BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029L22

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD22104.1|  B12D protein                                            124   1e-33   Ipomoea batatas [batate]
ref|XP_002283743.1|  PREDICTED: uncharacterized protein LOC100263922    114   2e-29   Vitis vinifera
emb|CBI15096.3|  unnamed protein product                                113   2e-29   Vitis vinifera
ref|XP_011087179.1|  PREDICTED: uncharacterized protein LOC105168733    112   4e-29   Sesamum indicum [beniseed]
ref|XP_004152455.1|  PREDICTED: uncharacterized protein LOC101218501    112   6e-29   
ref|XP_008437938.1|  PREDICTED: uncharacterized protein LOC103483212    112   6e-29   Cucumis melo [Oriental melon]
ref|XP_010929102.1|  PREDICTED: uncharacterized protein LOC105050689    112   8e-29   Elaeis guineensis
ref|XP_008806317.1|  PREDICTED: uncharacterized protein LOC103719037    111   2e-28   Phoenix dactylifera
ref|XP_008798028.1|  PREDICTED: uncharacterized protein LOC103713044    111   2e-28   Phoenix dactylifera
ref|XP_010942173.1|  PREDICTED: uncharacterized protein LOC105060...    110   2e-28   Elaeis guineensis
ref|XP_008779549.1|  PREDICTED: uncharacterized protein LOC103699287    110   3e-28   Phoenix dactylifera
ref|XP_007138129.1|  hypothetical protein PHAVU_009G182600g             110   6e-28   Phaseolus vulgaris [French bean]
gb|AGC24177.1|  unknown                                                 109   1e-27   Rehmannia glutinosa [Chinese foxglove]
ref|XP_010100274.1|  hypothetical protein L484_027580                   108   1e-27   Morus notabilis
ref|XP_010556171.1|  PREDICTED: uncharacterized protein LOC104825524    108   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010027794.1|  PREDICTED: uncharacterized protein LOC104418219    108   2e-27   Eucalyptus grandis [rose gum]
ref|XP_006357136.1|  PREDICTED: uncharacterized protein LOC102583994    108   2e-27   Solanum tuberosum [potatoes]
ref|XP_010913425.1|  PREDICTED: uncharacterized protein LOC105039118    108   2e-27   Elaeis guineensis
ref|XP_010027818.1|  PREDICTED: uncharacterized protein LOC104418237    108   2e-27   Eucalyptus grandis [rose gum]
ref|XP_006856912.1|  hypothetical protein AMTR_s00055p00220460          108   3e-27   Amborella trichopoda
ref|XP_010678668.1|  PREDICTED: uncharacterized protein LOC104894188    108   3e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG26447.1|  Uncharacterized protein F383_04740                      107   3e-27   Gossypium arboreum [tree cotton]
ref|XP_009760043.1|  PREDICTED: uncharacterized protein LOC104212451    107   4e-27   Nicotiana sylvestris
ref|XP_006338509.1|  PREDICTED: uncharacterized protein LOC102603775    107   5e-27   Solanum tuberosum [potatoes]
ref|XP_004233340.1|  PREDICTED: uncharacterized protein LOC101261386    107   5e-27   
gb|EPS70000.1|  hypothetical protein M569_04763                         107   6e-27   Genlisea aurea
ref|XP_009615457.1|  PREDICTED: uncharacterized protein LOC104108174    107   6e-27   Nicotiana tomentosiformis
ref|XP_003527039.1|  PREDICTED: uncharacterized protein LOC100499787    106   1e-26   Glycine max [soybeans]
ref|XP_004501964.1|  PREDICTED: uncharacterized protein LOC101508877    106   1e-26   Cicer arietinum [garbanzo]
ref|XP_011042649.1|  PREDICTED: uncharacterized protein LOC105138299    106   2e-26   Populus euphratica
ref|NP_001148351.1|  LOC100281961                                       105   2e-26   Zea mays [maize]
ref|XP_002438146.1|  hypothetical protein SORBIDRAFT_10g008810          105   2e-26   Sorghum bicolor [broomcorn]
ref|XP_010111964.1|  hypothetical protein L484_004741                   106   2e-26   Morus notabilis
ref|XP_002511469.1|  conserved hypothetical protein                     105   2e-26   Ricinus communis
ref|XP_010272106.1|  PREDICTED: uncharacterized protein LOC104607987    105   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009771458.1|  PREDICTED: uncharacterized protein LOC104221988    105   2e-26   Nicotiana sylvestris
ref|XP_006404294.1|  hypothetical protein EUTSA_v10010862mg             105   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_009785405.1|  PREDICTED: uncharacterized protein LOC104233674    105   2e-26   Nicotiana sylvestris
ref|XP_004232259.1|  PREDICTED: uncharacterized protein LOC101265497    105   3e-26   Solanum lycopersicum
ref|NP_001057280.1|  Os06g0246000                                       105   3e-26   
ref|XP_003523058.1|  PREDICTED: uncharacterized protein LOC100500534    105   3e-26   Glycine max [soybeans]
ref|XP_008340166.1|  PREDICTED: uncharacterized protein LOC103403120    105   3e-26   
emb|CAK22419.1|  B12D-like protein                                      105   3e-26   Beta vulgaris [beet]
ref|XP_011098540.1|  PREDICTED: uncharacterized protein LOC105177185    105   4e-26   Sesamum indicum [beniseed]
ref|XP_011085792.1|  PREDICTED: uncharacterized protein LOC105167687    105   4e-26   Sesamum indicum [beniseed]
ref|XP_006845122.1|  hypothetical protein AMTR_s00005p00190110          105   5e-26   Amborella trichopoda
ref|XP_009403647.1|  PREDICTED: uncharacterized protein LOC103987158    105   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008222037.1|  PREDICTED: uncharacterized protein LOC103321965    105   5e-26   Prunus mume [ume]
ref|XP_002318014.1|  senescence-associated family protein               105   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007226455.1|  hypothetical protein PRUPE_ppa024551mg             105   5e-26   Prunus persica
gb|ADB08699.1|  B12D-like protein                                       104   5e-26   Wolffia arrhiza
ref|XP_003551877.1|  PREDICTED: uncharacterized protein LOC100500344    104   6e-26   Glycine max [soybeans]
ref|XP_008792162.1|  PREDICTED: uncharacterized protein LOC103708847    104   6e-26   Phoenix dactylifera
ref|XP_010511712.1|  PREDICTED: uncharacterized protein LOC104787778    104   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009627555.1|  PREDICTED: uncharacterized protein LOC104118078    106   6e-26   
ref|XP_009385140.1|  PREDICTED: uncharacterized protein LOC103972508    104   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP14927.1|  unnamed protein product                                104   9e-26   Coffea canephora [robusta coffee]
gb|ACU15396.1|  unknown                                                 104   9e-26   Glycine max [soybeans]
gb|AFO59572.1|  B12D like protein                                       103   1e-25   Saccharum hybrid cultivar GT28
ref|XP_009588369.1|  PREDICTED: uncharacterized protein LOC104085953    104   1e-25   Nicotiana tomentosiformis
ref|XP_010470676.1|  PREDICTED: uncharacterized protein LOC104750563    105   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010930055.1|  PREDICTED: uncharacterized protein LOC105051361    103   1e-25   Elaeis guineensis
ref|XP_004236155.1|  PREDICTED: uncharacterized protein LOC101260417    103   1e-25   Solanum lycopersicum
ref|NP_001152717.1|  LOC100286358                                       103   1e-25   Zea mays [maize]
emb|CDP02170.1|  unnamed protein product                                103   1e-25   Coffea canephora [robusta coffee]
ref|XP_006344997.1|  PREDICTED: uncharacterized protein LOC102605944    103   2e-25   Solanum tuberosum [potatoes]
ref|XP_010546014.1|  PREDICTED: uncharacterized protein LOC104818223    103   2e-25   Tarenaya hassleriana [spider flower]
gb|AEC10990.1|  b12d-like protein                                       103   2e-25   Camellia sinensis [black tea]
gb|ACU15648.1|  unknown                                                 103   2e-25   Glycine max [soybeans]
ref|XP_006439727.1|  hypothetical protein CICLE_v10023087mg             103   2e-25   Citrus clementina [clementine]
ref|XP_010415343.1|  PREDICTED: uncharacterized protein LOC104701372    103   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007209803.1|  hypothetical protein PRUPE_ppa014036mg             103   2e-25   Prunus persica
ref|XP_008800943.1|  PREDICTED: uncharacterized protein LOC103715180    103   3e-25   Phoenix dactylifera
ref|XP_007163724.1|  hypothetical protein PHAVU_001G258900g             102   3e-25   Phaseolus vulgaris [French bean]
ref|XP_002270661.1|  PREDICTED: uncharacterized protein LOC100259604    102   4e-25   Vitis vinifera
ref|XP_003538567.1|  PREDICTED: uncharacterized protein LOC100527541    102   4e-25   Glycine max [soybeans]
ref|XP_004965125.1|  PREDICTED: uncharacterized protein LOC101762161    102   5e-25   Setaria italica
ref|XP_011042304.1|  PREDICTED: uncharacterized protein LOC105138023    102   5e-25   Populus euphratica
emb|CDY44977.1|  BnaCnng12070D                                          102   6e-25   Brassica napus [oilseed rape]
ref|XP_003564009.1|  PREDICTED: uncharacterized protein LOC100821381    102   7e-25   Brachypodium distachyon [annual false brome]
gb|KFK34105.1|  b12d protein                                            102   8e-25   Arabis alpina [alpine rockcress]
ref|XP_008374479.1|  PREDICTED: uncharacterized protein LOC103437758    101   8e-25   Malus domestica [apple tree]
ref|XP_010255359.1|  PREDICTED: uncharacterized protein LOC104596051    101   8e-25   Nelumbo nucifera [Indian lotus]
gb|ACJ84101.1|  unknown                                                 101   9e-25   Medicago truncatula
ref|XP_008239697.1|  PREDICTED: uncharacterized protein LOC103338283    101   1e-24   Prunus mume [ume]
ref|XP_009149843.1|  PREDICTED: uncharacterized protein LOC103873171    101   1e-24   Brassica rapa
ref|XP_002875880.1|  hypothetical protein ARALYDRAFT_485174             101   1e-24   
ref|XP_004502329.1|  PREDICTED: uncharacterized protein LOC101491577    101   1e-24   Cicer arietinum [garbanzo]
ref|XP_010942172.1|  PREDICTED: uncharacterized protein LOC105060...    101   1e-24   Elaeis guineensis
ref|NP_190397.1|  B12D protein                                          101   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHN44408.1|  hypothetical protein glysoja_014449                     101   1e-24   Glycine soja [wild soybean]
ref|XP_010692143.1|  PREDICTED: uncharacterized protein LOC104905334    101   1e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP26755.1|  hypothetical protein JCGZ_17913                         101   2e-24   Jatropha curcas
ref|XP_002515002.1|  conserved hypothetical protein                     100   2e-24   
ref|XP_010515125.1|  PREDICTED: uncharacterized protein LOC104791023    100   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006290288.1|  hypothetical protein CARUB_v10018322mg             100   2e-24   Capsella rubella
ref|XP_006655963.1|  PREDICTED: uncharacterized protein LOC102707968    100   2e-24   Oryza brachyantha
ref|XP_010550670.1|  PREDICTED: uncharacterized protein LOC104821467    100   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_002311729.1|  hypothetical protein POPTR_0008s17950g             100   2e-24   Populus trichocarpa [western balsam poplar]
gb|AFK33307.1|  unknown                                                 100   3e-24   Medicago truncatula
ref|XP_011029641.1|  PREDICTED: uncharacterized protein LOC105129336    100   3e-24   Populus euphratica
gb|KHG12689.1|  Uncharacterized protein F383_19724                      100   3e-24   Gossypium arboreum [tree cotton]
ref|XP_007036078.1|  B12D protein                                       100   3e-24   Theobroma cacao [chocolate]
ref|XP_002314553.2|  hypothetical protein POPTR_0010s06550g             102   3e-24   Populus trichocarpa [western balsam poplar]
gb|AFK42697.1|  unknown                                                 100   4e-24   Lotus japonicus
gb|ACU16637.1|  unknown                                               99.8    4e-24   Glycine max [soybeans]
ref|XP_009150210.1|  PREDICTED: uncharacterized protein LOC103873555  99.8    5e-24   Brassica rapa
gb|KJB30971.1|  hypothetical protein B456_005G172200                  99.4    7e-24   Gossypium raimondii
ref|XP_010907762.1|  PREDICTED: uncharacterized protein LOC105034337  99.0    1e-23   Elaeis guineensis
ref|XP_008351806.1|  PREDICTED: uncharacterized protein LOC103415246  99.0    1e-23   
ref|XP_004310038.1|  PREDICTED: uncharacterized protein LOC101295883  98.6    1e-23   Fragaria vesca subsp. vesca
ref|XP_006391239.1|  hypothetical protein EUTSA_v10019446mg           98.6    2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_004142944.1|  PREDICTED: uncharacterized protein LOC101222643  98.2    2e-23   Cucumis sativus [cucumbers]
gb|AFK36649.1|  unknown                                               97.4    4e-23   Lotus japonicus
gb|ACG48656.1|  B12D protein                                          97.4    5e-23   Zea mays [maize]
gb|KCW61991.1|  hypothetical protein EUGRSUZ_H04674                   98.6    5e-23   Eucalyptus grandis [rose gum]
ref|XP_006376832.1|  hypothetical protein POPTR_0012s07660g           96.7    7e-23   
ref|XP_008651557.1|  PREDICTED: B12D protein isoform X1               97.1    8e-23   Zea mays [maize]
emb|CAA54065.1|  HvB12D                                               95.5    2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09386.1|  hypothetical protein F775_07588                       95.1    3e-22   
ref|XP_002459694.1|  hypothetical protein SORBIDRAFT_02g008930        95.5    3e-22   Sorghum bicolor [broomcorn]
gb|AFW76868.1|  hypothetical protein ZEAMMB73_758599                  96.3    4e-22   
gb|ABK24106.1|  unknown                                               94.7    5e-22   Picea sitchensis
ref|XP_003601829.1|  B12D protein                                     93.6    1e-21   Medicago truncatula
ref|XP_004504481.1|  PREDICTED: uncharacterized protein LOC101503540  93.2    2e-21   Cicer arietinum [garbanzo]
ref|XP_004299593.1|  PREDICTED: uncharacterized protein LOC101301782  92.4    3e-21   Fragaria vesca subsp. vesca
gb|EMT27875.1|  hypothetical protein F775_28789                       92.4    4e-21   
gb|EMS61978.1|  hypothetical protein TRIUR3_19930                     92.4    4e-21   Triticum urartu
ref|XP_007044988.1|  B12D protein                                     92.0    4e-21   Theobroma cacao [chocolate]
ref|XP_004955942.1|  PREDICTED: uncharacterized protein LOC101785845  91.3    1e-20   Setaria italica
ref|XP_011086732.1|  PREDICTED: uncharacterized protein LOC105168371  91.3    1e-20   Sesamum indicum [beniseed]
ref|XP_003557311.1|  PREDICTED: uncharacterized protein LOC100833199  90.9    1e-20   
gb|KEH20547.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      90.1    3e-20   Medicago truncatula
gb|EPS70497.1|  hypothetical protein M569_04271                       89.0    5e-20   Genlisea aurea
dbj|BAK01669.1|  predicted protein                                    89.4    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45331.1|  hypothetical protein TRIUR3_29962                     89.4    7e-20   Triticum urartu
dbj|BAC84633.1|  putative B12D protein                                89.0    9e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13299.1|  unnamed protein product                              87.8    2e-19   Coffea canephora [robusta coffee]
ref|XP_006658464.1|  PREDICTED: uncharacterized protein LOC102702396  87.8    2e-19   Oryza brachyantha
ref|NP_001151846.1|  B12D protein                                     86.7    4e-19   Zea mays [maize]
ref|XP_001779363.1|  predicted protein                                87.0    4e-19   
dbj|BAK01100.1|  predicted protein                                    86.7    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006438116.1|  hypothetical protein CICLE_v10033501mg           85.1    2e-18   Citrus clementina [clementine]
ref|XP_006338343.1|  PREDICTED: uncharacterized protein LOC102603988  85.1    2e-18   Solanum tuberosum [potatoes]
ref|XP_010249439.1|  PREDICTED: uncharacterized protein LOC104591985  85.1    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009596991.1|  PREDICTED: uncharacterized protein LOC104092997  84.7    3e-18   Nicotiana tomentosiformis
ref|XP_006484337.1|  PREDICTED: uncharacterized protein LOC102622685  84.7    3e-18   
ref|XP_001776158.1|  predicted protein                                84.0    6e-18   
gb|EYU29787.1|  hypothetical protein MIMGU_mgv1a021169mg              83.6    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_004232140.1|  PREDICTED: uncharacterized protein LOC101252543  82.8    1e-17   Solanum lycopersicum
ref|XP_009792586.1|  PREDICTED: uncharacterized protein LOC104239607  82.8    2e-17   Nicotiana sylvestris
gb|EYU20492.1|  hypothetical protein MIMGU_mgv1a026736mg              82.0    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_008464582.1|  PREDICTED: uncharacterized protein LOC103502424  80.9    7e-17   Cucumis melo [Oriental melon]
ref|XP_010694063.1|  PREDICTED: uncharacterized protein LOC104906928  80.9    7e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004137261.1|  PREDICTED: uncharacterized protein LOC101217963  80.1    1e-16   Cucumis sativus [cucumbers]
gb|EYU25265.1|  hypothetical protein MIMGU_mgv1a024239mg              79.7    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_011099034.1|  PREDICTED: uncharacterized protein LOC105177540  79.7    2e-16   Sesamum indicum [beniseed]
emb|CDP19974.1|  unnamed protein product                              79.7    2e-16   Coffea canephora [robusta coffee]
ref|XP_006856407.1|  hypothetical protein AMTR_s00047p00213990        79.3    4e-16   Amborella trichopoda
ref|XP_008664404.1|  PREDICTED: uncharacterized protein LOC100383000  79.0    4e-16   Zea mays [maize]
gb|AAL17696.1|  B12D-like protein                                     80.1    4e-16   Castanea sativa
ref|NP_001059360.2|  Os07g0274700                                     80.1    4e-16   
ref|XP_007215204.1|  hypothetical protein PRUPE_ppa014104mg           78.6    6e-16   Prunus persica
dbj|BAJ88884.1|  predicted protein                                    80.1    7e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008230281.1|  PREDICTED: uncharacterized protein LOC103329570  78.6    7e-16   Prunus mume [ume]
ref|XP_010029400.1|  PREDICTED: uncharacterized protein LOC104419...  77.4    1e-15   Eucalyptus grandis [rose gum]
dbj|BAK03592.1|  predicted protein                                    77.8    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002531002.1|  conserved hypothetical protein                   77.4    2e-15   Ricinus communis
ref|NP_001059359.1|  Os07g0274400                                     77.4    2e-15   
ref|XP_004304209.1|  PREDICTED: uncharacterized protein LOC101313329  77.4    2e-15   Fragaria vesca subsp. vesca
dbj|BAG94722.1|  unnamed protein product                              77.4    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099316.1|  hypothetical protein L484_018178                 77.0    3e-15   Morus notabilis
ref|XP_008362218.1|  PREDICTED: uncharacterized protein LOC103425898  76.6    3e-15   
ref|XP_009151762.1|  PREDICTED: uncharacterized protein LOC103875065  76.6    3e-15   Brassica rapa
ref|XP_002281305.1|  PREDICTED: uncharacterized protein LOC100258293  76.6    3e-15   Vitis vinifera
ref|XP_006373388.1|  germination family protein                       76.6    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006340507.1|  PREDICTED: uncharacterized protein LOC102592850  77.4    4e-15   Solanum tuberosum [potatoes]
ref|XP_011021065.1|  PREDICTED: uncharacterized protein LOC105123251  76.3    4e-15   Populus euphratica
ref|XP_004955938.1|  PREDICTED: uncharacterized protein LOC101784102  76.3    4e-15   Setaria italica
gb|AFK43764.1|  unknown                                               76.3    4e-15   Medicago truncatula
ref|XP_004491894.1|  PREDICTED: uncharacterized protein LOC101510215  76.3    5e-15   Cicer arietinum [garbanzo]
ref|XP_003531875.1|  PREDICTED: uncharacterized protein LOC100527287  75.9    6e-15   Glycine max [soybeans]
ref|XP_008379445.1|  PREDICTED: uncharacterized protein LOC103442440  75.9    6e-15   
ref|XP_010514670.1|  PREDICTED: uncharacterized protein LOC104790592  75.5    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010257978.1|  PREDICTED: uncharacterized protein LOC104597899  75.5    8e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010260574.1|  PREDICTED: uncharacterized protein LOC104599651  75.5    1e-14   Nelumbo nucifera [Indian lotus]
gb|KCW56312.1|  hypothetical protein EUGRSUZ_I02053                   77.8    1e-14   Eucalyptus grandis [rose gum]
ref|NP_189632.1|  B12D protein                                        75.1    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459693.1|  hypothetical protein SORBIDRAFT_02g008920        75.1    1e-14   Sorghum bicolor [broomcorn]
ref|XP_006658463.1|  PREDICTED: uncharacterized protein LOC102702117  74.7    2e-14   Oryza brachyantha
ref|XP_002875526.1|  hypothetical protein ARALYDRAFT_323026           74.7    2e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_010260461.1|  PREDICTED: uncharacterized protein LOC104599559  74.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008651396.1|  PREDICTED: B12D protein isoform X1               74.3    3e-14   
ref|XP_002305391.1|  germination family protein                       73.6    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_003561264.1|  PREDICTED: uncharacterized protein LOC100824762  73.6    4e-14   Brachypodium distachyon [annual false brome]
dbj|BAC83875.1|  unknown protein                                      73.9    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010502994.1|  PREDICTED: uncharacterized protein LOC104780196  73.6    4e-14   Camelina sativa [gold-of-pleasure]
gb|AFK44347.1|  unknown                                               73.6    4e-14   Lotus japonicus
ref|XP_006395262.1|  hypothetical protein EUTSA_v10005671mg           73.6    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_011008605.1|  PREDICTED: uncharacterized protein LOC105113935  73.2    6e-14   Populus euphratica
ref|XP_003562728.1|  PREDICTED: uncharacterized protein LOC100837236  73.2    6e-14   Brachypodium distachyon [annual false brome]
ref|XP_009419068.1|  PREDICTED: uncharacterized protein LOC103999135  73.2    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139429.1|  hypothetical protein PHAVU_008G028700g           73.9    6e-14   Phaseolus vulgaris [French bean]
ref|XP_004958246.1|  PREDICTED: uncharacterized protein LOC101775472  73.2    8e-14   Setaria italica
ref|NP_001060222.2|  Os07g0604600                                     73.9    8e-14   
ref|XP_006482419.1|  PREDICTED: uncharacterized protein LOC102612079  72.8    1e-13   Citrus sinensis [apfelsine]
gb|KDP24288.1|  hypothetical protein JCGZ_25584                       72.4    1e-13   Jatropha curcas
ref|XP_010034410.1|  PREDICTED: uncharacterized protein LOC104423644  72.4    2e-13   
ref|XP_010034411.1|  PREDICTED: uncharacterized protein LOC104423646  71.6    2e-13   
ref|XP_006657932.1|  PREDICTED: uncharacterized protein LOC102705450  72.0    2e-13   Oryza brachyantha
ref|XP_003552604.1|  PREDICTED: uncharacterized protein LOC100785946  71.6    2e-13   Glycine max [soybeans]
ref|XP_010553961.1|  PREDICTED: uncharacterized protein LOC104823885  71.6    3e-13   Tarenaya hassleriana [spider flower]
gb|KJB22813.1|  hypothetical protein B456_004G066900                  71.2    4e-13   Gossypium raimondii
ref|XP_007032847.1|  B12D protein                                     70.9    4e-13   
ref|XP_009406306.1|  PREDICTED: uncharacterized protein LOC103989230  70.5    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010029399.1|  PREDICTED: uncharacterized protein LOC104419...  69.7    1e-12   Eucalyptus grandis [rose gum]
ref|XP_008810952.1|  PREDICTED: uncharacterized protein LOC103722254  68.6    4e-12   
ref|XP_006430939.1|  hypothetical protein CICLE_v10013823mg           68.6    4e-12   Citrus clementina [clementine]
ref|NP_001060223.1|  Os07g0604700                                     68.6    4e-12   
ref|NP_001147337.1|  B12D protein                                     67.8    7e-12   
ref|XP_001757013.1|  predicted protein                                67.4    1e-11   
ref|XP_009351238.1|  PREDICTED: uncharacterized protein LOC103942755  66.6    1e-11   Pyrus x bretschneideri [bai li]
tpg|DAA63528.1|  TPA: b12D protein                                    67.8    1e-11   
gb|EPS63516.1|  hypothetical protein M569_11268                       67.0    1e-11   Genlisea aurea
ref|NP_001050622.2|  Os03g0601500                                     66.2    3e-11   
ref|XP_010937886.1|  PREDICTED: uncharacterized protein LOC105057112  65.5    5e-11   Elaeis guineensis
ref|XP_006658786.1|  PREDICTED: uncharacterized protein LOC102700818  64.7    1e-10   Oryza brachyantha
ref|XP_002978639.1|  hypothetical protein SELMODRAFT_152721           63.9    2e-10   Selaginella moellendorffii
gb|KEH35272.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      63.5    2e-10   Medicago truncatula
gb|AAR13310.1|  B12D-like protein                                     64.3    2e-10   Phaseolus vulgaris [French bean]
gb|KGN53786.1|  hypothetical protein Csa_4G129030                     62.0    7e-10   Cucumis sativus [cucumbers]
gb|EMS56733.1|  Microspherule protein 1                               66.6    8e-10   Triticum urartu
gb|EEC81850.1|  hypothetical protein OsI_25618                        62.0    3e-09   Oryza sativa Indica Group [Indian rice]
emb|CDX85280.1|  BnaC07g25910D                                        58.2    1e-08   
ref|XP_001772578.1|  predicted protein                                57.4    3e-08   
ref|XP_002460987.1|  hypothetical protein SORBIDRAFT_02g038760        56.6    6e-08   
ref|XP_002961492.1|  hypothetical protein SELMODRAFT_76981            56.6    8e-08   
gb|EMS53792.1|  hypothetical protein TRIUR3_24112                     57.0    1e-07   Triticum urartu
gb|EYU29509.1|  hypothetical protein MIMGU_mgv1a024878mg              56.2    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_001416807.1|  predicted protein                                54.7    5e-07   Ostreococcus lucimarinus CCE9901
ref|XP_005648934.1|  hypothetical protein COCSUDRAFT_52948            53.9    7e-07   Coccomyxa subellipsoidea C-169
ref|XP_007511902.1|  predicted protein                                53.1    1e-06   Bathycoccus prasinos
ref|XP_002975136.1|  hypothetical protein SELMODRAFT_102690           50.8    8e-06   
ref|XP_008346823.1|  PREDICTED: putative cyclin-B3-1                  50.8    1e-05   
ref|XP_009394678.1|  PREDICTED: uncharacterized protein LOC103980120  49.7    1e-05   
ref|XP_002507620.1|  predicted protein                                49.7    2e-05   Micromonas commoda
ref|NP_001168199.1|  uncharacterized protein LOC100381955             50.4    2e-05   
gb|AAP12919.2|  expressed protein                                     49.3    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003601294.1|  B12D-like protein                                48.5    5e-05   
gb|ACU13634.1|  unknown                                               48.5    6e-05   Glycine max [soybeans]
ref|XP_002887135.1|  hypothetical protein ARALYDRAFT_894514           48.1    8e-05   
emb|CEF97372.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit     47.8    9e-05   Ostreococcus tauri
gb|ABF97493.1|  expressed protein                                     46.2    3e-04   Oryza sativa Japonica Group [Japonica rice]



>gb|AAD22104.1| B12D protein [Ipomoea batatas]
Length=90

 Score =   124 bits (312),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAAM VAVGICGFQLIRN+  NPEVRV KEGRAAGVLENYEEGKKY E S
Sbjct  5    RWIRPEVYPLFAAMSVAVGICGFQLIRNLTTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPSLNR FSDPQRN
Sbjct  65   LRKFVRNKSPEIMPSLNRFFSDPQRN  90



>ref|XP_002283743.1| PREDICTED: uncharacterized protein LOC100263922 [Vitis vinifera]
Length=93

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL+RNI  NP+VRV KE RAAGVLEN+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHF  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  FSDP++N
Sbjct  68   LRKYVRNKSPEIMPSINSFFSDPEKN  93



>emb|CBI15096.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL+RNI  NP+VRV KE RAAGVLEN+ EG+KY E  
Sbjct  3    RWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHF  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  FSDP++N
Sbjct  63   LRKYVRNKSPEIMPSINSFFSDPEKN  88



>ref|XP_011087179.1| PREDICTED: uncharacterized protein LOC105168733 [Sesamum indicum]
Length=89

 Score =   112 bits (281),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAAMGVAVGICGFQL+RNI  NPEVRV KEGRAAGVLEN+ EG+KY E +
Sbjct  5    RWIRPEVYPLFAAMGVAVGICGFQLVRNICINPEVRVNKEGRAAGVLENFAEGQKYSEHA  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR + PEIMPS+N  F+DPQ
Sbjct  65   LKKFVRNRRPEIMPSINSFFTDPQ  88



>ref|XP_004152455.1| PREDICTED: uncharacterized protein LOC101218501 [Cucumis sativus]
 ref|XP_004157801.1| PREDICTED: uncharacterized LOC101218501 [Cucumis sativus]
 gb|KGN64280.1| hypothetical protein Csa_1G045780 [Cucumis sativus]
Length=94

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQLIRNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHF  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  F+DP RN
Sbjct  69   LRKFVRNKSPEIMPSINNFFTDPNRN  94



>ref|XP_008437938.1| PREDICTED: uncharacterized protein LOC103483212 [Cucumis melo]
Length=94

 Score =   112 bits (280),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQLIRNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVSKENRAAGVLDNFAEGEKYSEHF  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  F+DP RN
Sbjct  69   LRKFVRNKSPEIMPSINNFFTDPSRN  94



>ref|XP_010929102.1| PREDICTED: uncharacterized protein LOC105050689 [Elaeis guineensis]
Length=91

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLENY EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEIMPS+NR F+DP+
Sbjct  68   LRKFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008806317.1| PREDICTED: uncharacterized protein LOC103719037 [Phoenix dactylifera]
Length=91

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLEN+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENHAEGEKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L + VR K+PEIMPS+NR F+DP+
Sbjct  68   LRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008798028.1| PREDICTED: uncharacterized protein LOC103713044 [Phoenix dactylifera]
Length=92

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLENY EG+ Y E  
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGETYAEHG  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R ++PEIMPS+NR F+DP+
Sbjct  69   LRKFLRTRTPEIMPSINRFFADPK  92



>ref|XP_010942173.1| PREDICTED: uncharacterized protein LOC105060250 isoform X2 [Elaeis 
guineensis]
Length=91

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLENY EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGQKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L + VR K+PEIMPS+NR F+DP+
Sbjct  68   LRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008779549.1| PREDICTED: uncharacterized protein LOC103699287 [Phoenix dactylifera]
Length=91

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLEN+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENFAEGQKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEI+PS+NR F+DP+
Sbjct  68   LRKFVRNKAPEILPSINRFFADPK  91



>ref|XP_007138129.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
 gb|ESW10123.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
Length=89

 Score =   110 bits (274),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGICGFQL+RNI  NPEVRV KEGR AGVLEN+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFSEGEKYTEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR +SPEIMPSLN  F+DP RN
Sbjct  64   LRKYVRNRSPEIMPSLNSFFADPSRN  89



>gb|AGC24177.1| unknown [Rehmannia glutinosa]
Length=93

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QLIRNI  NPEVRV KE RAAGVL+++ EG+KY E +
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLIRNITINPEVRVTKENRAAGVLDDFAEGEKYAEHA  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR +SPEIMPSLN  F+DP+
Sbjct  69   LRKYVRNRSPEIMPSLNSFFTDPK  92



>ref|XP_010100274.1| hypothetical protein L484_027580 [Morus notabilis]
 gb|EXB82408.1| hypothetical protein L484_027580 [Morus notabilis]
Length=92

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QLIRNI  NPEVRV KE RAAG+L+N+EEG++Y + S
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLIRNITTNPEVRVTKENRAAGILDNFEEGERYSQHS  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSP+IMP+LN  FSDP 
Sbjct  69   LRKFVRNKSPQIMPNLNNFFSDPN  92



>ref|XP_010556171.1| PREDICTED: uncharacterized protein LOC104825524 [Tarenaya hassleriana]
Length=88

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FA++GVAVGICG QL+RNI  NPEVRV KE RAAG+LEN+EEG+KY E  
Sbjct  5    RWIRPEVYPLFASVGVAVGICGMQLVRNICSNPEVRVTKENRAAGILENFEEGEKYKEHR  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N  FSDPQ
Sbjct  65   LRKFVRSKSPEIMPSINSFFSDPQ  88



>ref|XP_010027794.1| PREDICTED: uncharacterized protein LOC104418219 [Eucalyptus grandis]
 gb|KCW83389.1| hypothetical protein EUGRSUZ_B00324 [Eucalyptus grandis]
Length=90

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KY E S
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYTEHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR +SPEIMPSLN  F+ P RN
Sbjct  65   LRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_006357136.1| PREDICTED: uncharacterized protein LOC102583994 [Solanum tuberosum]
Length=91

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RN+  NPEVRV KE RAAGVLEN+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVTKENRAAGVLENFSEGEKYAEHT  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR +SPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNRSPEIMPSINGFFSDPK  91



>ref|XP_010913425.1| PREDICTED: uncharacterized protein LOC105039118 [Elaeis guineensis]
Length=92

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KEGRAAGVLENY EG+KY E  
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHG  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R ++PEIMPS+NR F++P+
Sbjct  69   LRKFLRTRAPEIMPSINRFFANPK  92



>ref|XP_010027818.1| PREDICTED: uncharacterized protein LOC104418237 [Eucalyptus grandis]
 gb|KCW83385.1| hypothetical protein EUGRSUZ_B00320 [Eucalyptus grandis]
Length=90

 Score =   108 bits (269),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+GVAVGICGF L+R+I  NPEVRV KE RAAGVL+N++EG+KY E S
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYAEHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR +SPEIMPSLN  F+ P RN
Sbjct  65   LRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_006856912.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
 gb|ERN18379.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
Length=91

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE RAAG+LEN+ EG++Y E S
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEARAAGILENFTEGERYAEHS  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR +SPEIMPS+N  F+DP+
Sbjct  68   LRKFVRNRSPEIMPSINGYFTDPK  91



>ref|XP_010678668.1| PREDICTED: uncharacterized protein LOC104894188 [Beta vulgaris 
subsp. vulgaris]
Length=91

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVLEN+ EG+KY E  
Sbjct  6    RWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHF  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K+PEIMPS+N  F+DP RN
Sbjct  66   LRKYVRNKTPEIMPSINSFFADPTRN  91



>gb|KHG26447.1| Uncharacterized protein F383_04740 [Gossypium arboreum]
 gb|KJB07848.1| hypothetical protein B456_001G047700 [Gossypium raimondii]
Length=87

 Score =   107 bits (268),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEIMPS+N  F+DP+
Sbjct  64   LRKYVRNKTPEIMPSINSFFTDPK  87



>ref|XP_009760043.1| PREDICTED: uncharacterized protein LOC104212451 [Nicotiana sylvestris]
Length=92

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHA  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  FSDP+
Sbjct  69   LRKFVRNRAPEIMPSINGFFSDPK  92



>ref|XP_006338509.1| PREDICTED: uncharacterized protein LOC102603775 [Solanum tuberosum]
Length=91

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N  FSDP 
Sbjct  68   LRKFVRNKSPEIMPSINGFFSDPN  91



>ref|XP_004233340.1| PREDICTED: uncharacterized protein LOC101261386 [Solanum lycopersicum]
Length=91

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQLIRN+  NPEVRV KE RAAGVLEN+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLIRNVCINPEVRVNKENRAAGVLENFSEGEKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR +SPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNRSPEIMPSINGFFSDPK  91



>gb|EPS70000.1| hypothetical protein M569_04763, partial [Genlisea aurea]
Length=86

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAAMG+AVGICGFQLIRNI  NPEVRV K  R+AGVLEN+EEG KY E S
Sbjct  4    RWIRPEVYPLFAAMGIAVGICGFQLIRNITGNPEVRVNKRDRSAGVLENFEEGHKYKEHS  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR + PEIMP+LN  FSDP
Sbjct  64   LRKFVRNRKPEIMPALNSFFSDP  86



>ref|XP_009615457.1| PREDICTED: uncharacterized protein LOC104108174 [Nicotiana tomentosiformis]
Length=91

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNKSPEIMPSINGFFSDPK  91



>ref|XP_003527039.1| PREDICTED: uncharacterized protein LOC100499787 [Glycine max]
 gb|KHN19346.1| hypothetical protein glysoja_012266 [Glycine soja]
Length=89

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
             W+R EVYP FAA+G AVGICGFQL+RNI  NPEVRV KEGR AGVLEN+ EG+KY E  
Sbjct  4    HWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR ++PEIMPS+N  F+DP RN
Sbjct  64   LRKYVRNRTPEIMPSINSFFADPSRN  89



>ref|XP_004501964.1| PREDICTED: uncharacterized protein LOC101508877 [Cicer arietinum]
Length=89

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV K+ RAAGVLEN+ EG+KY E  
Sbjct  4    RWVRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKQTRAAGVLENFSEGEKYTEHL  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K  R +SPEIMP++N  F+DP RN
Sbjct  64   LRKFSRNRSPEIMPTINSFFTDPSRN  89



>ref|XP_011042649.1| PREDICTED: uncharacterized protein LOC105138299 [Populus euphratica]
Length=90

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVLEN+ EG+KY E  
Sbjct  5    RWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLENFSEGEKYSEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR +SPEIMPS+N  F+DP+ N
Sbjct  65   LRKLVRNRSPEIMPSINNFFTDPKLN  90



>ref|NP_001148351.1| LOC100281961 [Zea mays]
 gb|ACG30961.1| B12D protein [Zea mays]
 gb|AFW85170.1| b12D protein [Zea mays]
Length=87

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V  K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTDPK  87



>ref|XP_002438146.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
 gb|EER89513.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
Length=87

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V  K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHEKTPEIMPAINKFFTDPK  87



>ref|XP_010111964.1| hypothetical protein L484_004741 [Morus notabilis]
 gb|EXC32238.1| hypothetical protein L484_004741 [Morus notabilis]
Length=93

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP FAA+GVA+GICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  8    KWLRPEVYPLFAAVGVAIGICGFQLVRNICINPEVRVSKETRAAGVLDNFAEGEKYSEHF  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR ++PEIMPS+N  F+DP R+
Sbjct  68   LRKYVRNRAPEIMPSINSFFTDPNRS  93



>ref|XP_002511469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52071.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAAMGVAVGIC FQL+RNI  NPEVRV K+ RAAGVLEN++EG+KY E  
Sbjct  5    RWIRPEVYPLFAAMGVAVGICSFQLVRNICINPEVRVNKQNRAAGVLENFKEGEKYSENF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEIMPS+NR F++P 
Sbjct  65   LRKFVRNKTPEIMPSINRFFTEPN  88



>ref|XP_010272106.1| PREDICTED: uncharacterized protein LOC104607987 [Nelumbo nucifera]
Length=90

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE RAAGVLEN+ EG+KY E +
Sbjct  7    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRAAGVLENFSEGEKYAEHT  66

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  F++P+
Sbjct  67   LRKFVRNRTPEIMPSINNFFTNPK  90



>ref|XP_009771458.1| PREDICTED: uncharacterized protein LOC104221988 [Nicotiana sylvestris]
Length=91

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMP++N  FSDP+
Sbjct  68   LRKFVRNKSPEIMPNINGFFSDPK  91



>ref|XP_006404294.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
 gb|ESQ45747.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
Length=88

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGICGF LIRNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICGFSLIRNITGNPEVRVTKENRAAGVLDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_009785405.1| PREDICTED: uncharacterized protein LOC104233674 [Nicotiana sylvestris]
Length=90

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVA+GICG QL+RN+  NPEVRV KE RAAGVL+N+EEG+KY E +
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLDNFEEGQKYAEHA  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            + K  R + PEI PSLNR FSDPQ+N
Sbjct  65   VRKFARSRPPEIFPSLNRFFSDPQKN  90



>ref|XP_004232259.1| PREDICTED: uncharacterized protein LOC101265497 [Solanum lycopersicum]
Length=91

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N  FS+P 
Sbjct  68   LRKFVRNKSPEIMPSINGFFSNPN  91



>ref|NP_001057280.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|AAB65433.1| HvB12D homolog [Oryza sativa]
 gb|AAL76334.1| putative G-box binding protein [Oryza sativa]
 dbj|BAD45657.1| G-box binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF19194.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|ABR25364.1| senescence associated protein [Oryza sativa Indica Group]
 gb|ACJ54927.1| G-box binding protein [Oryza sativa Japonica Group]
 dbj|BAG94133.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99740.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00561.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80316.1| hypothetical protein OsI_22358 [Oryza sativa Indica Group]
 gb|EEE65438.1| hypothetical protein OsJ_20800 [Oryza sativa Japonica Group]
Length=89

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y E  
Sbjct  5    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            L   VR K+PEIMP++N+ F++P +
Sbjct  65   LRNYVRDKTPEIMPAINKFFTEPTK  89



>ref|XP_003523058.1| PREDICTED: uncharacterized protein LOC100500534 [Glycine max]
Length=89

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGICGFQL+RNI  NPEVRV KEGR AGVLEN+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR ++PEIMPS+N  F+D  RN
Sbjct  64   LRKYVRNRTPEIMPSINSFFADTSRN  89



>ref|XP_008340166.1| PREDICTED: uncharacterized protein LOC103403120 [Malus domestica]
 ref|XP_008361836.1| PREDICTED: uncharacterized protein LOC103425520 [Malus domestica]
Length=92

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FAA+GVAVGICG QL+RNI  NPEVRV K+ R AGVLEN+EEG++Y E  
Sbjct  6    RWIRPEVFPLFAAVGVAVGICGMQLVRNITSNPEVRVTKQNRTAGVLENHEEGERYAEHG  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++P+IMPS+N+ FSDPQ
Sbjct  66   LRKYVRTRAPQIMPSINKYFSDPQ  89



>emb|CAK22419.1| B12D-like protein [Beta vulgaris]
Length=91

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVLEN+ EG+KY E  
Sbjct  6    RWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHF  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K+PEIMPS+N  F+D  RN
Sbjct  66   LRKYVRNKTPEIMPSINSFFADSTRN  91



>ref|XP_011098540.1| PREDICTED: uncharacterized protein LOC105177185 [Sesamum indicum]
Length=93

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYAEHA  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  F+DP+
Sbjct  69   LRKFVRNRAPEIMPSINSFFTDPK  92



>ref|XP_011085792.1| PREDICTED: uncharacterized protein LOC105167687 [Sesamum indicum]
Length=93

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE RAAGVLEN+ EG+KY E +
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLENFAEGEKYAEHA  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  F+DP+
Sbjct  69   LRKFVRNRAPEIMPSINSFFTDPK  92



>ref|XP_006845122.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
 gb|ERN06797.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
Length=91

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FA +G AVGICG QL+RNI  NP+VRV KE R+AGVLEN+ EG++Y + S
Sbjct  8    RWLRPEVYPIFAVVGTAVGICGLQLVRNIRTNPDVRVTKEKRSAGVLENFAEGERYAQHS  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N+ F+DP+
Sbjct  68   LRKFVRNKSPEIMPSINKFFTDPK  91



>ref|XP_009403647.1| PREDICTED: uncharacterized protein LOC103987158 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EV+P FAA+G AVGICG QLIRNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  5    RWVRPEVFPLFAAVGTAVGICGMQLIRNICINPEVRVTKENRAAGVLDNFQEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR KSP+IMPSLN  FSDP
Sbjct  65   LRKFVRNKSPQIMPSLNNYFSDP  87



>ref|XP_008222037.1| PREDICTED: uncharacterized protein LOC103321965 [Prunus mume]
Length=91

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP F A+GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG++Y E  
Sbjct  5    RWLKPEVYPLFVAVGVAVGICGMQLVRNIYTNPEVRVNKEKRAAGVLDNHAEGERYAEHR  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMP++N+ FSDPQ
Sbjct  65   LRKYVRNKTPQIMPTINKFFSDPQ  88



>ref|XP_002318014.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK94203.1| unknown [Populus trichocarpa]
 gb|EEE96234.1| senescence-associated family protein [Populus trichocarpa]
Length=90

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY E  
Sbjct  5    RWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR +SP+IMPS+N  F+DP+ N
Sbjct  65   LRKLVRNRSPQIMPSINNFFTDPKLN  90



>ref|XP_007226455.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
 gb|EMJ27654.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
Length=91

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+G AVGICG QL+RNI  NP+VRV KE RAAGVL+N+ EG++Y E  
Sbjct  5    RWLKPEVYPLFAAVGAAVGICGMQLVRNIYTNPDVRVNKENRAAGVLDNHAEGERYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMP++N+ FSDPQ
Sbjct  65   LRKYVRNKTPQIMPTINKFFSDPQ  88



>gb|ADB08699.1| B12D-like protein [Wolffia arrhiza]
 gb|AEI83500.1| B12D [Wolffia arrhiza]
 gb|AEQ39050.1| putative B12D-like protein [Wolffia arrhiza]
Length=91

 Score =   104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RN+  NPEVRV KEGRA+GVLEN+ EG++Y E S
Sbjct  8    RWVRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVSKEGRASGVLENFAEGERYAEHS  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R K PEIMPS+N  F++P+
Sbjct  68   LRKFLRNKRPEIMPSINGFFANPK  91



>ref|XP_003551877.1| PREDICTED: uncharacterized protein LOC100500344 [Glycine max]
 gb|KHN24095.1| hypothetical protein glysoja_025268 [Glycine soja]
Length=89

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAG+LEN+ EG+KY + S
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_008792162.1| PREDICTED: uncharacterized protein LOC103708847 [Phoenix dactylifera]
Length=91

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGIC  QLIRNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGTAVGICCMQLIRNITTNPEVRVTKENRAAGVLDNFSEGEKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R K+PEIMPSLN+ FSDP 
Sbjct  68   LRKFLRNKNPEIMPSLNKFFSDPN  91



>ref|XP_010511712.1| PREDICTED: uncharacterized protein LOC104787778 [Camelina sativa]
Length=89

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE R AG+L+N+ EG++Y E  
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILDNHAEGERYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_009627555.1| PREDICTED: uncharacterized protein LOC104118078 [Nicotiana tomentosiformis]
Length=149

 Score =   106 bits (264),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVA+GICG QL+RN+  NPEVRV KE RAAGVLEN+EEG+KY E +
Sbjct  64   RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLENFEEGEKYAEHA  123

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            + K  R + PEI PSLNR FSDPQ+N
Sbjct  124  VRKFARSRPPEIFPSLNRFFSDPQKN  149



>ref|XP_009385140.1| PREDICTED: uncharacterized protein LOC103972508 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R +VYP FAA+GVAVGICG QL+RNI  NP+VRV K+ RAAGVLEN+ EG+KY E S
Sbjct  8    RWLRPDVYPLFAAVGVAVGICGVQLVRNISTNPQVRVNKQNRAAGVLENFGEGEKYAEHS  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEIMP++N+ FSDP+
Sbjct  68   LRKFVRNKAPEIMPAVNKFFSDPK  91



>emb|CDP14927.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVA+GICGF L+RNI  NPEVRV K+ RAAGVLEN+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAIGICGFSLVRNICINPEVRVAKQDRAAGVLENFAEGEKYAEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR + PEIMPS+N  F++P++N
Sbjct  68   LRKYVRNRKPEIMPSINSFFTEPEKN  93



>gb|ACU15396.1| unknown [Glycine max]
Length=89

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAG+LEN+ EG+KY + S
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K P++MPS+N  FSDP
Sbjct  65   LRKYVRGKQPQVMPSVNNFFSDP  87



>gb|AFO59572.1| B12D like protein [Saccharum hybrid cultivar GT28]
 gb|AHB79077.1| B12D-like protein [Saccharum hybrid cultivar]
Length=87

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V  K+PEIMP++N+ F++P+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTEPK  87



>ref|XP_009588369.1| PREDICTED: uncharacterized protein LOC104085953 [Nicotiana tomentosiformis]
Length=92

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP F A+GVA GICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E +
Sbjct  9    RWLRPEVYPLFVAVGVAFGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHA  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  FSDP+
Sbjct  69   LRKFVRNRAPEIMPSINGFFSDPK  92



>ref|XP_010470676.1| PREDICTED: uncharacterized protein LOC104750563 [Camelina sativa]
Length=134

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+GVAVGICG QL+RNI  NPEVRV KE R AG+LEN+ EG++Y E  
Sbjct  50   RWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHG  109

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP+
Sbjct  110  LRKFVRNKAPQIMPSINGFFSDPK  133



>ref|XP_010930055.1| PREDICTED: uncharacterized protein LOC105051361 [Elaeis guineensis]
Length=91

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGIC  QL+RNI  NPEVRV KE RAAGVLEN+ EG++Y E  
Sbjct  8    RWLRPEVYPLFAAVGTAVGICCMQLVRNITTNPEVRVTKENRAAGVLENFSEGERYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R K+PEIMPSLN+ FSDP 
Sbjct  68   LRKFLRSKNPEIMPSLNKFFSDPN  91



>ref|XP_004236155.1| PREDICTED: uncharacterized protein LOC101260417 [Solanum lycopersicum]
Length=90

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVA+GICG QL+RN+  NPEVRV KE RAAG+LEN+EEG+KY E +
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHA  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            + K  R + PEI P+LNR FSDPQ+N
Sbjct  65   IRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|NP_001152717.1| LOC100286358 [Zea mays]
 gb|ACG30827.1| B12D protein [Zea mays]
 gb|ACG49122.1| B12D protein [Zea mays]
 gb|AFW76867.1| b12D protein [Zea mays]
Length=87

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    
Sbjct  4    RWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V  K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHDKTPEIMPAVNKFFTDPK  87



>emb|CDP02170.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   103 bits (257),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QLIRNI  NPEVRV KE RAAGVLEN+ EG+KY E +
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGAQLIRNICINPEVRVTKENRAAGVLENHAEGEKYAEHA  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++P+IMPS+N  FS PQ
Sbjct  68   LRKFVRNRAPQIMPSVNNFFSKPQ  91



>ref|XP_006344997.1| PREDICTED: uncharacterized protein LOC102605944 [Solanum tuberosum]
Length=90

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVA+GICG QL+RN+  NPEVRV KE RAAG+LEN+EEG+KY E +
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHA  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            + K  R + PEI P+LNR FSDPQ+N
Sbjct  65   VRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|XP_010546014.1| PREDICTED: uncharacterized protein LOC104818223 [Tarenaya hassleriana]
Length=88

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGICGFQL+RNI  NPEVRV KE RAAGVLEN+ EG++Y E  
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVSKENRAAGVLENFAEGERYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + + VR K PEIMPS+N+ F+DP+
Sbjct  64   VRRFVRNKDPEIMPSINKFFTDPK  87



>gb|AEC10990.1| b12d-like protein [Camellia sinensis]
Length=91

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE  AAGVL+N+ EG+KY E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEKGAAGVLDNHAEGEKYAEHF  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K VR KSPEIMP++N+ F+DP+
Sbjct  68   VRKFVRNKSPEIMPAVNKFFTDPK  91



>gb|ACU15648.1| unknown [Glycine max]
Length=89

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGICGFQL+R+I  NPEVRV KEGR AGVLEN+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRSICINPEVRVNKEGRKAGVLENFAEGEKYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR ++PEIMPS+N  F+D  RN
Sbjct  64   LRKYVRNRTPEIMPSINSFFADTSRN  89



>ref|XP_006439727.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 ref|XP_006476687.1| PREDICTED: uncharacterized protein LOC102617192 [Citrus sinensis]
 gb|ESR52967.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 gb|KDO69809.1| hypothetical protein CISIN_1g034649mg [Citrus sinensis]
Length=88

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAGVLENY EG+KY E  
Sbjct  5    RWIRPEVFPLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLENYAEGEKYSEHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+PEIMP +N  F+DPQ
Sbjct  65   LRKYVRNKTPEIMPKINSFFTDPQ  88



>ref|XP_010415343.1| PREDICTED: uncharacterized protein LOC104701372 [Camelina sativa]
Length=89

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FA +GVAVGICG QL+RNI  NPEVRV KE R AG+LEN+ EG++Y E  
Sbjct  5    RWIRPEVYPLFATVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_007209803.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
 gb|EMJ11002.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
Length=90

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGICG  L R+I  NPEVRV KE RAAG+LEN++EG+KY E  
Sbjct  5    RWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  F+DP RN
Sbjct  65   LRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_008800943.1| PREDICTED: uncharacterized protein LOC103715180 [Phoenix dactylifera]
Length=121

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAGVL+N+ EG+KY E  
Sbjct  38   RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHG  97

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R KSPEIMPS+N+ FS+P 
Sbjct  98   LRKFIRNKSPEIMPSVNKFFSNPN  121



>ref|XP_007163724.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
 gb|ESW35718.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
Length=89

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAG+LEN+EEG+KY E S
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFEEGEKYSEHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K+P+IMPS+N  FS+P
Sbjct  65   LRKYVRGKNPQIMPSVNNFFSEP  87



>ref|XP_002270661.1| PREDICTED: uncharacterized protein LOC100259604 [Vitis vinifera]
 emb|CBI27548.3| unnamed protein product [Vitis vinifera]
Length=93

 Score =   102 bits (255),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ R AGVLEN+EEG++Y E  
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKQNRTAGVLENFEEGERYAEHR  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K P+IMPS+N+ FSDP 
Sbjct  68   LRKFVRNKEPQIMPSINKFFSDPN  91



>ref|XP_003538567.1| PREDICTED: uncharacterized protein LOC100527541 [Glycine max]
Length=89

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA++GVAVGICG QL+RNI  NPEVRV K+ R AG+LEN+ EG+KY + S
Sbjct  5    RWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_004965125.1| PREDICTED: uncharacterized protein LOC101762161 [Setaria italica]
Length=87

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    
Sbjct  4    RWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V  K+PEIMP++N+ F++P+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTEPK  87



>ref|XP_011042304.1| PREDICTED: uncharacterized protein LOC105138023 [Populus euphratica]
Length=92

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++P+IMPS+N  FSDP 
Sbjct  65   LRKYVRKRTPQIMPSINGFFSDPD  88



>emb|CDY44977.1| BnaCnng12070D [Brassica napus]
Length=88

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGVLDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_003564009.1| PREDICTED: uncharacterized protein LOC100821381 [Brachypodium 
distachyon]
Length=88

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP FAA GVAVGIC FQL+RNI  NPEVRV K GRAAGVL+N+EEG++Y E  
Sbjct  5    KWVRPEVYPLFAATGVAVGICAFQLLRNITGNPEVRVSKVGRAAGVLDNHEEGRRYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   VR K+PEIMP +N+ F+DP+
Sbjct  65   LRSFVRDKTPEIMPGINKFFTDPK  88



>gb|KFK34105.1| b12d protein [Arabis alpina]
Length=90

 Score =   102 bits (253),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVRV KE RAAG+L+N+ EG+KY E  
Sbjct  6    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRVSKENRAAGILDNHAEGEKYKENF  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP 
Sbjct  66   LRKFVRNKHPEIMPGINKFFTDPT  89



>ref|XP_008374479.1| PREDICTED: uncharacterized protein LOC103437758 [Malus domestica]
Length=90

 Score =   101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGICG  L R+I  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  5    RWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVTKENRAAGVLDNHAEGEKYKEHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K+PEIMP +N  F+DP +N
Sbjct  65   LRKFVRNKAPEIMPGINAFFTDPSKN  90



>ref|XP_010255359.1| PREDICTED: uncharacterized protein LOC104596051 [Nelumbo nucifera]
Length=90

 Score =   101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEVRV KE R AGVLEN+ EG+KY E +
Sbjct  7    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRTAGVLENFAEGEKYAEHT  66

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++PEIMPS+N  F++ +
Sbjct  67   LRKFVRNRTPEIMPSINNFFTNQK  90



>gb|ACJ84101.1| unknown [Medicago truncatula]
 gb|AFK34497.1| unknown [Medicago truncatula]
 gb|KEH35090.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=90

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+G AVGIC F L+RNI  NPEVRV K+ RAAGVLEN+ EG+KY E  
Sbjct  5    RWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHL  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K  R +SPEIMP LN  F+DP RN
Sbjct  65   LRKFSRNRSPEIMPGLNSFFTDPSRN  90



>ref|XP_008239697.1| PREDICTED: uncharacterized protein LOC103338283 [Prunus mume]
Length=90

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAV ICG  L R+I  NPEVRV KE RAAG+LEN++EG+KY E  
Sbjct  5    RWLRPEVYPLFAATGVAVAICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR KSPEIMPS+N  F+DP RN
Sbjct  65   LRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_009149843.1| PREDICTED: uncharacterized protein LOC103873171 [Brassica rapa]
 emb|CDY36902.1| BnaA06g16870D [Brassica napus]
Length=88

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_002875880.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52139.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP LN+ F+DP 
Sbjct  64   LRKFVRNKKPEIMPGLNKFFTDPT  87



>ref|XP_004502329.1| PREDICTED: uncharacterized protein LOC101491577 [Cicer arietinum]
Length=88

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGICG QL+RNI  NP+VRV K+ RAAGVL+N+ EG+KY + +
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLVRNITGNPDVRVTKQNRAAGVLDNFSEGEKYSQHT  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KS +IMPS+N  FSDP+
Sbjct  65   LRKFVRNKSSQIMPSVNNFFSDPK  88



>ref|XP_010942172.1| PREDICTED: uncharacterized protein LOC105060250 isoform X1 [Elaeis 
guineensis]
Length=105

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 14/98 (14%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEV--------------RVXKEGRAAGV  278
            RW+R EVYP FAA+GVAVGICGFQL+RNI  NPEV              RV KEGRAAGV
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRYGDVLFHTYGDFTRVSKEGRAAGV  67

Query  277  LenyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDPQ  164
            LENY EG+KY E  L + VR K+PEIMPS+NR F+DP+
Sbjct  68   LENYAEGQKYAEHGLRRFVRNKAPEIMPSINRFFADPK  105



>ref|NP_190397.1| B12D protein [Arabidopsis thaliana]
 pir||T13003 hypothetical protein T24C20.20 - Arabidopsis thaliana
 emb|CAB51061.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAL91215.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAN65070.1| B12D-like protein [Arabidopsis thaliana]
 dbj|BAH19734.1| AT3G48140 [Arabidopsis thaliana]
 gb|AEE78372.1| B12D protein [Arabidopsis thaliana]
Length=88

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP LN+ F+DP 
Sbjct  64   LRKFVRNKKPEIMPGLNKFFTDPT  87



>gb|KHN44408.1| hypothetical protein glysoja_014449 [Glycine soja]
Length=89

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA++GVAVGICG QL+RNI  NPEVRV K  R AG+LEN+ EG+KY + S
Sbjct  5    RWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKRNRTAGILENFAEGEKYSQHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_010692143.1| PREDICTED: uncharacterized protein LOC104905334 [Beta vulgaris 
subsp. vulgaris]
Length=89

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP F A+G AVGICGFQL+RNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  6    RWVRPEVYPLFVAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNHKEGEKYAEHF  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K  R +S EIMP LN+ FSDPQ
Sbjct  66   IRKFSRTQSAEIMPGLNKFFSDPQ  89



>gb|KDP26755.1| hypothetical protein JCGZ_17913 [Jatropha curcas]
Length=93

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FAA+GVAVGICG QL+RNI  NP+VRV KE RAAGVL+N+ EG+KY E  
Sbjct  5    RWIRPEVFPLFAAVGVAVGICGMQLVRNICINPDVRVTKEKRAAGVLDNFAEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K P+IMPS+N  FSDP 
Sbjct  65   LRKFVRKKQPQIMPSINGFFSDPD  88



>ref|XP_002515002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47556.1| conserved hypothetical protein [Ricinus communis]
Length=93

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG++Y E  
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFAEGERYKEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR +SP+IMPSLN  FS+P 
Sbjct  65   LRKFVRNRSPQIMPSLNGFFSEPD  88



>ref|XP_010515125.1| PREDICTED: uncharacterized protein LOC104791023 [Camelina sativa]
 ref|XP_010426282.1| PREDICTED: uncharacterized protein LOC104711289 [Camelina sativa]
Length=88

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP+
Sbjct  64   LRKFVRNKHPEIMPGINKFFTDPK  87



>ref|XP_006290288.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
 gb|EOA23186.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
Length=88

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K PEIMP +N+ F+DP+
Sbjct  64   LRKFVRDKHPEIMPGINKFFTDPK  87



>ref|XP_006655963.1| PREDICTED: uncharacterized protein LOC102707968 [Oryza brachyantha]
Length=88

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAAMGVAV ICG QL RNI  NPEVRV K GRAAGVLEN+EEG++Y E  
Sbjct  5    RWVRPEVYPLFAAMGVAVAICGMQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   VR K+PEIMP++N+ F++P+
Sbjct  65   LRNFVRDKTPEIMPTINKFFTEPK  88



>ref|XP_010550670.1| PREDICTED: uncharacterized protein LOC104821467 [Tarenaya hassleriana]
Length=86

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVGICGFQL+RNI  NPEVRV KE RAAGVL+N+ EG++Y E  
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNFAEGERYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K VR K PEIMPS+N+ F++
Sbjct  64   LRKFVRNKGPEIMPSINKFFTE  85



>ref|XP_002311729.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
 gb|EEE89096.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
Length=92

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  5    RWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP 
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPD  88



>gb|AFK33307.1| unknown [Medicago truncatula]
Length=90

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA+G AVGIC F L+RNI  NPEVRV K+ RAAGVLEN+ EG+KY E  
Sbjct  5    RWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHL  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L +  R +SPEIMP LN  F+DP RN
Sbjct  65   LRRFSRNRSPEIMPGLNSFFTDPSRN  90



>ref|XP_011029641.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
 ref|XP_011029642.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
Length=92

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  5    RWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP 
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPD  88



>gb|KHG12689.1| Uncharacterized protein F383_19724 [Gossypium arboreum]
Length=89

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA++GVAVGIC  QL+RNI  NPEVRV KE RAAGVL N+EEG+KY E  
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLNNFEEGEKYAEHG  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR + P+IMPS+N  FSDP+
Sbjct  66   LRKFVRNRQPQIMPSVNNFFSDPK  89



>ref|XP_007036078.1| B12D protein [Theobroma cacao]
 gb|EOY20579.1| B12D protein [Theobroma cacao]
Length=87

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+ VAVGICG QL+RNI  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVSVAVGICGLQLVRNICINPEVRVNKENRAAGVLDNFAEGEKYAEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K VR ++PEIMPS+N  F+DP+
Sbjct  64   VRKYVRNRAPEIMPSINSFFTDPK  87



>ref|XP_002314553.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
 gb|EEF00724.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
Length=163

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA++GVAVGICG QL+RNI  NPEVRV KE RAAGVL+N++EG+KY E  
Sbjct  76   RWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  135

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR ++P+IMPS+N  FSDP 
Sbjct  136  LRKYVRKRTPQIMPSINGFFSDPD  159



>gb|AFK42697.1| unknown [Lotus japonicus]
Length=89

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG QL+RNI  NPEVRV K+ RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVNKQNRAAGVLDNFSEGEKYTEHF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            + K  R  S EIMPS+N  F+DP RN
Sbjct  64   IRKFARTSSREIMPSINSFFADPSRN  89



>gb|ACU16637.1| unknown [Glycine max]
Length=89

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  A++GVAVGICG QL+RNI  NPEVRV K+ R AG+LEN+ EG+KY + S
Sbjct  5    RWLKPEVYPLIASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHS  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_009150210.1| PREDICTED: uncharacterized protein LOC103873555 [Brassica rapa]
 emb|CDY21808.1| BnaA06g20770D [Brassica napus]
Length=88

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA G AVGIC F LIRNI  NPEVR  KE RAAG+L+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFAATGAAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR K PEIMP LN+ F+DP
Sbjct  64   LRKYVRDKRPEIMPGLNKFFTDP  86



>gb|KJB30971.1| hypothetical protein B456_005G172200 [Gossypium raimondii]
Length=89

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA++GVAVGIC  QL+RNI  NP+VRV KE RAAGVL N+EEG+KY E  
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPDVRVTKENRAAGVLNNFEEGEKYAEHG  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR + P+IMPS+N  FSDP+
Sbjct  66   LRKFVRNRQPQIMPSVNNFFSDPK  89



>ref|XP_010907762.1| PREDICTED: uncharacterized protein LOC105034337 [Elaeis guineensis]
Length=91

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AA+GVAVG+CG QL+RNI  NPEVRV K+ RAAGVL+N+ EG+KY E  
Sbjct  8    RWLKPEVYPLLAAVGVAVGMCGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHG  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R K+PEIMPS+N+ FS P 
Sbjct  68   LRKFLRNKAPEIMPSVNKFFSSPN  91



>ref|XP_008351806.1| PREDICTED: uncharacterized protein LOC103415246 [Malus domestica]
Length=90

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVA+GICG  L R+I  NPEVRV KE RAAGVL+N+ EG+KY E  
Sbjct  5    RWLRPEVYPLFAATGVAIGICGLSLFRHITINPEVRVNKENRAAGVLDNHAEGEKYKENF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR ++PEIMP++N  F+DP+ N
Sbjct  65   LRKFVRNRAPEIMPAINGFFTDPKNN  90



>ref|XP_004310038.1| PREDICTED: uncharacterized protein LOC101295883 [Fragaria vesca 
subsp. vesca]
Length=87

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FAA GVAVGIC  QL+RNI  NPEVRV KE RAAG+L+N+EEG+KY E +
Sbjct  4    RWIRPEVYPLFAATGVAVGICAMQLVRNITGNPEVRVTKENRAAGILDNFEEGEKYRENA  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + + VR K P+IMPS+N  FS+P 
Sbjct  64   VRRFVRNKKPQIMPSINNFFSEPN  87



>ref|XP_006391239.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
 gb|ESQ28525.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
Length=89

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FA++GVAVGIC  QL+RNI  NPEVRV K+ R AGVL+N+ EG+KY E  
Sbjct  5    RWIRPEVYPLFASVGVAVGICVMQLVRNISTNPEVRVTKQNRIAGVLDNFAEGEKYAEHG  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR K+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPK  88



>ref|XP_004142944.1| PREDICTED: uncharacterized protein LOC101222643 [Cucumis sativus]
 ref|XP_004159555.1| PREDICTED: uncharacterized protein LOC101224466 [Cucumis sativus]
 gb|KGN62359.1| hypothetical protein Csa_2G350420 [Cucumis sativus]
Length=89

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA++GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N+EEG+KY E  
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVIKERRAAGVLDNFEEGEKYAEHG  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + P+IMPS+N+ FSDP 
Sbjct  66   LRKFLRTRPPQIMPSINKFFSDPN  89



>gb|AFK36649.1| unknown [Lotus japonicus]
Length=88

 Score = 97.4 bits (241),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FA +G+AVGICG QL+RNI  NPEVRV K+ RAAG+L+N+EEG+KY +  
Sbjct  5    RWIRPEVFPLFATVGIAVGICGMQLVRNISTNPEVRVTKQNRAAGILDNFEEGEKYSQHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K VR K  +IMPS+N+ FSDP 
Sbjct  65   VRKFVRGKDTQIMPSINKFFSDPN  88



>gb|ACG48656.1| B12D protein [Zea mays]
Length=98

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F  M VA+GIC +QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    
Sbjct  12   RWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K PEIM S+N  F+DP ++
Sbjct  72   LRKFVRGKKPEIMASINSFFADPXKD  97



>gb|KCW61991.1| hypothetical protein EUGRSUZ_H04674, partial [Eucalyptus grandis]
Length=135

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EV+P FAA+GVAVGICG QLIRNI  NPEVRV KE RAAGVL+N+ EG+KY +  
Sbjct  52   RWIRPEVFPLFAAVGVAVGICGMQLIRNICTNPEVRVTKEKRAAGVLDNFAEGEKYSQHV  111

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + + VR + P++MPS+N  FSDP+
Sbjct  112  VRRFVRNRPPQVMPSINNFFSDPK  135



>ref|XP_006376832.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
 gb|ERP54629.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
Length=82

 Score = 96.7 bits (239),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            +VYP FAA+GVAVGICGFQL RNI  NPEVRV K+ RAAGVL+N+ EG+KY E  L K V
Sbjct  2    QVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHGLRKLV  61

Query  220  RXKSPEIMPSLNRXFSDPQRN  158
            R +SP+IMPS+N  F+DP+ N
Sbjct  62   RNRSPQIMPSINNFFTDPKLN  82



>ref|XP_008651557.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG31473.1| B12D protein [Zea mays]
 tpg|DAA60235.1| TPA: hypothetical protein ZEAMMB73_939997 [Zea mays]
Length=98

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F  M VA+GIC +QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    
Sbjct  12   RWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K PEIM S+N  F+DP ++
Sbjct  72   LRKFVRGKKPEIMASINSFFADPPKD  97



>emb|CAA54065.1| HvB12D [Hordeum vulgare subsp. vulgare]
 emb|CAA70936.1| B12Dg1 [Hordeum vulgare subsp. vulgare]
Length=87

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP FAA GVA+GIC F L+RNI  NPEVRV K GRAAGVLEN+EEG++Y E  
Sbjct  4    KWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVSKMGRAAGVLENHEEGRRYAEHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V+ K+PEIMP +N+ F+ P+
Sbjct  64   LRAYVQDKTPEIMPGINKFFTSPK  87



>gb|EMT09386.1| hypothetical protein F775_07588 [Aegilops tauschii]
Length=87

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP FAA GVA+GIC F L+RNI  NPEVRV K GRAAGVLEN+EEG++Y E  
Sbjct  4    KWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVNKMGRAAGVLENHEEGRRYAEHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   V+ K+PEIMP +N+ F+ P+
Sbjct  64   LRAYVQDKTPEIMPGINKFFTSPK  87



>ref|XP_002459694.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
 gb|EER96215.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
Length=97

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F  M  A+GIC +QL+RNI  NPEVRV KE RAAGVL+N++EG+KY    
Sbjct  11   RWIRPEVYPLFVPMAAALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGEKYAMHG  70

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K VR K PEIM S+N  F+DP ++
Sbjct  71   LRKFVRGKKPEIMASINSFFADPPKD  96



>gb|AFW76868.1| hypothetical protein ZEAMMB73_758599, partial [Zea mays]
Length=141

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -1

Query  406  RXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXK  227
            R +VYP FAA GVAVGICGFQL RNI  NPEVRV K GRAAGVLEN+EEG++Y    L  
Sbjct  61   RAQVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRS  120

Query  226  XVRXKSPEIMPSLNRXFSDPQ  164
             V  K+PEIMP++N+ F+DP+
Sbjct  121  FVHDKTPEIMPAVNKFFTDPK  141



>gb|ABK24106.1| unknown [Picea sitchensis]
Length=92

 Score = 94.7 bits (234),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP FAA G+AV +C FQL RN+  NPEVR+ KE RAAG+L+N+EEG+KY E  
Sbjct  9    RWLRPEAYPIFAATGIAVTMCCFQLSRNLFTNPEVRLLKENRAAGILDNFEEGEKYAEHK  68

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K VR KSPEIMPS+N+ F++ +
Sbjct  69   LRKYVRNKSPEIMPSINKYFTESK  92



>ref|XP_003601829.1| B12D protein [Medicago truncatula]
 gb|AES72080.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
 gb|AFK33923.1| unknown [Medicago truncatula]
Length=88

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F  +G AVGIC  QL+RNI  NPEVRV K+ RAAG+L+N++EG+KY +  
Sbjct  5    RWIRPEVYPLFVPVGAAVGICVMQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHF  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + + VR KS EIMPSLN  FSDP+
Sbjct  65   IRRFVRGKSTEIMPSLNGFFSDPK  88



>ref|XP_004504481.1| PREDICTED: uncharacterized protein LOC101503540 [Cicer arietinum]
Length=90

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP FAA+G  VGIC  QL+RNI  NPEVRV KE R AGVL+N+ EG+ Y E  
Sbjct  5    RWIKPEVYPLFAAVGAVVGICAMQLVRNISTNPEVRVNKENRLAGVLDNHAEGEAYAEHR  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
              K VR K  ++MPS+N  FSDPQ
Sbjct  65   FRKFVRNKPRQVMPSVNNFFSDPQ  88



>ref|XP_004299593.1| PREDICTED: uncharacterized protein LOC101301782 [Fragaria vesca 
subsp. vesca]
Length=88

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP F A+G AVGICGF ++R++  NPEVRV K  RAAGVL+N+ EG+KY E  
Sbjct  4    RWLRPEVYPLFLAVGAAVGICGFSMVRHMCINPEVRVSKVNRAAGVLDNFAEGEKYQEHM  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            L K VR +SPEIMP +N  F+DP +
Sbjct  64   LRKFVRNRSPEIMPGINSFFADPAK  88



>gb|EMT27875.1| hypothetical protein F775_28789 [Aegilops tauschii]
Length=98

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP FAA GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
              + +  KS EIMP +N  F+DP +N
Sbjct  73   FRRFIDGKSAEIMPGINSFFTDPPKN  98



>gb|EMS61978.1| hypothetical protein TRIUR3_19930 [Triticum urartu]
 gb|EMT04073.1| hypothetical protein F775_11885 [Aegilops tauschii]
Length=97

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA GVAV IC  QLIRNI  NPEVRV KE RAAG+ EN++EGK+Y +  
Sbjct  12   RWLRPEVYPIFAATGVAVSICAMQLIRNITTNPEVRVTKENRAAGIQENFDEGKRYSQHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              K +  + PEIMP++N  FSDP
Sbjct  72   FRKFIDRQRPEIMPAINNFFSDP  94



>ref|XP_007044988.1| B12D protein [Theobroma cacao]
 gb|EOY00820.1| B12D protein [Theobroma cacao]
Length=89

 Score = 92.0 bits (227),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FAA+G AVGIC  QL+RNI  NPEVRV KE R+AG+LEN+EEG++Y E  
Sbjct  6    RWLKPEVYPLFAAVGFAVGICAMQLVRNISTNPEVRVTKENRSAGILENFEEGERYAEHG  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L   VR +  +IMPS+N  FSDP 
Sbjct  66   LRNFVRKRPSQIMPSINNFFSDPN  89



>ref|XP_004955942.1| PREDICTED: uncharacterized protein LOC101785845 [Setaria italica]
Length=95

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F A G AVGIC  QLIRNI  NPEVRV KE RAAGVLEN+EEG++Y +  
Sbjct  11   RWIRPEVYPLFLATGAAVGICAMQLIRNITGNPEVRVLKEKRAAGVLENHEEGRRYSQHG  70

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
              K +  K PEIM SLN   +DP+
Sbjct  71   FRKYIDGKKPEIMQSLNSWMADPK  94



>ref|XP_011086732.1| PREDICTED: uncharacterized protein LOC105168371 [Sesamum indicum]
Length=86

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ E+YP    +G AVGICG QLIRNI  NPEVRV KE RAAGVL+NYEEG+KY + +
Sbjct  3    RWMKPEIYPLLVPVGFAVGICGMQLIRNICTNPEVRVTKENRAAGVLQNYEEGEKYADHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
              K +R + P+IMP +NR FS P+
Sbjct  63   FRKYLRGQHPQIMPGINRYFSKPE  86



>ref|XP_003557311.1| PREDICTED: uncharacterized protein LOC100833199 [Brachypodium 
distachyon]
Length=97

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N+ EG++Y    
Sbjct  12   RWLRPEAYPIFATTGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHAEGERYSRHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              K +  +S EIMP+LN  F+DP
Sbjct  72   FRKFIDGRSREIMPALNSFFTDP  94



>gb|KEH20547.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=91

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +WI+ EVYP FAA+G  VGIC  QL+RNI  NPEVRV K+ R AGVLEN+ EG+ Y E  
Sbjct  5    KWIKPEVYPLFAAVGTVVGICAMQLVRNICTNPEVRVNKQNRIAGVLENHAEGEAYAEHR  64

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K +R K P++MPS+N+ FS+P 
Sbjct  65   VRKFLRNKPPQVMPSVNKFFSEPN  88



>gb|EPS70497.1| hypothetical protein M569_04271, partial [Genlisea aurea]
Length=79

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -1

Query  397  VYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVR  218
            V+P FAA+GVAVG+CG QLIRNI  NPEVRV K  R AGVL+N+EEG+KY + S+ K VR
Sbjct  1    VFPLFAAVGVAVGLCGMQLIRNITINPEVRVNKMNRGAGVLDNFEEGEKYAQHSVRKFVR  60

Query  217  XKSPEIMPSLNRXFSDP  167
             +SPEIMPS+N  FS+P
Sbjct  61   KRSPEIMPSINHFFSEP  77



>dbj|BAK01669.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=98

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP FAA GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
              + +  KS EIMP +N  F+ P +N
Sbjct  73   FRRFIDGKSAEIMPGINNFFTAPPKN  98



>gb|EMS45331.1| hypothetical protein TRIUR3_29962 [Triticum urartu]
Length=98

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP FAA GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
              + +  KS EIMP +N  F+ P +N
Sbjct  73   FRRFIDGKSAEIMPGINSFFTAPPKN  98



>dbj|BAC84633.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31625.1| putative B12D protein [Oryza sativa Japonica Group]
 gb|EAZ03481.1| hypothetical protein OsI_25619 [Oryza sativa Indica Group]
 gb|EAZ39393.1| hypothetical protein OsJ_23824 [Oryza sativa Japonica Group]
 dbj|BAH01595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=98

 Score = 89.0 bits (219),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F A GVAV IC  QL+RNI  NPEVRV KE RAAGVLEN++EGK+Y +  
Sbjct  13   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHG  72

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
              K +  K PEIMP +N  FSDP +
Sbjct  73   FRKFIDGKRPEIMPGINSFFSDPPK  97



>emb|CDP13299.1| unnamed protein product [Coffea canephora]
Length=89

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  A +   VG+C  QL+RNI  NPEVRV KE RAAGVL N+EEG+ Y +  
Sbjct  6    RWIKPEVYPLLAPVAAVVGLCTMQLVRNICTNPEVRVTKENRAAGVLNNFEEGEYYAQHR  65

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L + +R + PE+MPS+N+ FSDP 
Sbjct  66   LRQFLRGRRPEVMPSVNKFFSDPN  89



>ref|XP_006658464.1| PREDICTED: uncharacterized protein LOC102702396 [Oryza brachyantha]
Length=100

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP F A GVAV IC  QL+RNI  NPEVRV KE RAAGVLEN++EG++Y +  
Sbjct  15   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGRRYSQHG  74

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
              K +  + PEIMPS+N  F+DP +
Sbjct  75   FRKFIDGRRPEIMPSINSFFADPPK  99



>ref|NP_001151846.1| B12D protein [Zea mays]
 gb|ACG44577.1| B12D protein [Zea mays]
Length=84

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            +VYP F  M VA+GIC +QL+RNI  NPEVRV KE RAAGVL+N++EG++Y    L K V
Sbjct  3    QVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFV  62

Query  220  RXKSPEIMPSLNRXFSDPQRN  158
            R K PEIM S+N  F+DP ++
Sbjct  63   RGKKPEIMASINSFFADPPKD  83



>ref|XP_001779363.1| predicted protein [Physcomitrella patens]
 gb|EDQ55870.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ E+YP FAA+G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y    
Sbjct  10   RWIKPEIYPLFAAIGAALGICGYSMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHG  69

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K ++ + P+IMP +N  FS
Sbjct  70   LRKYLQQQEPQIMPGINNYFS  90



>dbj|BAK01100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E YP F   GVAV IC  QLIRNI  NPEVRV KE RAAGV EN++EGK+Y +  
Sbjct  12   RWLRPEAYPIFLTTGVAVSICAMQLIRNITTNPEVRVTKENRAAGVQENFDEGKRYSQHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              K +  + P+IMP++N  FSDP
Sbjct  72   FRKFIDRQRPQIMPAINNFFSDP  94



>ref|XP_006438116.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|ESR51356.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|KDO82025.1| hypothetical protein CISIN_1g047755mg [Citrus sinensis]
Length=90

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP F A+G AVGIC  QL+RN   NPEVR+ K  R AGVLEN++EG +Y E +
Sbjct  7    KWVRPEVYPLFGALGAAVGICAMQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENA  66

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L + VR K P+IMPS+N  FS
Sbjct  67   LRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_006338343.1| PREDICTED: uncharacterized protein LOC102603988 [Solanum tuberosum]
Length=88

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+ GVLEN EEG+KY + S
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L   +R + P++MPS+NR FSD   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSDHDNN  88



>ref|XP_010249439.1| PREDICTED: uncharacterized protein LOC104591985 [Nelumbo nucifera]
Length=94

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW R EVYP   A+G  VG+C FQL+RNI  NP+VRV K+ R+ GV +N+EEGK Y E S
Sbjct  7    RWSRPEVYPLMVALGGVVGLCAFQLVRNICSNPDVRVNKQKRSEGVFDNFEEGKNYKEHS  66

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            + K +R + PE+MPS+N+ FS+P+
Sbjct  67   IRKFLRNRPPEVMPSVNKFFSEPK  90



>ref|XP_009596991.1| PREDICTED: uncharacterized protein LOC104092997 [Nicotiana tomentosiformis]
Length=88

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+  VLEN EEG+KY + S
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRISKVHRSMAVLENEEEGEKYAQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K +R + P++MPS+NR FSD  +N
Sbjct  63   LRKFLRTRPPQVMPSINRFFSDHDKN  88



>ref|XP_006484337.1| PREDICTED: uncharacterized protein LOC102622685 [Citrus sinensis]
Length=90

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +W+R EVYP F A+G AVGIC  QL+RN   NPEVR+ K  R AGVLEN++EG +Y E +
Sbjct  7    KWVRPEVYPLFGALGAAVGICAVQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENA  66

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L + VR K P+IMPS+N  FS
Sbjct  67   LRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_001776158.1| predicted protein [Physcomitrella patens]
 gb|EDQ59069.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ E+YP F A+G A+GICG+ + RN+  NP+VR+ KE RAAGVLENY+EG+ Y    
Sbjct  10   RWIKPEIYPLFFAIGAALGICGYAMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHG  69

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L   VR + P+IMP  N  FS
Sbjct  70   LRAYVRQQEPQIMPGFNNYFS  90



>gb|EYU29787.1| hypothetical protein MIMGU_mgv1a021169mg [Erythranthe guttata]
Length=80

 Score = 83.6 bits (205),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 55/87 (63%), Gaps = 13/87 (15%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVX-KEGRAAGVLenyeegkkyxeX  239
            RWIR EVYP FAA G+AVGICGFQL+RNI  NPEVR    EG             KY E 
Sbjct  6    RWIRPEVYPLFAATGLAVGICGFQLVRNICGNPEVRDNFDEGH------------KYKER  53

Query  238  SLXKXVRXKSPEIMPSLNRXFSDPQRN  158
            +L K VR +  EIMPSLN  F+DPQ N
Sbjct  54   ALRKYVRNRKLEIMPSLNSFFTDPQNN  80



>ref|XP_004232140.1| PREDICTED: uncharacterized protein LOC101252543 [Solanum lycopersicum]
Length=88

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+ GVLEN EEG+KY + S
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L   +R + P++MPS+NR FS+   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSNHDNN  88



>ref|XP_009792586.1| PREDICTED: uncharacterized protein LOC104239607 [Nicotiana sylvestris]
Length=87

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+  +LEN EEG+KY + S
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRIKKAHRSMAILENEEEGEKYAQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + P++MPS+NR FSD
Sbjct  63   LRKFLRTRPPQVMPSINRFFSD  84



>gb|EYU20492.1| hypothetical protein MIMGU_mgv1a026736mg [Erythranthe guttata]
Length=86

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R   VLEN EEG  Y E +
Sbjct  3    RWVKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGLTYREHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PE+MPS+NR FSD
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSD  84



>ref|XP_008464582.1| PREDICTED: uncharacterized protein LOC103502424 [Cucumis melo]
Length=86

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAMG    +C FQL RNI  NP+VRV K  R  GVLEN EEG+KY E S
Sbjct  3    RWMKPEVYPLLAAMGFVTSMCVFQLTRNILINPDVRVNKAHRRMGVLENEEEGEKYSEHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L + +R + PEIMP++NR FS  +
Sbjct  63   LRRFLRTRPPEIMPTINRYFSQDK  86



>ref|XP_010694063.1| PREDICTED: uncharacterized protein LOC104906928 [Beta vulgaris 
subsp. vulgaris]
Length=88

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ +VYP  AAM    G+C FQL RN+  NP+VR+ K  RA  VLEN+EEG+KY E  
Sbjct  3    RWIKPDVYPLIAAMSFVTGMCIFQLTRNVLLNPDVRINKAHRATAVLENHEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
              K +R +SPE+MPS+N  FS+ +++
Sbjct  63   FRKYLRTRSPEVMPSINSFFSETKKD  88



>ref|XP_004137261.1| PREDICTED: uncharacterized protein LOC101217963 [Cucumis sativus]
 ref|XP_004154766.1| PREDICTED: uncharacterized LOC101217963 [Cucumis sativus]
Length=87

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAMG    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY E S
Sbjct  3    RWMKPEVYPLLAAMGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            L + +R + PEIMP++N  FS   +
Sbjct  63   LRRFLRTRPPEIMPTINHYFSQDHK  87



>gb|EYU25265.1| hypothetical protein MIMGU_mgv1a024239mg [Erythranthe guttata]
Length=86

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R   VLEN EEG KY E +
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGWKYREHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PE+MPS+NR FS+
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSE  84



>ref|XP_011099034.1| PREDICTED: uncharacterized protein LOC105177540 [Sesamum indicum]
Length=86

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN   NP+VR+ K  R   VLEN EEG+KY E S
Sbjct  3    RWMKPDVYPLVAAMSFVTGMCLFQLTRNALLNPDVRINKAHRRRAVLENQEEGEKYAEHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PE+MPSLNR FSD
Sbjct  63   LRKFLRTRPPEVMPSLNRFFSD  84



>emb|CDP19974.1| unnamed protein product [Coffea canephora]
Length=92

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAM    G+C FQL RN+  NP+VRV K  R   VLEN EEG+KY + S
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCIFQLTRNVLLNPDVRVDKAHRKTAVLENQEEGEKYAQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L + +R + PEIMPS+NR F+
Sbjct  63   LRRFLRTRPPEIMPSINRFFA  83



>ref|XP_006856407.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
 gb|ERN17874.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
Length=87

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAMG    +C FQL RN+  NP+VR+ K  R + VL+N EEG+KY E S
Sbjct  3    RWIKPEVYPLMAAMGFVTSLCIFQLTRNLLLNPDVRINKAHRTSAVLDNEEEGQKYAEHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L   +R + PEIMP++N+ FS+
Sbjct  63   LRNFLRTRPPEIMPAINKIFSE  84



>ref|XP_008664404.1| PREDICTED: uncharacterized protein LOC100383000 [Zea mays]
 gb|ACN31786.1| unknown [Zea mays]
Length=88

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG++Y +  
Sbjct  4    RWVRAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKEKRAAGVLDNHDEGRRYSQHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            + +    K  + M ++++  +DP +
Sbjct  64   VRRFWLSKRRDYMQAMDKVPTDPNK  88



>gb|AAL17696.1| B12D-like protein [Castanea sativa]
Length=134

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAA-GVLenyeegkkyxeX  239
             W+R EVYP FA +GVAVGIC  QL+RNI  NPEVRV KE  +    L N+EEG+KY + 
Sbjct  31   EWLRPEVYPLFATVGVAVGICAMQLVRNICTNPEVRVTKENNSCRKCLHNFEEGEKYSQH  90

Query  238  SLXKXVRXKSPEIMPSLNRXFSDPQ  164
            ++ K V  +SP IMPSL   FS+P+
Sbjct  91   AVRKFVLNRSPHIMPSLKSFFSEPK  115



>ref|NP_001059360.2| Os07g0274700 [Oryza sativa Japonica Group]
 dbj|BAF21274.2| Os07g0274700, partial [Oryza sativa Japonica Group]
Length=130

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            EVYP F A GVAV IC  QL+RNI  NPEVRV KE RAAGVLEN++EGK+Y +    K +
Sbjct  50   EVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHGFRKFI  109

Query  220  RXKSPEIMPSLNRXFSDPQR  161
              K PEIMP +N  FSDP +
Sbjct  110  DGKRPEIMPGINSFFSDPPK  129



>ref|XP_007215204.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
 gb|EMJ16403.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
Length=86

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM     +C FQL RN+  NP+VR+ K  R  GVLEN EEG+KY E  
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKAKRGMGVLENKEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PEIMP++N+ FS  +
Sbjct  63   LRKFLRTRPPEIMPTINQFFSQDE  86



>dbj|BAJ88884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            + YP FAA GVAVGIC  QL+RNI  NPEVRV KE RAAGVL+N++EG++Y      + +
Sbjct  70   QAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFI  129

Query  220  RXKSPEIMPSLNRXFSDPQRN  158
              KS EIMP +N  F+ P +N
Sbjct  130  DGKSAEIMPGINNFFTAPPKN  150



>ref|XP_008230281.1| PREDICTED: uncharacterized protein LOC103329570 [Prunus mume]
Length=86

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R  GVLEN EEG+KY E  
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKARRGMGVLENKEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PEIMP++NR FS  +
Sbjct  63   LRKFLRTRPPEIMPTINRFFSQDE  86



>ref|XP_010029400.1| PREDICTED: uncharacterized protein LOC104419438 isoform X2 [Eucalyptus 
grandis]
Length=86

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R  GVL+N EEG+KY +  
Sbjct  3    RWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPAINHFFSE  84



>dbj|BAK03592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=89

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVLEN++EGK+Y +  
Sbjct  4    RWIRPEVYPLFATTGVAVGICVMQLVRNIMTNPEVRVTKENRAAGVLENHDEGKRYSQHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            + +    K  + M +L+   +DP
Sbjct  64   VRRFWLSKRRDYMQALDNVPTDP  86



>ref|XP_002531002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31390.1| conserved hypothetical protein [Ricinus communis]
Length=86

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAM     +C FQL RN+  NP+VR+ K  R   VLEN  EG++Y E  
Sbjct  3    RWIKPEVYPLMAAMTFVTSLCAFQLTRNMFLNPDVRINKAHRRTAVLENEVEGEQYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMPS+N  FS+
Sbjct  63   LRKFLRTRPPEIMPSINHFFSE  84



>ref|NP_001059359.1| Os07g0274400 [Oryza sativa Japonica Group]
 dbj|BAC84630.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31622.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAF21273.1| Os07g0274400 [Oryza sativa Japonica Group]
 gb|EAZ39392.1| hypothetical protein OsJ_23823 [Oryza sativa Japonica Group]
Length=89

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RWIR EVYP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVL
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVL  50



>ref|XP_004304209.1| PREDICTED: uncharacterized protein LOC101313329 [Fragaria vesca 
subsp. vesca]
Length=89

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP  AAM     +C FQL RN+  NP+VRV K  R   VL+N EEG++Y E  
Sbjct  3    RWIRPEVYPLMAAMTFVTSLCVFQLTRNVILNPDVRVNKAHRRMAVLDNEEEGERYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K +R + PE+MP++N  FS  Q +
Sbjct  63   LRKYLRTRRPEVMPTINHFFSHSQED  88



>dbj|BAG94722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=90

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RWIR EVYP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVL
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVL  50



>ref|XP_010099316.1| hypothetical protein L484_018178 [Morus notabilis]
 gb|EXB77662.1| hypothetical protein L484_018178 [Morus notabilis]
Length=87

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAM     +C FQL RN+  NP+VR+ K  R+ GVLEN EEG+KY E  
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNMFLNPDVRINKAHRSMGVLENKEEGEKYAEHC  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            L K +R + PE+MPS+N  FS   +
Sbjct  63   LRKFLRTRPPEVMPSVNHFFSSQDK  87



>ref|XP_008362218.1| PREDICTED: uncharacterized protein LOC103425898 [Malus domestica]
 ref|XP_009373788.1| PREDICTED: uncharacterized protein LOC103962745 [Pyrus x bretschneideri]
Length=86

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM     +C FQL RN+  NPEVR+ K  R   VLEN EEG+KY E  
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS 
Sbjct  63   LRKFLRTRPPEIMPTINHFFSQ  84



>ref|XP_009151762.1| PREDICTED: uncharacterized protein LOC103875065 [Brassica rapa]
 emb|CDX86357.1| BnaA06g30740D [Brassica napus]
Length=87

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP   AMG    +  FQL RN   NP+ R+ KE R  G+LEN +EG+KY + +
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + P++MPSLNR FS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>ref|XP_002281305.1| PREDICTED: uncharacterized protein LOC100258293 [Vitis vinifera]
Length=89

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+  EVYP   AM +  G+  F L R++  NP+VR+ KEGR   VL+N +EG++Y E  
Sbjct  3    RWVIPEVYPLLGAMAIVGGMVVFSLGRHVTMNPDVRISKEGRKQAVLDNADEGERYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L K +R ++PEI P LNR FSDP+++
Sbjct  63   LRKFLRTRTPEIFPKLNRFFSDPEKS  88



>ref|XP_006373388.1| germination family protein [Populus trichocarpa]
 gb|ERP51185.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VRV K  R  GVLEN EEG++Y E  
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRVNKANRGMGVLENKEEGERYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PEIMP++N  FS+ +
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSEDK  86



>ref|XP_006340507.1| PREDICTED: uncharacterized protein LOC102592850 [Solanum tuberosum]
Length=125

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 10/83 (12%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+GVAVGICG Q +             E RAAGVL+N+ EG+KY E +
Sbjct  52   RWLRPEVYPLFAAVGVAVGICGMQYMHQ----------PENRAAGVLDNFSEGEKYAEHA  101

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L K VR KSPEIMPS+N  FSDP
Sbjct  102  LRKFVRNKSPEIMPSINGFFSDP  124



>ref|XP_011021065.1| PREDICTED: uncharacterized protein LOC105123251 [Populus euphratica]
Length=86

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R  GVLEN EEG+KY E  
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRINKANRGMGVLENKEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSE  84



>ref|XP_004955938.1| PREDICTED: uncharacterized protein LOC101784102 [Setaria italica]
Length=91

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP FA  GVAVGIC  QL+RNI  NPEVRV K+ RAAGVL+N++EG++Y +  
Sbjct  4    RWLKAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLDNHDEGRRYSQHG  63

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            + +    K  + M ++++  +DP
Sbjct  64   VRRFWLSKRRDYMQAMDKVPTDP  86



>gb|AFK43764.1| unknown [Medicago truncatula]
 gb|KEH21758.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=86

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K GR  GV +N EEG+KY +  
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLQNPDVRISKNGRTKGVFDNKEEGEKYAKHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L   +R + PE+MP++N  FS+
Sbjct  63   LRNFLRTRPPEVMPTINHFFSE  84



>ref|XP_004491894.1| PREDICTED: uncharacterized protein LOC101510215 [Cicer arietinum]
Length=86

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RNI  NP+VR+ K  R  GV +N EEG+KY E  
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCIFQLTRNILGNPDVRISKSRRTKGVFDNKEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PEIMPS+N  FS+ +
Sbjct  63   LRKFLRTRPPEIMPSINHFFSEDK  86



>ref|XP_003531875.1| PREDICTED: uncharacterized protein LOC100527287 [Glycine max]
 gb|ACU16358.1| unknown [Glycine max]
 gb|KHN30319.1| hypothetical protein glysoja_037830 [Glycine soja]
Length=86

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+  VLEN EEG+KY E  
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNVLGNPDVRINKTRRSMAVLENREEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>ref|XP_008379445.1| PREDICTED: uncharacterized protein LOC103442440 [Malus domestica]
 ref|XP_008348095.1| PREDICTED: uncharacterized protein LOC103411226 [Malus domestica]
Length=86

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM     +C FQL RN+  NPEVR+ K  R   VLEN EEG+KY E  
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP+ N  FS 
Sbjct  63   LRKFLRTRPPEIMPTXNHFFSQ  84



>ref|XP_010514670.1| PREDICTED: uncharacterized protein LOC104790592 [Camelina sativa]
Length=87

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP   AMG    +  FQL RN   NP+ R+ K  R  G+LEN +EG+KY + +
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEDEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + P++MPSLNR FSD
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSD  84



>ref|XP_010257978.1| PREDICTED: uncharacterized protein LOC104597899 [Nelumbo nucifera]
Length=87

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWI+ EVYP  AAM     +C FQL RN   NP+VRV K+ R   VLENYEEG+KY E  
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNAFLNPDVRVNKDHRKTAVLENYEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K +R + PEIMP++N  FS
Sbjct  63   LRKFLRTRPPEIMPTINHFFS  83



>ref|XP_010260574.1| PREDICTED: uncharacterized protein LOC104599651 [Nelumbo nucifera]
Length=88

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VRV KE R   VLEN EEG+KY E  
Sbjct  3    RWVKPEVYPLMAAMTFVASMCVFQLTRNVFMNPDVRVNKEHRQKAVLENAEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K +R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPAINSFFS  83



>gb|KCW56312.1| hypothetical protein EUGRSUZ_I02053 [Eucalyptus grandis]
Length=234

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R  GVL+N EEG+KY +  
Sbjct  151  RWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHG  210

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS+
Sbjct  211  LRKFLRTRPPEIMPAINHFFSE  232



>ref|NP_189632.1| B12D protein [Arabidopsis thaliana]
 dbj|BAB02998.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77618.1| B12D protein [Arabidopsis thaliana]
Length=87

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP   AMG    +  FQL RN   NP+ R+ KE R  G+LEN +EG+KY + +
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNAFLNPDCRINKEHRKMGILENKDEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
              K +R + P++MPSLNR FS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_002459693.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
 gb|EER96214.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
Length=96

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RW+R EVYP FA  GVAVGIC  QL+RNI  NPEVRV KE RAAGVL
Sbjct  5    RWVRPEVYPLFATTGVAVGICVMQLVRNITGNPEVRVTKENRAAGVL  51



>ref|XP_006658463.1| PREDICTED: uncharacterized protein LOC102702117 [Oryza brachyantha]
Length=86

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RWIR EVYP F   GVAVGIC  QL+RNI  NPEVRV KE RAAGVL
Sbjct  4    RWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKEKRAAGVL  50



>ref|XP_002875526.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51785.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP   AMG    +  FQL RN   NP+ R+ KE R  G+LEN +EG+KY + +
Sbjct  3    RWVRPEVYPLLGAMGFVTTMVVFQLTRNALLNPDCRINKEHRKMGILENEDEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
              K +R + P++MPSLNR FS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_010260461.1| PREDICTED: uncharacterized protein LOC104599559 [Nelumbo nucifera]
Length=89

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -1

Query  412  WIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSL  233
            WI+ +VYP  AAM     +C FQL RN+  NP+VR+ K+ R   VLEN EEG+KY E  L
Sbjct  6    WIKPDVYPLVAAMTFVTSMCVFQLTRNVFLNPDVRINKDRRKMAVLENQEEGEKYAEHGL  65

Query  232  XKXVRXKSPEIMPSLNRXFSDPQ  164
             K +R + PEIMP++N  FS P+
Sbjct  66   RKFLRTRPPEIMPTINHFFSKPE  88



>ref|XP_008651396.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG30695.1| B12D protein [Zea mays]
 tpg|DAA63527.1| TPA: b12D protein [Zea mays]
Length=94

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VL+N  EG++Y + +
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN*LPG  146
              + +  + PE+ P+LN  FSD   N  P 
Sbjct  63   FRRFLATQRPEVFPALNSFFSDSNNNNTPA  92



>ref|XP_002305391.1| germination family protein [Populus trichocarpa]
 gb|EEE85902.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R+ GVL N EEG++Y E  
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L + +R + PEIMP++N  F++
Sbjct  63   LRRFLRTRPPEIMPTINHFFTE  84



>ref|XP_003561264.1| PREDICTED: uncharacterized protein LOC100824762 [Brachypodium 
distachyon]
Length=87

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RWIR EVYP F   GVAVGIC  QL+RNI  NPEVRV K+ RAAGVL
Sbjct  4    RWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKQNRAAGVL  50



>dbj|BAC83875.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88459.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82410.1| hypothetical protein OsI_26790 [Oryza sativa Indica Group]
 gb|EEE67550.1| hypothetical protein OsJ_25042 [Oryza sativa Japonica Group]
Length=95

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VLEN EEG+KY + +
Sbjct  3    RWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              + +  + PE+ P+LNR F+ P
Sbjct  63   FRRFLATQRPEVFPALNRFFAGP  85



>ref|XP_010502994.1| PREDICTED: uncharacterized protein LOC104780196 [Camelina sativa]
Length=87

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP   AMG    +  FQL RN   NP+ R+ K  R  G+LEN EEG+KY + +
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEEEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + P++MPSLNR FS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>gb|AFK44347.1| unknown [Lotus japonicus]
Length=87

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeeg-kkyxeX  239
            RW++ EVYP  AAM    G+C FQL RN+  NP+VR+ K  R+ GVL + +E  ++Y E 
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNLLGNPDVRISKARRSMGVLFDNKEEGERYAEH  62

Query  238  SLXKXVRXKSPEIMPSLNRXFSD  170
             L K +R + PEIMP++N  FS+
Sbjct  63   GLRKFLRTRQPEIMPTINHFFSE  85



>ref|XP_006395262.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
 gb|ESQ32548.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
Length=87

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R E+YP   AMG    +  FQL RN   NP+ R+ K  R  G+LEN +EG+KY + +
Sbjct  3    RWVRPEMYPLLGAMGFVTSMVVFQLTRNALLNPDCRINKANRKMGILENEDEGEKYAQHN  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + P++MPSLNR FS   
Sbjct  63   LRKYLRTRQPQVMPSLNRFFSHDH  86



>ref|XP_011008605.1| PREDICTED: uncharacterized protein LOC105113935 [Populus euphratica]
 ref|XP_011014073.1| PREDICTED: uncharacterized protein LOC105117942 [Populus euphratica]
Length=86

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R+ GVL N EEG++Y +  
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYADHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L + +R + PEIMP++N  F++
Sbjct  63   LRRFLRTRPPEIMPAINHFFTE  84



>ref|XP_003562728.1| PREDICTED: uncharacterized protein LOC100837236 [Brachypodium 
distachyon]
Length=88

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP   AM +  G+C FQL+RN+  NP+VR+ K  R + VLEN EEG+KY + +
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCAFQLVRNVLLNPDVRISKSNRQSAVLENAEEGEKYSQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
              + V    PE+ P++NR FS+
Sbjct  63   FRRFVSAHRPEVFPAINRFFSE  84



>ref|XP_009419068.1| PREDICTED: uncharacterized protein LOC103999135 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EV+P  AAM     +C FQL RN+  NP+VR+ K  R   VLEN EEG+KY + S
Sbjct  3    RWVRPEVFPLMAAMTFVTSMCVFQLTRNMLMNPDVRINKTNRTTAVLENAEEGEKYSQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L + +  + PE+ P+LNR FS
Sbjct  63   LRRFLSHRPPEVFPALNRFFS  83



>ref|XP_007139429.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
 gb|ESW11423.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
Length=115

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VRV K  R+  VL+N EEG+KY E  
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVRVNKTRRSMAVLDNREEGEKYAEHG  91

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PEIMP++N  FS  +
Sbjct  92   LRKFLRTRPPEIMPTINHFFSQDK  115



>ref|XP_004958246.1| PREDICTED: uncharacterized protein LOC101775472 [Setaria italica]
Length=91

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VL+N +EG++Y + +
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLTRNVFMNPDVRVSKASRQSAVLDNADEGQRYSQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
              + +  + PE+ P+LNR FS+
Sbjct  63   FRRFLATQRPEVFPALNRFFSE  84



>ref|NP_001060222.2| Os07g0604600 [Oryza sativa Japonica Group]
 dbj|BAF22136.2| Os07g0604600, partial [Oryza sativa Japonica Group]
Length=127

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VLEN EEG+KY + +
Sbjct  35   RWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHA  94

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              + +  + PE+ P+LNR F+ P
Sbjct  95   FRRFLATQRPEVFPALNRFFAGP  117



>ref|XP_006482419.1| PREDICTED: uncharacterized protein LOC102612079 [Citrus sinensis]
 gb|KDO72280.1| hypothetical protein CISIN_1g048115mg [Citrus sinensis]
Length=94

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM     +C FQL RN+  NP+VR+ K  R+ GVLEN EEG+KY E  
Sbjct  3    RWMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L + +R + P++MP++NR F+
Sbjct  63   LRRFLRTRPPQVMPAINRFFT  83



>gb|KDP24288.1| hypothetical protein JCGZ_25584 [Jatropha curcas]
Length=86

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R   VLEN +EG+KY E  
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNVFLNPDVRINKAHRRMAVLENEDEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQ  164
            L K +R + PE+MP++N  FS  +
Sbjct  63   LRKFLRTRPPEVMPAINHFFSQDE  86



>ref|XP_010034410.1| PREDICTED: uncharacterized protein LOC104423644 [Eucalyptus grandis]
 gb|KCW51947.1| hypothetical protein EUGRSUZ_J01394 [Eucalyptus grandis]
Length=88

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM     +C FQL RN+  NP+VR+ K  R   VL+N EEG+KY E  
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNVLLNPDVRINKAHRGMAVLDNAEEGRKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K +R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>ref|XP_010034411.1| PREDICTED: uncharacterized protein LOC104423646 [Eucalyptus grandis]
 gb|KCW51953.1| hypothetical protein EUGRSUZ_J01397 [Eucalyptus grandis]
Length=88

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM     +C FQL RN   NP+VRV K  R   VL+  EEG+KY E  
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNALLNPDVRVNKAHRGMAVLDTAEEGRKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K +R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>ref|XP_006657932.1| PREDICTED: uncharacterized protein LOC102705450 [Oryza brachyantha]
Length=95

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VLEN  EG++Y + +
Sbjct  3    RWLKPDVYPLIAAMSFVTGLCTFQLTRNVFMNPDVRVNKNNRQSAVLENATEGERYSQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              + +  + PE+ P+ NR F+ P
Sbjct  63   FRRFLATQRPEVFPAANRFFAGP  85



>ref|XP_003552604.1| PREDICTED: uncharacterized protein LOC100785946 [Glycine max]
 gb|KHN37934.1| hypothetical protein glysoja_042363 [Glycine soja]
Length=86

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R+  VL+N EEG+KY E  
Sbjct  3    RWMKPEVYPLLAAMTFVSSMCVFQLTRNMLGNPDVRINKTRRSMPVLDNREEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>ref|XP_010553961.1| PREDICTED: uncharacterized protein LOC104823885 [Tarenaya hassleriana]
Length=87

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RWIR EVYP   AMG    +  FQL RN   NP+ R+ K  R +GVLEN EEG+KY + S
Sbjct  3    RWIRPEVYPLLGAMGFVTSMVVFQLTRNAMLNPDCRINKGNRKSGVLENEEEGEKYAQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
            L + +R ++P++MP++N  FS    
Sbjct  63   LRRFLRTRAPQVMPAINNFFSQDHH  87



>gb|KJB22813.1| hypothetical protein B456_004G066900 [Gossypium raimondii]
Length=86

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP   AM     +C FQL RN+  NP VR+ K  R+  VLENYEEG+KY E  
Sbjct  3    RWMKPEVYPLVGAMAFVTSMCIFQLTRNVFLNPAVRINKSDRSQAVLENYEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PE+MP++N  FS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>ref|XP_007032847.1| B12D protein [Theobroma cacao]
 gb|EOY03773.1| B12D protein [Theobroma cacao]
Length=86

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP   AM     +C FQL RN+  NP VR+ K  R+  VLENYEEG+KY E  
Sbjct  3    RWMKPEVYPLLGAMTFVTSMCIFQLTRNVFLNPAVRINKADRSKAVLENYEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L K +R + PE+MP++N  FS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>ref|XP_009406306.1| PREDICTED: uncharacterized protein LOC103989230 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM     +C FQL RN+  NP+VR+ K  R   VLEN +E ++Y +  
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCLFQLTRNMFLNPDVRINKSHRTTPVLENADEAQRYSQHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN  158
            L + +  + PEIMP++N  FS  +R+
Sbjct  63   LRRFLSRRPPEIMPTINTFFSGIKRD  88



>ref|XP_010029399.1| PREDICTED: uncharacterized protein LOC104419438 isoform X1 [Eucalyptus 
grandis]
Length=90

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -1

Query  412  WIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSL  233
             I   VYP  AAM    G+C FQL RN+  NP+VR+ K  R  GVL+N EEG+KY +  L
Sbjct  8    LIEETVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHGL  67

Query  232  XKXVRXKSPEIMPSLNRXFSDPQ  164
             K +R + PEIMP++N  FS+ +
Sbjct  68   RKFLRTRPPEIMPAINHFFSEDK  90



>ref|XP_008810952.1| PREDICTED: uncharacterized protein LOC103722254 [Phoenix dactylifera]
Length=87

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM    G+C FQL RN+  NP+VR+ K  RA+ +L+N EEG+KY + S
Sbjct  3    RWVRPEVYPLMAAMAFVTGMCAFQLTRNMILNPDVRINKARRASAILDNAEEGEKYSQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
              K +  +   +MP+L+   +D  +
Sbjct  63   FRKFLYRQRSAVMPALDGLSTDSDK  87



>ref|XP_006430939.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
 gb|ESR44179.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
Length=94

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            R +R EVYP  AAM     +C FQL RN+  NP+VR+ K  R+ GVLEN EEG+KY E  
Sbjct  3    RGMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQRN*LP  149
            L + +R + P++MP++NR FS  + +  P
Sbjct  63   LRRFLRTRPPQVMPAINRFFSQDKDHFQP  91



>ref|NP_001060223.1| Os07g0604700 [Oryza sativa Japonica Group]
 dbj|BAC83876.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF22137.1| Os07g0604700 [Oryza sativa Japonica Group]
 gb|EAZ04641.1| hypothetical protein OsI_26791 [Oryza sativa Indica Group]
 gb|EAZ40584.1| hypothetical protein OsJ_25043 [Oryza sativa Japonica Group]
 dbj|BAH01133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=95

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP   AM +  G+C FQL RN+  NP+VRV K  R + VLEN +EG+KY   +
Sbjct  3    RWVKPDVYPLIVAMSLVGGMCVFQLTRNVFMNPDVRVNKSHRQSAVLENADEGEKYHHHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              + +  + PE+ P++NR F+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|NP_001147337.1| B12D protein [Zea mays]
 gb|ACG26928.1| B12D protein [Zea mays]
Length=88

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VL+N  EG++Y + +  + +
Sbjct  2    QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  61

Query  220  RXKSPEIMPSLNRXFSDPQRN*LPG  146
              + PE+ P+LN  FSD   N  P 
Sbjct  62   ATQRPEVFPALNSFFSDSNNNNTPA  86



>ref|XP_001757013.1| predicted protein [Physcomitrella patens]
 gb|EDQ78244.1| predicted protein [Physcomitrella patens]
Length=94

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            +WI+ E+YP F A+  A+ + GF + R+I  NP+VR+ K+ R AGVLENY+EG+ Y    
Sbjct  10   QWIKPEIYPLFLAVATALSMGGFVMARSIAVNPDVRISKQDREAGVLENYKEGEVYKNHR  69

Query  235  LXKXVRXKSPEIMPSLNRXFSD  170
            L        P+IMPSLN  FS 
Sbjct  70   LRHYALKHGPQIMPSLNNYFSS  91



>ref|XP_009351238.1| PREDICTED: uncharacterized protein LOC103942755, partial [Pyrus 
x bretschneideri]
Length=66

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  397  VYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            VYP FAA GVA+GICG  L R+I  NPEVRV KEGRAAGVL
Sbjct  1    VYPLFAATGVAIGICGLSLFRHITINPEVRVSKEGRAAGVL  41



>tpg|DAA63528.1| TPA: b12D protein [Zea mays]
Length=125

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            +VYP  AAM    G+C FQL RN+  NP+VRV K  R + VL+N  EG++Y + +  + +
Sbjct  39   QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  98

Query  220  RXKSPEIMPSLNRXFSDPQRN*LPG  146
              + PE+ P+LN  FSD   N  P 
Sbjct  99   ATQRPEVFPALNSFFSDSNNNNTPA  123



>gb|EPS63516.1| hypothetical protein M569_11268, partial [Genlisea aurea]
Length=86

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM    G+   QL RN+  NP VR+ K  R + +++N E+G KY E +
Sbjct  3    RWMKPEVYPLLAAMTCVCGMVVLQLTRNVMHNPAVRLKKSERGSAIVDNEEKGMKYTEHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L K +R + PEIMP++NR F+
Sbjct  63   LRKFLRTRPPEIMPAVNRFFA  83



>ref|NP_001050622.2| Os03g0601500 [Oryza sativa Japonica Group]
 gb|EEC75707.1| hypothetical protein OsI_12530 [Oryza sativa Indica Group]
 dbj|BAF12536.2| Os03g0601500 [Oryza sativa Japonica Group]
Length=96

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP  AAM +A G+  FQL RN+  NPEV++ K  R   V ++  E ++Y    
Sbjct  3    RWVRPEVYPLMAAMMLASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHG  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
              +    + PE+MPS+NR FS+  R
Sbjct  63   FRRFFGRRRPEVMPSINRFFSNSDR  87



>ref|XP_010937886.1| PREDICTED: uncharacterized protein LOC105057112 [Elaeis guineensis]
Length=87

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP  AAM +  G+C FQL RN+  NP+VR+ K  R+  +L+N EEG+ Y + S
Sbjct  3    RWVKPEVYPLMAAMTLVTGMCVFQLTRNMILNPDVRINKTRRSTAILDNAEEGEMYSQHS  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDPQR  161
              K +    P ++PS +   +D  +
Sbjct  63   FRKFLYRLRPSVLPSFDGLSTDSDK  87



>ref|XP_006658786.1| PREDICTED: uncharacterized protein LOC102700818 [Oryza brachyantha]
Length=100

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP  AAM +  G+C F L RN+  NP+VRV K  R + V EN EEG+KY + +
Sbjct  3    RWVKPDVYPLIAAMSLVGGMCVFSLTRNVFMNPDVRVNKNNRQSAVPENAEEGEKYSQHA  62

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
              + +  + PE+ P++NR F+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|XP_002978639.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
 ref|XP_002984577.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ14222.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ20086.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
Length=95

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EV P    +G A+G+  F  +RN+  NPEVR+ KE R+AG+++NY+EG +Y E  
Sbjct  12   RWLKPEVIPLIGFIGAAMGLASFMCVRNLMLNPEVRINKEDRSAGLVQNYKEGYEYHEHG  71

Query  235  LXKXVRXKSPEIMPSLNRXFS  173
            L   +R +  EIMP +N  F+
Sbjct  72   LRHYMRNRKSEIMPRINEYFT  92



>gb|KEH35272.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=62

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  346  QLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDP  167
            QL+RNI  NPEVRV K+ RAAG+L+N++EG+KY +  + + VR KS EIMPSLN  FSDP
Sbjct  2    QLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHFIRRFVRGKSTEIMPSLNGFFSDP  61

Query  166  Q  164
            +
Sbjct  62   K  62



>gb|AAR13310.1| B12D-like protein [Phaseolus vulgaris]
Length=128

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEV-------------RVXKEGRAAGVL  275
            RW++ EVYP  AAM     +C FQL RN+  NP+V             RV K  R+  VL
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVSILVINFWSENWYRVNKTRRSMAVL  91

Query  274  enyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDPQ  164
            +N EEG+KY E  L K +R + PEIMP++N  FS  +
Sbjct  92   DNREEGEKYAEHGLRKFLRTRPPEIMPTINHFFSQDK  128



>gb|KGN53786.1| hypothetical protein Csa_4G129030 [Cucumis sativus]
Length=72

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  376  MGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIM  197
            MG    +C FQL RNI  NP+VRV K  R  GVL+N EEG+KY E SL + +R + PEIM
Sbjct  1    MGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHSLRRFLRTRPPEIM  60

Query  196  PSLNRXFSDPQR  161
            P++N  FS   +
Sbjct  61   PTINHYFSQDHK  72



>gb|EMS56733.1| Microspherule protein 1 [Triticum urartu]
Length=892

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            +VYP FA  GVAVGIC  QL+RNI  NPEVRV K+ RAAGVL
Sbjct  22   QVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGVL  63



>gb|EEC81850.1| hypothetical protein OsI_25618 [Oryza sativa Indica Group]
Length=173

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVR  308
            RWIR EVYP FA  GVAVGIC  QL+RNI  NPEVR
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVR  39



>emb|CDX85280.1| BnaC07g25910D [Brassica napus]
Length=72

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  376  MGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIM  197
            MG    +  FQL RN   NP+ R+ KE R  G+LEN +EG+KY + +L K +R + P++M
Sbjct  1    MGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHNLRKYLRTRPPQVM  60

Query  196  PSLNRXFSD  170
            PSLNR FS+
Sbjct  61   PSLNRFFSE  69



>ref|XP_001772578.1| predicted protein [Physcomitrella patens]
 gb|EDQ62620.1| predicted protein, partial [Physcomitrella patens]
Length=72

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVL  275
            RWI  EVYP    +G AVG+CG  ++RN   NP+VR+ KE RAAG L
Sbjct  3    RWIIPEVYPIVLVIGTAVGLCGTAIVRNASINPDVRINKEDRAAGYL  49



>ref|XP_002460987.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
 gb|EER97508.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
Length=76

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  376  MGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIM  197
            M    G+C FQL RN+  NP+VRV K  R + VL+N +EG++Y + +  + +  + PE+ 
Sbjct  1    MSFVTGMCVFQLTRNVLMNPDVRVSKSHRQSAVLDNADEGQRYSQHAFRRFLSTQRPEVF  60

Query  196  PSLNRXFSD  170
            P+LNR FS+
Sbjct  61   PALNRFFSN  69



>ref|XP_002961492.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
 gb|EFJ36752.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
Length=95

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ EVYP    +  AVG+  +   R +  +PEVRV K+ R  G L+N+ EG+ Y    
Sbjct  8    RWLKPEVYPLGVFVIGAVGLAAYLSARKLITDPEVRVNKDDRKHGRLDNHSEGEVYHNHP  67

Query  235  LXKXVRXKSPEIMPSLNRXFSDP  167
            L + +R K  +IMP LN  FS P
Sbjct  68   LRRFLRDKKTQIMPGLNEYFSKP  90



>gb|EMS53792.1| hypothetical protein TRIUR3_24112 [Triticum urartu]
Length=131

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW++ +VYP   AM +  G+C FQL RN+  NP+VRV K  R + V EN EEG++Y + +
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCVFQLTRNVFLNPDVRVSKSNRQSAVPENEEEGERYSQHA  62

Query  235  LXKXVRXKSPEIMPS  191
              + V    PE  P+
Sbjct  63   FRRFVSAHRPEGFPA  77



>gb|EYU29509.1| hypothetical protein MIMGU_mgv1a024878mg [Erythranthe guttata]
Length=90

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  319  PEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDPQRN  158
             EVRV KE RAAG+L+N++EG KY E +L K VR + PEIMPSLN  F+DPQ N
Sbjct  37   TEVRVNKENRAAGILDNFDEGHKYKEHALRKYVRNRKPEIMPSLNSFFTDPQNN  90



>ref|XP_001416807.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95100.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=101

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 43/94 (46%), Gaps = 9/94 (10%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVG+CGF   R +  +P     K  R AG+LE   +  +     
Sbjct  8    RWLRPEVYPIFAAIGGAVGLCGFFCTRQLVASPGFTAAKSRRMAGILETKADFDEGKNWR  67

Query  235  LXKXVR---------XKSPEIMPSLNRXFSDPQR  161
              +  R            P+I P LN  F   Q 
Sbjct  68   DHRVRRFLRSMYGGKGHGPQIFPGLNESFGGGQH  101



>ref|XP_005648934.1| hypothetical protein COCSUDRAFT_52948 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24390.1| hypothetical protein COCSUDRAFT_52948 [Coccomyxa subellipsoidea 
C-169]
Length=84

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGV  278
            +W++ E+YP FAA+G+ +G C +   RN   +PEVRV K  RA G 
Sbjct  7    QWVKPEIYPLFAALGLGIGACVYSSTRNFLHSPEVRVYKTSRADGA  52



>ref|XP_007511902.1| predicted protein [Bathycoccus prasinos]
 emb|CCO65990.1| predicted protein [Bathycoccus prasinos]
Length=96

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 3/80 (4%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXS  236
            RW+R EVYP FAA+G AVG+C F   R +  +P     K  RA  + E  ++ K+  +  
Sbjct  10   RWLRPEVYPIFAALGSAVGLCAFFCTRQLTTSPGFTASKAKRATAIPETAQDFKEGEKFR  69

Query  235  ---LXKXVRXKSPEIMPSLN  185
               + + V    PEIMP LN
Sbjct  70   NHFIRRSVLGMKPEIMPGLN  89



>ref|XP_002975136.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
 ref|XP_002977540.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ21544.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ23921.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
Length=81

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -1

Query  400  EVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXV  221
            +VYP  A M  AVG+  F  +RN+  NPEVRV K+ R AG+++N++EGK Y + +L + +
Sbjct  1    QVYPLIAFMAAAVGLASFVSMRNLTLNPEVRVNKDDRMAGLVQNFKEGKAYHDHALRRYL  60

Query  220  RX-KSPEIMPSLNRXF  176
               K  +I P +N  F
Sbjct  61   YTRKHFQITPGINEYF  76



>ref|XP_008346823.1| PREDICTED: putative cyclin-B3-1 [Malus domestica]
Length=132

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  316  EVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDPQRN  158
            ++RV KE RAAGVL+N+ EG+KY E  L K VR K+PEIMP +N  F+DP +N
Sbjct  80   KIRVTKENRAAGVLDNHAEGEKYKEHFLRKFVRNKAPEIMPGINAFFTDPSKN  132



>ref|XP_009394678.1| PREDICTED: uncharacterized protein LOC103980120 [Musa acuminata 
subsp. malaccensis]
Length=66

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  310  RVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSPEIMPSLNRXFSDPQ  164
            RV KEGRAAGVL+N+ EG+KY E SL K VR K+PEIMP++N  F+ P+
Sbjct  16   RVSKEGRAAGVLDNHAEGEKYAEHSLRKFVRNKNPEIMPAINNFFTRPE  64



>ref|XP_002507620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68878.1| predicted protein [Micromonas sp. RCC299]
Length=99

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 43/87 (49%), Gaps = 4/87 (5%)
 Frame = -1

Query  412  WIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkky----x  245
            WIR EVYP  AA+G AV +C F   R I  +P  RV K+GRA   +   +   K      
Sbjct  13   WIRPEVYPIVAAIGGAVSLCTFFCARQISSSPGFRVWKDGRAHEGIPEEKFRVKEGVNWR  72

Query  244  eXSLXKXVRXKSPEIMPSLNRXFSDPQ  164
            E  + + +R   P I P LN   + P+
Sbjct  73   EHFVRRAMRDTKPAIFPGLNDAMTSPK  99



>ref|NP_001168199.1| uncharacterized protein LOC100381955 [Zea mays]
 gb|ACN27425.1| unknown [Zea mays]
 gb|AFW84880.1| hypothetical protein ZEAMMB73_310499 [Zea mays]
Length=160

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -1

Query  415  RWIRXEVYPXFAAMGVAVGICGFQLIRNIXXNPEVR  308
            RW++ +VYP F  MGVA+GICG QL  NI  N EVR
Sbjct  99   RWVQPKVYPLFMTMGVAMGICGLQLFWNITGNLEVR  134



>gb|AAP12919.2| expressed protein [Oryza sativa Japonica Group]
Length=84

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -1

Query  385  FAAMGVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVRXKSP  206
             AAM +A G+  FQL RN+  NPEV++ K  R   V ++  E ++Y      +    + P
Sbjct  1    MAAMMLASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHGFRRFFGRRRP  60

Query  205  EIMPSLNRXFSDPQR  161
            E+MPS+NR FS+  R
Sbjct  61   EVMPSINRFFSNSDR  75



>ref|XP_003601294.1| B12D-like protein [Medicago truncatula]
Length=96

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -1

Query  394  YPXFAAM-GVAVGICGFQLIRNIXXNPEVRVXKEGRAAGVLenyeegkkyxeXSLXKXVR  218
            YP    M G +        I ++      RV K+ RAAGVLEN+ EG+KY E  L K  R
Sbjct  17   YPFAGEMEGGSTHTYALTSIMDVCSFDGFRVNKQSRAAGVLENFAEGEKYTEHLLRKFSR  76

Query  217  XKSPEIMPSLNRXFSDPQRN  158
             +SPEIMP LN  F+DP RN
Sbjct  77   NRSPEIMPGLNSFFTDPSRN  96



>gb|ACU13634.1| unknown [Glycine max]
Length=110

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  192  DGIISGLLXRTNFXREXsxyffpss*fsNtpaalpslxtltsGLXXIFRIN*NPQXPTAT  371
            +GIISG+L RT F R+ S YF PS+ FSNTPA LPSL TLTSGL  I R N NPQ PTA 
Sbjct  2    EGIISGVLLRTYFLRKCSAYFSPSAKFSNTPAFLPSLFTLTSGLMQILRTNWNPQIPTAA  61

Query  372  PMAANXG*TSXLIQ  413
            P AA+ G TS L Q
Sbjct  62   PTAASSGYTSGLSQ  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700