLWDAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKER  671

Query  170  TTGEVSVRVRDIPDHKVMTVDELLAHFK  87
              G V++R RD   H  M V+EL+A  K
Sbjct  672  NAGTVNIRTRDNVVHGEMAVEELIAKLK  699



>gb|AJR47138.1| Ths1p [Saccharomyces cerevisiae YJM1342]
Length=734

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 158/215 (73%), Gaps = 6/215 (3%)
 Frame = -1

Query  707  PEKYLGDLESWEKAEAALTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATL  528
            PEKY+G +E+W+ AE+ L  AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+
Sbjct  509  PEKYVGKIETWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATI  568

Query  527  QLDFQLPQRFNLSYSAEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  354
            QLDFQLP RF L + ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPR
Sbjct  569  QLDFQLPNRFELEFKSKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPR  628

Query  353  QAMVCPVSDKSQAYGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKE  174
            Q +V PV  K Q Y  ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E
Sbjct  629  QVLVVPVGVKYQGYAEDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQE  688

Query  173  ATTGEVSVRVRDIPDHK----VMTVDELLAHFKDL  81
                 V++R RD+ + +     ++V+E+L   ++L
Sbjct  689  MNEKSVNIRNRDVMEQQGKNATVSVEEVLKQLRNL  723



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350