BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029L13

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD22104.1|  B12D protein                                            127   1e-34   Ipomoea batatas [batate]
ref|XP_011087179.1|  PREDICTED: uncharacterized protein LOC105168733    115   5e-30   Sesamum indicum [beniseed]
ref|XP_002283743.1|  PREDICTED: uncharacterized protein LOC100263922    114   2e-29   Vitis vinifera
emb|CBI15096.3|  unnamed protein product                                113   3e-29   Vitis vinifera
ref|XP_010929102.1|  PREDICTED: uncharacterized protein LOC105050689    112   5e-29   Elaeis guineensis
ref|XP_008437938.1|  PREDICTED: uncharacterized protein LOC103483212    112   7e-29   Cucumis melo [Oriental melon]
ref|XP_004152455.1|  PREDICTED: uncharacterized protein LOC101218501    112   1e-28   
ref|XP_010942173.1|  PREDICTED: uncharacterized protein LOC105060...    111   1e-28   Elaeis guineensis
ref|XP_008806317.1|  PREDICTED: uncharacterized protein LOC103719037    111   1e-28   Phoenix dactylifera
ref|XP_008779549.1|  PREDICTED: uncharacterized protein LOC103699287    111   1e-28   Phoenix dactylifera
ref|XP_007138129.1|  hypothetical protein PHAVU_009G182600g             110   2e-28   Phaseolus vulgaris [French bean]
ref|XP_006856912.1|  hypothetical protein AMTR_s00055p00220460          110   2e-28   Amborella trichopoda
ref|XP_004233340.1|  PREDICTED: uncharacterized protein LOC101261386    109   7e-28   
ref|XP_008798028.1|  PREDICTED: uncharacterized protein LOC103713044    109   7e-28   Phoenix dactylifera
gb|EPS70000.1|  hypothetical protein M569_04763                         109   7e-28   Genlisea aurea
gb|AGC24177.1|  unknown                                                 108   1e-27   Rehmannia glutinosa [Chinese foxglove]
ref|XP_004501964.1|  PREDICTED: uncharacterized protein LOC101508877    108   2e-27   Cicer arietinum [garbanzo]
ref|XP_010100274.1|  hypothetical protein L484_027580                   108   2e-27   Morus notabilis
ref|XP_006357136.1|  PREDICTED: uncharacterized protein LOC102583994    108   2e-27   Solanum tuberosum [potatoes]
ref|XP_010027794.1|  PREDICTED: uncharacterized protein LOC104418219    108   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010027818.1|  PREDICTED: uncharacterized protein LOC104418237    108   3e-27   Eucalyptus grandis [rose gum]
ref|XP_009385140.1|  PREDICTED: uncharacterized protein LOC103972508    107   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009760043.1|  PREDICTED: uncharacterized protein LOC104212451    107   4e-27   Nicotiana sylvestris
ref|XP_009615457.1|  PREDICTED: uncharacterized protein LOC104108174    107   5e-27   Nicotiana tomentosiformis
ref|XP_006338509.1|  PREDICTED: uncharacterized protein LOC102603775    107   5e-27   Solanum tuberosum [potatoes]
ref|XP_010678668.1|  PREDICTED: uncharacterized protein LOC104894188    107   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003527039.1|  PREDICTED: uncharacterized protein LOC100499787    107   7e-27   Glycine max [soybeans]
ref|XP_010556171.1|  PREDICTED: uncharacterized protein LOC104825524    107   8e-27   Tarenaya hassleriana [spider flower]
ref|XP_010913425.1|  PREDICTED: uncharacterized protein LOC105039118    107   8e-27   Elaeis guineensis
ref|XP_007226455.1|  hypothetical protein PRUPE_ppa024551mg             106   1e-26   Prunus persica
gb|KHG26447.1|  Uncharacterized protein F383_04740                      106   1e-26   Gossypium arboreum [tree cotton]
ref|XP_006845122.1|  hypothetical protein AMTR_s00005p00190110          106   1e-26   Amborella trichopoda
ref|NP_001148351.1|  LOC100281961                                       106   1e-26   Zea mays [maize]
ref|XP_003523058.1|  PREDICTED: uncharacterized protein LOC100500534    106   1e-26   Glycine max [soybeans]
ref|XP_008222037.1|  PREDICTED: uncharacterized protein LOC103321965    106   1e-26   Prunus mume [ume]
ref|XP_010272106.1|  PREDICTED: uncharacterized protein LOC104607987    106   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009771458.1|  PREDICTED: uncharacterized protein LOC104221988    105   2e-26   Nicotiana sylvestris
ref|XP_011098540.1|  PREDICTED: uncharacterized protein LOC105177185    105   2e-26   Sesamum indicum [beniseed]
ref|XP_011085792.1|  PREDICTED: uncharacterized protein LOC105167687    105   2e-26   Sesamum indicum [beniseed]
gb|AEC10990.1|  b12d-like protein                                       105   3e-26   Camellia sinensis [black tea]
ref|XP_002438146.1|  hypothetical protein SORBIDRAFT_10g008810          105   3e-26   Sorghum bicolor [broomcorn]
ref|XP_002511469.1|  conserved hypothetical protein                     105   3e-26   Ricinus communis
ref|XP_010111964.1|  hypothetical protein L484_004741                   105   3e-26   Morus notabilis
gb|ADB08699.1|  B12D-like protein                                       105   4e-26   Wolffia arrhiza
ref|XP_004232259.1|  PREDICTED: uncharacterized protein LOC101265497    105   4e-26   Solanum lycopersicum
ref|XP_009403647.1|  PREDICTED: uncharacterized protein LOC103987158    105   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001057280.1|  Os06g0246000                                       104   6e-26   
gb|ACU15648.1|  unknown                                                 104   6e-26   Glycine max [soybeans]
gb|AFO59572.1|  B12D like protein                                       104   6e-26   Saccharum hybrid cultivar GT28
ref|XP_010511712.1|  PREDICTED: uncharacterized protein LOC104787778    104   7e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008792162.1|  PREDICTED: uncharacterized protein LOC103708847    104   7e-26   Phoenix dactylifera
emb|CAK22419.1|  B12D-like protein                                      104   7e-26   Beta vulgaris [beet]
ref|XP_004236155.1|  PREDICTED: uncharacterized protein LOC101260417    104   9e-26   Solanum lycopersicum
ref|XP_009588369.1|  PREDICTED: uncharacterized protein LOC104085953    104   9e-26   Nicotiana tomentosiformis
ref|XP_009785405.1|  PREDICTED: uncharacterized protein LOC104233674    104   1e-25   Nicotiana sylvestris
ref|XP_011042649.1|  PREDICTED: uncharacterized protein LOC105138299    103   1e-25   Populus euphratica
gb|ACJ84101.1|  unknown                                                 103   1e-25   Medicago truncatula
ref|XP_010470676.1|  PREDICTED: uncharacterized protein LOC104750563    105   1e-25   Camelina sativa [gold-of-pleasure]
ref|NP_001152717.1|  LOC100286358                                       103   1e-25   Zea mays [maize]
ref|XP_006344997.1|  PREDICTED: uncharacterized protein LOC102605944    103   1e-25   Solanum tuberosum [potatoes]
ref|XP_009627555.1|  PREDICTED: uncharacterized protein LOC104118078    105   2e-25   
ref|XP_010546014.1|  PREDICTED: uncharacterized protein LOC104818223    103   2e-25   Tarenaya hassleriana [spider flower]
emb|CDP02170.1|  unnamed protein product                                103   2e-25   Coffea canephora [robusta coffee]
ref|XP_010415343.1|  PREDICTED: uncharacterized protein LOC104701372    103   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007209803.1|  hypothetical protein PRUPE_ppa014036mg             103   2e-25   Prunus persica
ref|XP_008800943.1|  PREDICTED: uncharacterized protein LOC103715180    103   3e-25   Phoenix dactylifera
ref|XP_002270661.1|  PREDICTED: uncharacterized protein LOC100259604    103   3e-25   Vitis vinifera
emb|CDP14927.1|  unnamed protein product                                102   3e-25   Coffea canephora [robusta coffee]
gb|AFK33307.1|  unknown                                                 102   3e-25   Medicago truncatula
ref|XP_002318014.1|  senescence-associated family protein               102   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010550670.1|  PREDICTED: uncharacterized protein LOC104821467    102   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_004965125.1|  PREDICTED: uncharacterized protein LOC101762161    102   4e-25   Setaria italica
ref|XP_006439727.1|  hypothetical protein CICLE_v10023087mg             102   4e-25   Citrus clementina [clementine]
ref|XP_010255359.1|  PREDICTED: uncharacterized protein LOC104596051    102   6e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004502329.1|  PREDICTED: uncharacterized protein LOC101491577    102   7e-25   Cicer arietinum [garbanzo]
ref|XP_008340166.1|  PREDICTED: uncharacterized protein LOC103403120    102   7e-25   
ref|XP_010930055.1|  PREDICTED: uncharacterized protein LOC105051361    102   7e-25   Elaeis guineensis
ref|XP_010942172.1|  PREDICTED: uncharacterized protein LOC105060...    102   8e-25   Elaeis guineensis
ref|XP_006655963.1|  PREDICTED: uncharacterized protein LOC102707968    101   9e-25   Oryza brachyantha
ref|XP_007036078.1|  B12D protein                                       101   1e-24   Theobroma cacao [chocolate]
ref|XP_008374479.1|  PREDICTED: uncharacterized protein LOC103437758    101   1e-24   Malus domestica [apple tree]
ref|XP_008239697.1|  PREDICTED: uncharacterized protein LOC103338283    101   1e-24   Prunus mume [ume]
ref|XP_003551877.1|  PREDICTED: uncharacterized protein LOC100500344    100   2e-24   Glycine max [soybeans]
ref|XP_002515002.1|  conserved hypothetical protein                     101   2e-24   
ref|XP_003564009.1|  PREDICTED: uncharacterized protein LOC100821381    100   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_006404294.1|  hypothetical protein EUTSA_v10010862mg             100   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010907762.1|  PREDICTED: uncharacterized protein LOC105034337    100   2e-24   Elaeis guineensis
ref|XP_002311729.1|  hypothetical protein POPTR_0008s17950g             100   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010692143.1|  PREDICTED: uncharacterized protein LOC104905334    100   3e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU15396.1|  unknown                                                 100   3e-24   Glycine max [soybeans]
ref|XP_011029641.1|  PREDICTED: uncharacterized protein LOC105129336    100   3e-24   Populus euphratica
gb|KDP26755.1|  hypothetical protein JCGZ_17913                         100   3e-24   Jatropha curcas
gb|KHG12689.1|  Uncharacterized protein F383_19724                      100   3e-24   Gossypium arboreum [tree cotton]
gb|KJB30971.1|  hypothetical protein B456_005G172200                    100   4e-24   Gossypium raimondii
gb|AFK42697.1|  unknown                                                 100   4e-24   Lotus japonicus
ref|XP_007163724.1|  hypothetical protein PHAVU_001G258900g           99.0    9e-24   Phaseolus vulgaris [French bean]
ref|XP_011042304.1|  PREDICTED: uncharacterized protein LOC105138023  99.0    1e-23   Populus euphratica
ref|XP_006391239.1|  hypothetical protein EUTSA_v10019446mg           99.0    1e-23   Eutrema salsugineum [saltwater cress]
gb|KFK34105.1|  b12d protein                                          99.0    1e-23   Arabis alpina [alpine rockcress]
ref|XP_003538567.1|  PREDICTED: uncharacterized protein LOC100527541  98.6    1e-23   Glycine max [soybeans]
ref|XP_002875880.1|  hypothetical protein ARALYDRAFT_485174           98.6    2e-23   
ref|NP_190397.1|  B12D protein                                        98.2    2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351806.1|  PREDICTED: uncharacterized protein LOC103415246  97.8    3e-23   
gb|KCW61991.1|  hypothetical protein EUGRSUZ_H04674                   99.0    3e-23   Eucalyptus grandis [rose gum]
ref|XP_010515125.1|  PREDICTED: uncharacterized protein LOC104791023  97.4    3e-23   Camelina sativa [gold-of-pleasure]
gb|KHN44408.1|  hypothetical protein glysoja_014449                   97.4    4e-23   Glycine soja [wild soybean]
emb|CDY44977.1|  BnaCnng12070D                                        97.1    5e-23   Brassica napus [oilseed rape]
ref|XP_002314553.2|  hypothetical protein POPTR_0010s06550g           99.4    5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009149843.1|  PREDICTED: uncharacterized protein LOC103873171  96.7    7e-23   Brassica rapa
gb|ACU16637.1|  unknown                                               96.7    8e-23   Glycine max [soybeans]
ref|XP_006290288.1|  hypothetical protein CARUB_v10018322mg           96.3    1e-22   Capsella rubella
ref|XP_004310038.1|  PREDICTED: uncharacterized protein LOC101295883  95.5    2e-22   Fragaria vesca subsp. vesca
gb|ACG48656.1|  B12D protein                                          95.9    2e-22   Zea mays [maize]
ref|XP_004142944.1|  PREDICTED: uncharacterized protein LOC101222643  95.1    3e-22   Cucumis sativus [cucumbers]
gb|EMT09386.1|  hypothetical protein F775_07588                       95.1    3e-22   
gb|AFK36649.1|  unknown                                               95.1    3e-22   Lotus japonicus
ref|XP_008651557.1|  PREDICTED: B12D protein isoform X1               95.1    4e-22   Zea mays [maize]
ref|XP_004504481.1|  PREDICTED: uncharacterized protein LOC101503540  95.1    4e-22   Cicer arietinum [garbanzo]
ref|XP_009150210.1|  PREDICTED: uncharacterized protein LOC103873555  94.0    7e-22   Brassica rapa
ref|XP_004299593.1|  PREDICTED: uncharacterized protein LOC101301782  94.0    8e-22   Fragaria vesca subsp. vesca
ref|XP_002459694.1|  hypothetical protein SORBIDRAFT_02g008930        94.0    1e-21   Sorghum bicolor [broomcorn]
gb|ABK24106.1|  unknown                                               94.0    1e-21   Picea sitchensis
emb|CAA54065.1|  HvB12D                                               93.2    1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH20547.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      92.4    3e-21   Medicago truncatula
gb|EMS61978.1|  hypothetical protein TRIUR3_19930                     92.4    5e-21   Triticum urartu
gb|AFW76868.1|  hypothetical protein ZEAMMB73_758599                  93.2    7e-21   
ref|XP_003601829.1|  B12D protein                                     91.3    8e-21   Medicago truncatula
ref|XP_006376832.1|  hypothetical protein POPTR_0012s07660g           90.9    1e-20   
ref|XP_010249439.1|  PREDICTED: uncharacterized protein LOC104591985  90.5    2e-20   Nelumbo nucifera [Indian lotus]
gb|EMT27875.1|  hypothetical protein F775_28789                       90.1    3e-20   
ref|XP_007044988.1|  B12D protein                                     89.4    4e-20   Theobroma cacao [chocolate]
ref|XP_003557311.1|  PREDICTED: uncharacterized protein LOC100833199  88.6    1e-19   
ref|XP_011086732.1|  PREDICTED: uncharacterized protein LOC105168371  88.2    1e-19   Sesamum indicum [beniseed]
ref|XP_004955942.1|  PREDICTED: uncharacterized protein LOC101785845  87.8    2e-19   Setaria italica
emb|CDP13299.1|  unnamed protein product                              87.0    4e-19   Coffea canephora [robusta coffee]
ref|XP_006338343.1|  PREDICTED: uncharacterized protein LOC102603988  87.0    4e-19   Solanum tuberosum [potatoes]
gb|EPS70497.1|  hypothetical protein M569_04271                       86.7    5e-19   Genlisea aurea
gb|EMS45331.1|  hypothetical protein TRIUR3_29962                     87.0    5e-19   Triticum urartu
dbj|BAK01669.1|  predicted protein                                    86.7    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01100.1|  predicted protein                                    86.7    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC84633.1|  putative B12D protein                                86.7    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001779363.1|  predicted protein                                86.3    1e-18   
ref|XP_009596991.1|  PREDICTED: uncharacterized protein LOC104092997  85.1    2e-18   Nicotiana tomentosiformis
ref|XP_006658464.1|  PREDICTED: uncharacterized protein LOC102702396  85.5    2e-18   Oryza brachyantha
gb|EYU20492.1|  hypothetical protein MIMGU_mgv1a026736mg              84.7    3e-18   Erythranthe guttata [common monkey flower]
ref|XP_004232140.1|  PREDICTED: uncharacterized protein LOC101252543  84.7    3e-18   Solanum lycopersicum
ref|XP_008464582.1|  PREDICTED: uncharacterized protein LOC103502424  84.3    4e-18   Cucumis melo [Oriental melon]
gb|EYU29787.1|  hypothetical protein MIMGU_mgv1a021169mg              83.2    9e-18   Erythranthe guttata [common monkey flower]
ref|XP_009792586.1|  PREDICTED: uncharacterized protein LOC104239607  83.2    1e-17   Nicotiana sylvestris
ref|XP_006340507.1|  PREDICTED: uncharacterized protein LOC102592850  84.0    2e-17   Solanum tuberosum [potatoes]
ref|XP_001776158.1|  predicted protein                                82.8    2e-17   
gb|EYU25265.1|  hypothetical protein MIMGU_mgv1a024239mg              82.4    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_011099034.1|  PREDICTED: uncharacterized protein LOC105177540  82.4    2e-17   Sesamum indicum [beniseed]
ref|XP_010694063.1|  PREDICTED: uncharacterized protein LOC104906928  82.4    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006856407.1|  hypothetical protein AMTR_s00047p00213990        82.0    3e-17   Amborella trichopoda
ref|NP_001151846.1|  B12D protein                                     81.6    4e-17   Zea mays [maize]
emb|CDP19974.1|  unnamed protein product                              81.3    6e-17   Coffea canephora [robusta coffee]
ref|XP_006438116.1|  hypothetical protein CICLE_v10033501mg           81.3    7e-17   Citrus clementina [clementine]
ref|XP_006484337.1|  PREDICTED: uncharacterized protein LOC102622685  80.9    1e-16   
ref|XP_010029400.1|  PREDICTED: uncharacterized protein LOC104419...  80.5    1e-16   Eucalyptus grandis [rose gum]
ref|XP_004137261.1|  PREDICTED: uncharacterized protein LOC101217963  80.5    1e-16   Cucumis sativus [cucumbers]
ref|XP_007215204.1|  hypothetical protein PRUPE_ppa014104mg           80.1    1e-16   Prunus persica
ref|XP_008230281.1|  PREDICTED: uncharacterized protein LOC103329570  80.1    2e-16   Prunus mume [ume]
ref|XP_002531002.1|  conserved hypothetical protein                   79.7    2e-16   Ricinus communis
ref|XP_010099316.1|  hypothetical protein L484_018178                 79.3    3e-16   Morus notabilis
ref|XP_003531875.1|  PREDICTED: uncharacterized protein LOC100527287  79.0    4e-16   Glycine max [soybeans]
ref|XP_006373388.1|  germination family protein                       79.0    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011021065.1|  PREDICTED: uncharacterized protein LOC105123251  79.0    5e-16   Populus euphratica
gb|AAL17696.1|  B12D-like protein                                     80.1    5e-16   Castanea sativa
ref|XP_004304209.1|  PREDICTED: uncharacterized protein LOC101313329  78.6    7e-16   Fragaria vesca subsp. vesca
ref|XP_004491894.1|  PREDICTED: uncharacterized protein LOC101510215  78.2    8e-16   Cicer arietinum [garbanzo]
ref|XP_002281305.1|  PREDICTED: uncharacterized protein LOC100258293  78.2    9e-16   Vitis vinifera
ref|XP_010260574.1|  PREDICTED: uncharacterized protein LOC104599651  78.2    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008362218.1|  PREDICTED: uncharacterized protein LOC103425898  77.8    1e-15   
ref|XP_010257978.1|  PREDICTED: uncharacterized protein LOC104597899  77.8    1e-15   Nelumbo nucifera [Indian lotus]
gb|KCW56312.1|  hypothetical protein EUGRSUZ_I02053                   80.5    1e-15   Eucalyptus grandis [rose gum]
gb|AFK43764.1|  unknown                                               77.8    1e-15   Medicago truncatula
ref|XP_010260461.1|  PREDICTED: uncharacterized protein LOC104599559  77.0    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008379445.1|  PREDICTED: uncharacterized protein LOC103442440  77.0    2e-15   
ref|XP_010514670.1|  PREDICTED: uncharacterized protein LOC104790592  76.6    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002305391.1|  germination family protein                       76.3    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009151762.1|  PREDICTED: uncharacterized protein LOC103875065  76.3    4e-15   Brassica rapa
ref|XP_009419068.1|  PREDICTED: uncharacterized protein LOC103999135  76.3    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139429.1|  hypothetical protein PHAVU_008G028700g           77.0    5e-15   Phaseolus vulgaris [French bean]
dbj|BAK03592.1|  predicted protein                                    75.9    6e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011008605.1|  PREDICTED: uncharacterized protein LOC105113935  75.9    6e-15   Populus euphratica
ref|XP_006482419.1|  PREDICTED: uncharacterized protein LOC102612079  75.9    6e-15   Citrus sinensis [apfelsine]
ref|NP_189632.1|  B12D protein                                        75.9    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875526.1|  hypothetical protein ARALYDRAFT_323026           75.9    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_007032847.1|  B12D protein                                     75.1    1e-14   
gb|KJB22813.1|  hypothetical protein B456_004G066900                  75.1    1e-14   Gossypium raimondii
dbj|BAC83875.1|  unknown protein                                      75.5    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KDP24288.1|  hypothetical protein JCGZ_25584                       75.1    1e-14   Jatropha curcas
ref|XP_010502994.1|  PREDICTED: uncharacterized protein LOC104780196  75.1    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003552604.1|  PREDICTED: uncharacterized protein LOC100785946  74.7    2e-14   Glycine max [soybeans]
gb|AFK44347.1|  unknown                                               74.7    2e-14   Lotus japonicus
ref|XP_006395262.1|  hypothetical protein EUTSA_v10005671mg           74.7    2e-14   Eutrema salsugineum [saltwater cress]
ref|NP_001060222.2|  Os07g0604600                                     75.5    2e-14   
ref|XP_010034410.1|  PREDICTED: uncharacterized protein LOC104423644  74.3    2e-14   
dbj|BAG94722.1|  unnamed protein product                              74.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059359.1|  Os07g0274400                                     74.3    3e-14   
ref|XP_008651396.1|  PREDICTED: B12D protein isoform X1               74.3    3e-14   
ref|XP_010034411.1|  PREDICTED: uncharacterized protein LOC104423646  73.9    3e-14   
ref|XP_010553961.1|  PREDICTED: uncharacterized protein LOC104823885  73.6    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_008664404.1|  PREDICTED: uncharacterized protein LOC100383000  73.6    4e-14   Zea mays [maize]
ref|XP_004958246.1|  PREDICTED: uncharacterized protein LOC101775472  73.6    5e-14   Setaria italica
ref|NP_001059360.2|  Os07g0274700                                     74.3    5e-14   
ref|XP_006657932.1|  PREDICTED: uncharacterized protein LOC102705450  73.6    6e-14   Oryza brachyantha
ref|XP_009406306.1|  PREDICTED: uncharacterized protein LOC103989230  73.2    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88884.1|  predicted protein                                    74.3    7e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003562728.1|  PREDICTED: uncharacterized protein LOC100837236  73.2    7e-14   Brachypodium distachyon [annual false brome]
ref|XP_008810952.1|  PREDICTED: uncharacterized protein LOC103722254  71.6    2e-13   
ref|XP_006430939.1|  hypothetical protein CICLE_v10013823mg           71.6    2e-13   Citrus clementina [clementine]
gb|EPS63516.1|  hypothetical protein M569_11268                       71.2    4e-13   Genlisea aurea
ref|XP_006658463.1|  PREDICTED: uncharacterized protein LOC102702117  70.9    5e-13   Oryza brachyantha
ref|XP_004955938.1|  PREDICTED: uncharacterized protein LOC101784102  70.9    5e-13   Setaria italica
ref|XP_002459693.1|  hypothetical protein SORBIDRAFT_02g008920        70.9    6e-13   Sorghum bicolor [broomcorn]
ref|XP_003561264.1|  PREDICTED: uncharacterized protein LOC100824762  70.1    9e-13   Brachypodium distachyon [annual false brome]
ref|NP_001060223.1|  Os07g0604700                                     70.5    9e-13   
ref|XP_002978639.1|  hypothetical protein SELMODRAFT_152721           70.1    1e-12   Selaginella moellendorffii
ref|XP_006658786.1|  PREDICTED: uncharacterized protein LOC102700818  69.7    2e-12   Oryza brachyantha
ref|XP_010029399.1|  PREDICTED: uncharacterized protein LOC104419...  69.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010937886.1|  PREDICTED: uncharacterized protein LOC105057112  68.9    3e-12   Elaeis guineensis
ref|XP_001757013.1|  predicted protein                                67.4    1e-11   
gb|AAR13310.1|  B12D-like protein                                     67.4    2e-11   Phaseolus vulgaris [French bean]
ref|NP_001050622.2|  Os03g0601500                                     64.3    1e-10   
ref|NP_001147337.1|  B12D protein                                     63.9    2e-10   
tpg|DAA63528.1|  TPA: b12D protein                                    63.5    4e-10   
ref|XP_002961492.1|  hypothetical protein SELMODRAFT_76981            62.0    1e-09   
gb|EYU29509.1|  hypothetical protein MIMGU_mgv1a024878mg              60.8    2e-09   Erythranthe guttata [common monkey flower]
gb|KEH35272.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit      58.9    7e-09   Medicago truncatula
ref|XP_003601294.1|  B12D-like protein                                58.9    1e-08   
gb|KGN53786.1|  hypothetical protein Csa_4G129030                     58.2    1e-08   Cucumis sativus [cucumbers]
gb|EMS53792.1|  hypothetical protein TRIUR3_24112                     58.5    3e-08   Triticum urartu
ref|XP_001416807.1|  predicted protein                                57.0    7e-08   Ostreococcus lucimarinus CCE9901
ref|XP_008346823.1|  PREDICTED: putative cyclin-B3-1                  57.4    7e-08   
ref|XP_009394678.1|  PREDICTED: uncharacterized protein LOC103980120  55.8    9e-08   
ref|XP_007511902.1|  predicted protein                                56.6    9e-08   Bathycoccus prasinos
ref|XP_001772578.1|  predicted protein                                55.8    1e-07   
ref|XP_009351238.1|  PREDICTED: uncharacterized protein LOC103942755  54.7    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_002887135.1|  hypothetical protein ARALYDRAFT_894514           55.5    3e-07   
emb|CDX85280.1|  BnaC07g25910D                                        53.9    5e-07   
gb|EEC81850.1|  hypothetical protein OsI_25618                        55.1    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002460987.1|  hypothetical protein SORBIDRAFT_02g038760        52.0    2e-06   
ref|XP_002507620.1|  predicted protein                                52.0    4e-06   Micromonas commoda
ref|XP_005648934.1|  hypothetical protein COCSUDRAFT_52948            51.6    4e-06   Coccomyxa subellipsoidea C-169
gb|EMS56733.1|  Microspherule protein 1                               54.7    7e-06   Triticum urartu
ref|XP_002975136.1|  hypothetical protein SELMODRAFT_102690           50.4    9e-06   
ref|NP_001168199.1|  uncharacterized protein LOC100381955             48.1    2e-04   
gb|EMS55237.1|  hypothetical protein TRIUR3_19745                     46.6    2e-04   Triticum urartu
emb|CEF97372.1|  NADH-ubiquinone reductase complex 1 MLRQ subunit     46.2    4e-04   Ostreococcus tauri



>gb|AAD22104.1| B12D protein [Ipomoea batatas]
Length=90

 Score =   127 bits (318),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAAM VAVG CGFQ IRN+  N  VRVNKEGRAAGV ENYEEGKKY EHS
Sbjct  5    RWIRPEVYPLFAAMSVAVGICGFQLIRNLTTNPEVRVNKEGRAAGVLENYEEGKKYAEHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNKSPEIMPSLNR FSDPQRN
Sbjct  65   LRKFVRNKSPEIMPSLNRFFSDPQRN  90



>ref|XP_011087179.1| PREDICTED: uncharacterized protein LOC105168733 [Sesamum indicum]
Length=89

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAAMGVAVG CGFQ +RNI  N  VRVNKEGRAAGV EN+ EG+KY EH+
Sbjct  5    RWIRPEVYPLFAAMGVAVGICGFQLVRNICINPEVRVNKEGRAAGVLENFAEGQKYSEHA  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+ PEIMPS+N  F+DPQ
Sbjct  65   LKKFVRNRRPEIMPSINSFFTDPQ  88



>ref|XP_002283743.1| PREDICTED: uncharacterized protein LOC100263922 [Vitis vinifera]
Length=93

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ +RNI  N  VRV+KE RAAGV EN+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHF  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRNKSPEIMPS+N  FSDP++N
Sbjct  68   LRKYVRNKSPEIMPSINSFFSDPEKN  93



>emb|CBI15096.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   113 bits (282),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ +RNI  N  VRV+KE RAAGV EN+ EG+KY EH 
Sbjct  3    RWLRPEVYPLFAAMGVAVGICGFQLVRNICINPDVRVSKENRAAGVLENFTEGQKYSEHF  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRNKSPEIMPS+N  FSDP++N
Sbjct  63   LRKYVRNKSPEIMPSINSFFSDPEKN  88



>ref|XP_010929102.1| PREDICTED: uncharacterized protein LOC105050689 [Elaeis guineensis]
Length=91

 Score =   112 bits (281),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV ENY EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+PEIMPS+NR F+DP+
Sbjct  68   LRKFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008437938.1| PREDICTED: uncharacterized protein LOC103483212 [Cucumis melo]
Length=94

 Score =   112 bits (280),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ IRNI  N  VRV+KE RAAGV +N+ EG+KY EH 
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVSKENRAAGVLDNFAEGEKYSEHF  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNKSPEIMPS+N  F+DP RN
Sbjct  69   LRKFVRNKSPEIMPSINNFFTDPSRN  94



>ref|XP_004152455.1| PREDICTED: uncharacterized protein LOC101218501 [Cucumis sativus]
 ref|XP_004157801.1| PREDICTED: uncharacterized LOC101218501 [Cucumis sativus]
 gb|KGN64280.1| hypothetical protein Csa_1G045780 [Cucumis sativus]
Length=94

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ IRNI  N  VRV KE RAAGV +N+ EG+KY EH 
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLIRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHF  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNKSPEIMPS+N  F+DP RN
Sbjct  69   LRKFVRNKSPEIMPSINNFFTDPNRN  94



>ref|XP_010942173.1| PREDICTED: uncharacterized protein LOC105060250 isoform X2 [Elaeis 
guineensis]
Length=91

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV ENY EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGQKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L +FVRNK+PEIMPS+NR F+DP+
Sbjct  68   LRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008806317.1| PREDICTED: uncharacterized protein LOC103719037 [Phoenix dactylifera]
Length=91

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV EN+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENHAEGEKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L +FVRNK+PEIMPS+NR F+DP+
Sbjct  68   LRRFVRNKAPEIMPSINRFFADPK  91



>ref|XP_008779549.1| PREDICTED: uncharacterized protein LOC103699287 [Phoenix dactylifera]
Length=91

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV EN+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENFAEGQKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+PEI+PS+NR F+DP+
Sbjct  68   LRKFVRNKAPEILPSINRFFADPK  91



>ref|XP_007138129.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
 gb|ESW10123.1| hypothetical protein PHAVU_009G182600g [Phaseolus vulgaris]
Length=89

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG CGFQ +RNI  N  VRVNKEGR AGV EN+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFSEGEKYTEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRN+SPEIMPSLN  F+DP RN
Sbjct  64   LRKYVRNRSPEIMPSLNSFFADPSRN  89



>ref|XP_006856912.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
 gb|ERN18379.1| hypothetical protein AMTR_s00055p00220460 [Amborella trichopoda]
Length=91

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRVNKE RAAG+ EN+ EG++Y EHS
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEARAAGILENFTEGERYAEHS  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+SPEIMPS+N  F+DP+
Sbjct  68   LRKFVRNRSPEIMPSINGYFTDPK  91



>ref|XP_004233340.1| PREDICTED: uncharacterized protein LOC101261386 [Solanum lycopersicum]
Length=91

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ IRN+  N  VRVNKE RAAGV EN+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLIRNVCINPEVRVNKENRAAGVLENFSEGEKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+SPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNRSPEIMPSINGFFSDPK  91



>ref|XP_008798028.1| PREDICTED: uncharacterized protein LOC103713044 [Phoenix dactylifera]
Length=92

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV ENY EG+ Y EH 
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGETYAEHG  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R ++PEIMPS+NR F+DP+
Sbjct  69   LRKFLRTRTPEIMPSINRFFADPK  92



>gb|EPS70000.1| hypothetical protein M569_04763, partial [Genlisea aurea]
Length=86

 Score =   109 bits (272),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAAMG+AVG CGFQ IRNI  N  VRVNK  R+AGV EN+EEG KY EHS
Sbjct  4    RWIRPEVYPLFAAMGIAVGICGFQLIRNITGNPEVRVNKRDRSAGVLENFEEGHKYKEHS  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRN+ PEIMP+LN  FSDP
Sbjct  64   LRKFVRNRKPEIMPALNSFFSDP  86



>gb|AGC24177.1| unknown [Rehmannia glutinosa]
Length=93

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q IRNI  N  VRV KE RAAGV +++ EG+KY EH+
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLIRNITINPEVRVTKENRAAGVLDDFAEGEKYAEHA  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRN+SPEIMPSLN  F+DP+
Sbjct  69   LRKYVRNRSPEIMPSLNSFFTDPK  92



>ref|XP_004501964.1| PREDICTED: uncharacterized protein LOC101508877 [Cicer arietinum]
Length=89

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRVNK+ RAAGV EN+ EG+KY EH 
Sbjct  4    RWVRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKQTRAAGVLENFSEGEKYTEHL  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KF RN+SPEIMP++N  F+DP RN
Sbjct  64   LRKFSRNRSPEIMPTINSFFTDPSRN  89



>ref|XP_010100274.1| hypothetical protein L484_027580 [Morus notabilis]
 gb|EXB82408.1| hypothetical protein L484_027580 [Morus notabilis]
Length=92

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q IRNI  N  VRV KE RAAG+ +N+EEG++Y +HS
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLIRNITTNPEVRVTKENRAAGILDNFEEGERYSQHS  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRNKSP+IMP+LN  FSDP
Sbjct  69   LRKFVRNKSPQIMPNLNNFFSDP  91



>ref|XP_006357136.1| PREDICTED: uncharacterized protein LOC102583994 [Solanum tuberosum]
Length=91

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RN+  N  VRV KE RAAGV EN+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVTKENRAAGVLENFSEGEKYAEHT  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+SPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNRSPEIMPSINGFFSDPK  91



>ref|XP_010027794.1| PREDICTED: uncharacterized protein LOC104418219 [Eucalyptus grandis]
 gb|KCW83389.1| hypothetical protein EUGRSUZ_B00324 [Eucalyptus grandis]
Length=90

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+GVAVG CGF  +R+I  N  VRV KE RAAGV +N++EG+KY EHS
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYTEHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRN+SPEIMPSLN  F+ P RN
Sbjct  65   LRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_010027818.1| PREDICTED: uncharacterized protein LOC104418237 [Eucalyptus grandis]
 gb|KCW83385.1| hypothetical protein EUGRSUZ_B00320 [Eucalyptus grandis]
Length=90

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+GVAVG CGF  +R+I  N  VRV KE RAAGV +N++EG+KY EHS
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGFSLVRHICINPEVRVTKENRAAGVLDNFKEGEKYAEHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRN+SPEIMPSLN  F+ P RN
Sbjct  65   LRKFVRNRSPEIMPSLNSFFTSPDRN  90



>ref|XP_009385140.1| PREDICTED: uncharacterized protein LOC103972508 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RP+VYP FAA+GVAVG CG Q +RNI  N  VRVNK+ RAAGV EN+ EG+KY EHS
Sbjct  8    RWLRPDVYPLFAAVGVAVGICGVQLVRNISTNPQVRVNKQNRAAGVLENFGEGEKYAEHS  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+PEIMP++N+ FSDP+
Sbjct  68   LRKFVRNKAPEIMPAVNKFFSDPK  91



>ref|XP_009760043.1| PREDICTED: uncharacterized protein LOC104212451 [Nicotiana sylvestris]
Length=92

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHA  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  FSDP+
Sbjct  69   LRKFVRNRAPEIMPSINGFFSDPK  92



>ref|XP_009615457.1| PREDICTED: uncharacterized protein LOC104108174 [Nicotiana tomentosiformis]
Length=91

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKSPEIMPS+N  FSDP+
Sbjct  68   LRKFVRNKSPEIMPSINGFFSDPK  91



>ref|XP_006338509.1| PREDICTED: uncharacterized protein LOC102603775 [Solanum tuberosum]
Length=91

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKSPEIMPS+N  FSDP 
Sbjct  68   LRKFVRNKSPEIMPSINGFFSDPN  91



>ref|XP_010678668.1| PREDICTED: uncharacterized protein LOC104894188 [Beta vulgaris 
subsp. vulgaris]
Length=91

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV+KE RAAGV EN+ EG+KY EH 
Sbjct  6    RWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHF  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRNK+PEIMPS+N  F+DP RN
Sbjct  66   LRKYVRNKTPEIMPSINSFFADPTRN  91



>ref|XP_003527039.1| PREDICTED: uncharacterized protein LOC100499787 [Glycine max]
 gb|KHN19346.1| hypothetical protein glysoja_012266 [Glycine soja]
Length=89

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  414  WIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSL  235
            W+RPEVYP FAA+G AVG CGFQ +RNI  N  VRVNKEGR AGV EN+ EG+KY EH L
Sbjct  5    WLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHFL  64

Query  234  XKFVRNKSPEIMPSLNRXFSDPQRN  160
             K+VRN++PEIMPS+N  F+DP RN
Sbjct  65   RKYVRNRTPEIMPSINSFFADPSRN  89



>ref|XP_010556171.1| PREDICTED: uncharacterized protein LOC104825524 [Tarenaya hassleriana]
Length=88

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA++GVAVG CG Q +RNI  N  VRV KE RAAG+ EN+EEG+KY EH 
Sbjct  5    RWIRPEVYPLFASVGVAVGICGMQLVRNICSNPEVRVTKENRAAGILENFEEGEKYKEHR  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVR+KSPEIMPS+N  FSDPQ
Sbjct  65   LRKFVRSKSPEIMPSINSFFSDPQ  88



>ref|XP_010913425.1| PREDICTED: uncharacterized protein LOC105039118 [Elaeis guineensis]
Length=92

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KEGRAAGV ENY EG+KY EH 
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKEGRAAGVLENYAEGEKYAEHG  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R ++PEIMPS+NR F++P+
Sbjct  69   LRKFLRTRAPEIMPSINRFFANPK  92



>ref|XP_007226455.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
 gb|EMJ27654.1| hypothetical protein PRUPE_ppa024551mg [Prunus persica]
Length=91

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+G AVG CG Q +RNI  N  VRVNKE RAAGV +N+ EG++Y EH 
Sbjct  5    RWLKPEVYPLFAAVGAAVGICGMQLVRNIYTNPDVRVNKENRAAGVLDNHAEGERYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK+P+IMP++N+ FSDPQ
Sbjct  65   LRKYVRNKTPQIMPTINKFFSDPQ  88



>gb|KHG26447.1| Uncharacterized protein F383_04740 [Gossypium arboreum]
 gb|KJB07848.1| hypothetical protein B456_001G047700 [Gossypium raimondii]
Length=87

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV KE RAAGV +N+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYSEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK+PEIMPS+N  F+DP+
Sbjct  64   LRKYVRNKTPEIMPSINSFFTDPK  87



>ref|XP_006845122.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
 gb|ERN06797.1| hypothetical protein AMTR_s00005p00190110 [Amborella trichopoda]
Length=91

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FA +G AVG CG Q +RNI  N  VRV KE R+AGV EN+ EG++Y +HS
Sbjct  8    RWLRPEVYPIFAVVGTAVGICGLQLVRNIRTNPDVRVTKEKRSAGVLENFAEGERYAQHS  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKSPEIMPS+N+ F+DP+
Sbjct  68   LRKFVRNKSPEIMPSINKFFTDPK  91



>ref|NP_001148351.1| LOC100281961 [Zea mays]
 gb|ACG30961.1| B12D protein [Zea mays]
 gb|AFW85170.1| b12D protein [Zea mays]
Length=87

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H 
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FV +K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTDPK  87



>ref|XP_003523058.1| PREDICTED: uncharacterized protein LOC100500534 [Glycine max]
Length=89

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG CGFQ +RNI  N  VRVNKEGR AGV EN+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKEGRKAGVLENFAEGEKYAEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRN++PEIMPS+N  F+D  RN
Sbjct  64   LRKYVRNRTPEIMPSINSFFADTSRN  89



>ref|XP_008222037.1| PREDICTED: uncharacterized protein LOC103321965 [Prunus mume]
Length=91

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP F A+GVAVG CG Q +RNI  N  VRVNKE RAAGV +N+ EG++Y EH 
Sbjct  5    RWLKPEVYPLFVAVGVAVGICGMQLVRNIYTNPEVRVNKEKRAAGVLDNHAEGERYAEHR  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK+P+IMP++N+ FSDPQ
Sbjct  65   LRKYVRNKTPQIMPTINKFFSDPQ  88



>ref|XP_010272106.1| PREDICTED: uncharacterized protein LOC104607987 [Nelumbo nucifera]
Length=90

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KE RAAGV EN+ EG+KY EH+
Sbjct  7    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRAAGVLENFSEGEKYAEHT  66

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  F++P+
Sbjct  67   LRKFVRNRTPEIMPSINNFFTNPK  90



>ref|XP_009771458.1| PREDICTED: uncharacterized protein LOC104221988 [Nicotiana sylvestris]
Length=91

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICGNPEVRVTKENRAAGVLDNFSEGEKYAEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKSPEIMP++N  FSDP+
Sbjct  68   LRKFVRNKSPEIMPNINGFFSDPK  91



>ref|XP_011098540.1| PREDICTED: uncharacterized protein LOC105177185 [Sesamum indicum]
Length=93

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLDNFAEGEKYAEHA  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  F+DP+
Sbjct  69   LRKFVRNRAPEIMPSINSFFTDPK  92



>ref|XP_011085792.1| PREDICTED: uncharacterized protein LOC105167687 [Sesamum indicum]
Length=93

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV EN+ EG+KY EH+
Sbjct  9    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVTKENRAAGVLENFAEGEKYAEHA  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  F+DP+
Sbjct  69   LRKFVRNRAPEIMPSINSFFTDPK  92



>gb|AEC10990.1| b12d-like protein [Camellia sinensis]
Length=91

 Score =   105 bits (263),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRVNKE  AAGV +N+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVNKEKGAAGVLDNHAEGEKYAEHF  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + KFVRNKSPEIMP++N+ F+DP+
Sbjct  68   VRKFVRNKSPEIMPAVNKFFTDPK  91



>ref|XP_002438146.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
 gb|EER89513.1| hypothetical protein SORBIDRAFT_10g008810 [Sorghum bicolor]
Length=87

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H 
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FV  K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHEKTPEIMPAINKFFTDPK  87



>ref|XP_002511469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52071.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAAMGVAVG C FQ +RNI  N  VRVNK+ RAAGV EN++EG+KY E+ 
Sbjct  5    RWIRPEVYPLFAAMGVAVGICSFQLVRNICINPEVRVNKQNRAAGVLENFKEGEKYSENF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRNK+PEIMPS+NR F++P
Sbjct  65   LRKFVRNKTPEIMPSINRFFTEP  87



>ref|XP_010111964.1| hypothetical protein L484_004741 [Morus notabilis]
 gb|EXC32238.1| hypothetical protein L484_004741 [Morus notabilis]
Length=93

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP FAA+GVA+G CGFQ +RNI  N  VRV+KE RAAGV +N+ EG+KY EH 
Sbjct  8    KWLRPEVYPLFAAVGVAIGICGFQLVRNICINPEVRVSKETRAAGVLDNFAEGEKYSEHF  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRN++PEIMPS+N  F+DP R+
Sbjct  68   LRKYVRNRAPEIMPSINSFFTDPNRS  93



>gb|ADB08699.1| B12D-like protein [Wolffia arrhiza]
 gb|AEI83500.1| B12D [Wolffia arrhiza]
 gb|AEQ39050.1| putative B12D-like protein [Wolffia arrhiza]
Length=91

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RN+  N  VRV+KEGRA+GV EN+ EG++Y EHS
Sbjct  8    RWVRPEVYPLFAAVGVAVGICGFQLVRNVCINPEVRVSKEGRASGVLENFAEGERYAEHS  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+RNK PEIMPS+N  F++P+
Sbjct  68   LRKFLRNKRPEIMPSINGFFANPK  91



>ref|XP_004232259.1| PREDICTED: uncharacterized protein LOC101265497 [Solanum lycopersicum]
Length=91

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFSEGEKYSEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKSPEIMPS+N  FS+P 
Sbjct  68   LRKFVRNKSPEIMPSINGFFSNPN  91



>ref|XP_009403647.1| PREDICTED: uncharacterized protein LOC103987158 [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEV+P FAA+G AVG CG Q IRNI  N  VRV KE RAAGV +N++EG+KY EH 
Sbjct  5    RWVRPEVFPLFAAVGTAVGICGMQLIRNICINPEVRVTKENRAAGVLDNFQEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRNKSP+IMPSLN  FSDP
Sbjct  65   LRKFVRNKSPQIMPSLNNYFSDP  87



>ref|NP_001057280.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|AAB65433.1| HvB12D homolog [Oryza sativa]
 gb|AAL76334.1| putative G-box binding protein [Oryza sativa]
 dbj|BAD45657.1| G-box binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF19194.1| Os06g0246000 [Oryza sativa Japonica Group]
 gb|ABR25364.1| senescence associated protein [Oryza sativa Indica Group]
 gb|ACJ54927.1| G-box binding protein [Oryza sativa Japonica Group]
 dbj|BAG94133.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99740.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00561.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80316.1| hypothetical protein OsI_22358 [Oryza sativa Indica Group]
 gb|EEE65438.1| hypothetical protein OsJ_20800 [Oryza sativa Japonica Group]
Length=89

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y EH 
Sbjct  5    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
            L  +VR+K+PEIMP++N+ F++P +
Sbjct  65   LRNYVRDKTPEIMPAINKFFTEPTK  89



>gb|ACU15648.1| unknown [Glycine max]
Length=89

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG CGFQ +R+I  N  VRVNKEGR AGV EN+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRSICINPEVRVNKEGRKAGVLENFAEGEKYAEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRN++PEIMPS+N  F+D  RN
Sbjct  64   LRKYVRNRTPEIMPSINSFFADTSRN  89



>gb|AFO59572.1| B12D like protein [Saccharum hybrid cultivar GT28]
 gb|AHB79077.1| B12D-like protein [Saccharum hybrid cultivar]
Length=87

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H 
Sbjct  4    RWVRPEVYPLFAAMGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FV +K+PEIMP++N+ F++P+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTEPK  87



>ref|XP_010511712.1| PREDICTED: uncharacterized protein LOC104787778 [Camelina sativa]
Length=89

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE R AG+ +N+ EG++Y EH 
Sbjct  5    RWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILDNHAEGERYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_008792162.1| PREDICTED: uncharacterized protein LOC103708847 [Phoenix dactylifera]
Length=91

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG C  Q IRNI  N  VRV KE RAAGV +N+ EG+KY EH 
Sbjct  8    RWLRPEVYPLFAAVGTAVGICCMQLIRNITTNPEVRVTKENRAAGVLDNFSEGEKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+RNK+PEIMPSLN+ FSDP 
Sbjct  68   LRKFLRNKNPEIMPSLNKFFSDPN  91



>emb|CAK22419.1| B12D-like protein [Beta vulgaris]
Length=91

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV+KE RAAGV EN+ EG+KY EH 
Sbjct  6    RWVRPEVYPLFAAVGVAVGICGVQLVRNICINPEVRVSKENRAAGVLENFSEGEKYAEHF  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRNK+PEIMPS+N  F+D  RN
Sbjct  66   LRKYVRNKTPEIMPSINSFFADSTRN  91



>ref|XP_004236155.1| PREDICTED: uncharacterized protein LOC101260417 [Solanum lycopersicum]
Length=90

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVA+G CG Q +RN+  N  VRVNKE RAAG+ EN+EEG+KY EH+
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHA  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            + KF R++ PEI P+LNR FSDPQ+N
Sbjct  65   IRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|XP_009588369.1| PREDICTED: uncharacterized protein LOC104085953 [Nicotiana tomentosiformis]
Length=92

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP F A+GVA G CGFQ +RNI  N  VRV KE RAAGV +N+ EG+KY EH+
Sbjct  9    RWLRPEVYPLFVAVGVAFGICGFQLVRNICINPEVRVTKENRAAGVLDNFTEGEKYAEHA  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  FSDP+
Sbjct  69   LRKFVRNRAPEIMPSINGFFSDPK  92



>ref|XP_009785405.1| PREDICTED: uncharacterized protein LOC104233674 [Nicotiana sylvestris]
Length=90

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVA+G CG Q +RN+  N  VRV+KE RAAGV +N+EEG+KY EH+
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLDNFEEGQKYAEHA  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            + KF R++ PEI PSLNR FSDPQ+N
Sbjct  65   VRKFARSRPPEIFPSLNRFFSDPQKN  90



>ref|XP_011042649.1| PREDICTED: uncharacterized protein LOC105138299 [Populus euphratica]
Length=90

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ  RNI  N  VRV K+ RAAGV EN+ EG+KY EH 
Sbjct  5    RWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLENFSEGEKYSEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K VRN+SPEIMPS+N  F+DP+ N
Sbjct  65   LRKLVRNRSPEIMPSINNFFTDPKLN  90



>gb|ACJ84101.1| unknown [Medicago truncatula]
 gb|AFK34497.1| unknown [Medicago truncatula]
 gb|KEH35090.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=90

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+G AVG C F  +RNI  N  VRVNK+ RAAGV EN+ EG+KY EH 
Sbjct  5    RWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHL  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KF RN+SPEIMP LN  F+DP RN
Sbjct  65   LRKFSRNRSPEIMPGLNSFFTDPSRN  90



>ref|XP_010470676.1| PREDICTED: uncharacterized protein LOC104750563 [Camelina sativa]
Length=134

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+GVAVG CG Q +RNI  N  VRV KE R AG+ EN+ EG++Y EH 
Sbjct  50   RWIRPEVYPLFAAVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHG  109

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP+
Sbjct  110  LRKFVRNKAPQIMPSINGFFSDPK  133



>ref|NP_001152717.1| LOC100286358 [Zea mays]
 gb|ACG30827.1| B12D protein [Zea mays]
 gb|ACG49122.1| B12D protein [Zea mays]
 gb|AFW76867.1| b12D protein [Zea mays]
Length=87

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H 
Sbjct  4    RWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FV +K+PEIMP++N+ F+DP+
Sbjct  64   LRSFVHDKTPEIMPAVNKFFTDPK  87



>ref|XP_006344997.1| PREDICTED: uncharacterized protein LOC102605944 [Solanum tuberosum]
Length=90

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVA+G CG Q +RN+  N  VRVNKE RAAG+ EN+EEG+KY EH+
Sbjct  5    RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVNKEKRAAGILENFEEGEKYAEHA  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            + KF R++ PEI P+LNR FSDPQ+N
Sbjct  65   VRKFARSRPPEIFPNLNRFFSDPQKN  90



>ref|XP_009627555.1| PREDICTED: uncharacterized protein LOC104118078 [Nicotiana tomentosiformis]
Length=149

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVA+G CG Q +RN+  N  VRV+KE RAAGV EN+EEG+KY EH+
Sbjct  64   RWLRPEVYPLFAAVGVAIGICGLQLVRNMRINPEVRVSKEKRAAGVLENFEEGEKYAEHA  123

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            + KF R++ PEI PSLNR FSDPQ+N
Sbjct  124  VRKFARSRPPEIFPSLNRFFSDPQKN  149



>ref|XP_010546014.1| PREDICTED: uncharacterized protein LOC104818223 [Tarenaya hassleriana]
Length=88

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG CGFQ +RNI  N  VRV+KE RAAGV EN+ EG++Y EH 
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVSKENRAAGVLENFAEGERYAEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + +FVRNK PEIMPS+N+ F+DP+
Sbjct  64   VRRFVRNKDPEIMPSINKFFTDPK  87



>emb|CDP02170.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q IRNI  N  VRV KE RAAGV EN+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGAQLIRNICINPEVRVTKENRAAGVLENHAEGEKYAEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++P+IMPS+N  FS PQ
Sbjct  68   LRKFVRNRAPQIMPSVNNFFSKPQ  91



>ref|XP_010415343.1| PREDICTED: uncharacterized protein LOC104701372 [Camelina sativa]
Length=89

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA +GVAVG CG Q +RNI  N  VRV KE R AG+ EN+ EG++Y EH 
Sbjct  5    RWIRPEVYPLFATVGVAVGICGMQLVRNISTNPEVRVTKENRTAGILENHAEGERYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKAPQIMPSINGFFSDPK  88



>ref|XP_007209803.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
 gb|EMJ11002.1| hypothetical protein PRUPE_ppa014036mg [Prunus persica]
Length=90

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG CG    R+I  N  VRV+KE RAAG+ EN++EG+KY EH 
Sbjct  5    RWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNKSPEIMPS+N  F+DP RN
Sbjct  65   LRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_008800943.1| PREDICTED: uncharacterized protein LOC103715180 [Phoenix dactylifera]
Length=121

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+GVAVG CG Q +RNI  N  VRV K+ RAAGV +N+ EG+KY EH 
Sbjct  38   RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHG  97

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KF+RNKSPEIMPS+N+ FS+P
Sbjct  98   LRKFIRNKSPEIMPSVNKFFSNP  120



>ref|XP_002270661.1| PREDICTED: uncharacterized protein LOC100259604 [Vitis vinifera]
 emb|CBI27548.3| unnamed protein product [Vitis vinifera]
Length=93

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRV K+ R AGV EN+EEG++Y EH 
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGMQLVRNICTNPEVRVTKQNRTAGVLENFEEGERYAEHR  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRNK P+IMPS+N+ FSDP
Sbjct  68   LRKFVRNKEPQIMPSINKFFSDP  90



>emb|CDP14927.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVA+G CGF  +RNI  N  VRV K+ RAAGV EN+ EG+KY EH+
Sbjct  8    RWLRPEVYPLFAAVGVAIGICGFSLVRNICINPEVRVAKQDRAAGVLENFAEGEKYAEHA  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K+VRN+ PEIMPS+N  F++P++N
Sbjct  68   LRKYVRNRKPEIMPSINSFFTEPEKN  93



>gb|AFK33307.1| unknown [Medicago truncatula]
Length=90

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA+G AVG C F  +RNI  N  VRVNK+ RAAGV EN+ EG+KY EH 
Sbjct  5    RWIRPEVYPLFAAVGAAVGICAFSLVRNICINPEVRVNKQSRAAGVLENFAEGEKYTEHL  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L +F RN+SPEIMP LN  F+DP RN
Sbjct  65   LRRFSRNRSPEIMPGLNSFFTDPSRN  90



>ref|XP_002318014.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK94203.1| unknown [Populus trichocarpa]
 gb|EEE96234.1| senescence-associated family protein [Populus trichocarpa]
Length=90

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ  RNI  N  VRV K+ RAAGV +N+ EG+KY EH 
Sbjct  5    RWLRPEVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K VRN+SP+IMPS+N  F+DP+ N
Sbjct  65   LRKLVRNRSPQIMPSINNFFTDPKLN  90



>ref|XP_010550670.1| PREDICTED: uncharacterized protein LOC104821467 [Tarenaya hassleriana]
Length=86

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG CGFQ +RNI  N  VRVNKE RAAGV +N+ EG++Y EH 
Sbjct  4    RWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNFAEGERYAEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KFVRNK PEIMPS+N+ F++
Sbjct  64   LRKFVRNKGPEIMPSINKFFTE  85



>ref|XP_004965125.1| PREDICTED: uncharacterized protein LOC101762161 [Setaria italica]
Length=87

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H 
Sbjct  4    RWVRPEVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FV +K+PEIMP++N+ F++P+
Sbjct  64   LRSFVHDKTPEIMPAINKFFTEPK  87



>ref|XP_006439727.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 ref|XP_006476687.1| PREDICTED: uncharacterized protein LOC102617192 [Citrus sinensis]
 gb|ESR52967.1| hypothetical protein CICLE_v10023087mg [Citrus clementina]
 gb|KDO69809.1| hypothetical protein CISIN_1g034649mg [Citrus sinensis]
Length=88

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FAA+GVAVG CG Q +RNI  N  VRV K+ RAAGV ENY EG+KY EH 
Sbjct  5    RWIRPEVFPLFAAVGVAVGICGMQLVRNICINPEVRVTKQNRAAGVLENYAEGEKYSEHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK+PEIMP +N  F+DPQ
Sbjct  65   LRKYVRNKTPEIMPKINSFFTDPQ  88



>ref|XP_010255359.1| PREDICTED: uncharacterized protein LOC104596051 [Nelumbo nucifera]
Length=90

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  VRV+KE R AGV EN+ EG+KY EH+
Sbjct  7    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRVSKETRTAGVLENFAEGEKYAEHT  66

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN++PEIMPS+N  F++ +
Sbjct  67   LRKFVRNRTPEIMPSINNFFTNQK  90



>ref|XP_004502329.1| PREDICTED: uncharacterized protein LOC101491577 [Cicer arietinum]
Length=88

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG CG Q +RNI  N  VRV K+ RAAGV +N+ EG+KY +H+
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLVRNITGNPDVRVTKQNRAAGVLDNFSEGEKYSQHT  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNKS +IMPS+N  FSDP+
Sbjct  65   LRKFVRNKSSQIMPSVNNFFSDPK  88



>ref|XP_008340166.1| PREDICTED: uncharacterized protein LOC103403120 [Malus domestica]
 ref|XP_008361836.1| PREDICTED: uncharacterized protein LOC103425520 [Malus domestica]
Length=92

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FAA+GVAVG CG Q +RNI  N  VRV K+ R AGV EN+EEG++Y EH 
Sbjct  6    RWIRPEVFPLFAAVGVAVGICGMQLVRNITSNPEVRVTKQNRTAGVLENHEEGERYAEHG  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VR ++P+IMPS+N+ FSDPQ
Sbjct  66   LRKYVRTRAPQIMPSINKYFSDPQ  89



>ref|XP_010930055.1| PREDICTED: uncharacterized protein LOC105051361 [Elaeis guineensis]
Length=91

 Score =   102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+G AVG C  Q +RNI  N  VRV KE RAAGV EN+ EG++Y EH 
Sbjct  8    RWLRPEVYPLFAAVGTAVGICCMQLVRNITTNPEVRVTKENRAAGVLENFSEGERYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KF+R+K+PEIMPSLN+ FSDP
Sbjct  68   LRKFLRSKNPEIMPSLNKFFSDP  90



>ref|XP_010942172.1| PREDICTED: uncharacterized protein LOC105060250 isoform X1 [Elaeis 
guineensis]
Length=105

 Score =   102 bits (253),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 71/98 (72%), Gaps = 14/98 (14%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXV--------------RVNKEGRAAGV  280
            RW+RPEVYP FAA+GVAVG CGFQ +RNI  N  V              RV+KEGRAAGV
Sbjct  8    RWLRPEVYPLFAAVGVAVGICGFQLVRNICINPEVRYGDVLFHTYGDFTRVSKEGRAAGV  67

Query  279  xenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
             ENY EG+KY EH L +FVRNK+PEIMPS+NR F+DP+
Sbjct  68   LENYAEGQKYAEHGLRRFVRNKAPEIMPSINRFFADPK  105



>ref|XP_006655963.1| PREDICTED: uncharacterized protein LOC102707968 [Oryza brachyantha]
Length=88

 Score =   101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAAMGVAV  CG Q  RNI  N  VRVNK GRAAGV EN+EEG++Y EH 
Sbjct  5    RWVRPEVYPLFAAMGVAVAICGMQLFRNITGNPEVRVNKVGRAAGVLENHEEGRRYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FVR+K+PEIMP++N+ F++P+
Sbjct  65   LRNFVRDKTPEIMPTINKFFTEPK  88



>ref|XP_007036078.1| B12D protein [Theobroma cacao]
 gb|EOY20579.1| B12D protein [Theobroma cacao]
Length=87

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+ VAVG CG Q +RNI  N  VRVNKE RAAGV +N+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVSVAVGICGLQLVRNICINPEVRVNKENRAAGVLDNFAEGEKYAEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + K+VRN++PEIMPS+N  F+DP+
Sbjct  64   VRKYVRNRAPEIMPSINSFFTDPK  87



>ref|XP_008374479.1| PREDICTED: uncharacterized protein LOC103437758 [Malus domestica]
Length=90

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG CG    R+I  N  VRV KE RAAGV +N+ EG+KY EH 
Sbjct  5    RWLRPEVYPLFAATGVAVGICGLSLFRHITINPEVRVTKENRAAGVLDNHAEGEKYKEHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNK+PEIMP +N  F+DP +N
Sbjct  65   LRKFVRNKAPEIMPGINAFFTDPSKN  90



>ref|XP_008239697.1| PREDICTED: uncharacterized protein LOC103338283 [Prunus mume]
Length=90

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAV  CG    R+I  N  VRV+KE RAAG+ EN++EG+KY EH 
Sbjct  5    RWLRPEVYPLFAATGVAVAICGLSLFRHITINPEVRVSKENRAAGILENFDEGEKYKEHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRNKSPEIMPS+N  F+DP RN
Sbjct  65   LRKFVRNKSPEIMPSVNGFFTDPSRN  90



>ref|XP_003551877.1| PREDICTED: uncharacterized protein LOC100500344 [Glycine max]
 gb|KHN24095.1| hypothetical protein glysoja_025268 [Glycine soja]
Length=89

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+GVAVG CG Q +RNI  N  VRV K+ RAAG+ EN+ EG+KY +HS
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_002515002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47556.1| conserved hypothetical protein [Ricinus communis]
Length=93

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG++Y EH 
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLVRNICTNPEVRVTKENRAAGVLDNFAEGERYKEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+SP+IMPSLN  FS+P 
Sbjct  65   LRKFVRNRSPQIMPSLNGFFSEPD  88



>ref|XP_003564009.1| PREDICTED: uncharacterized protein LOC100821381 [Brachypodium 
distachyon]
Length=88

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP FAA GVAVG C FQ +RNI  N  VRV+K GRAAGV +N+EEG++Y EH 
Sbjct  5    KWVRPEVYPLFAATGVAVGICAFQLLRNITGNPEVRVSKVGRAAGVLDNHEEGRRYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  FVR+K+PEIMP +N+ F+DP+
Sbjct  65   LRSFVRDKTPEIMPGINKFFTDPK  88



>ref|XP_006404294.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
 gb|ESQ45747.1| hypothetical protein EUTSA_v10010862mg [Eutrema salsugineum]
Length=88

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG CGF  IRNI  N  VRV KE RAAGV +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICGFSLIRNITGNPEVRVTKENRAAGVLDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_010907762.1| PREDICTED: uncharacterized protein LOC105034337 [Elaeis guineensis]
Length=91

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AA+GVAVG CG Q +RNI  N  VRV K+ RAAGV +N+ EG+KY EH 
Sbjct  8    RWLKPEVYPLLAAVGVAVGMCGMQLVRNITTNPEVRVTKQNRAAGVLDNFAEGEKYAEHG  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KF+RNK+PEIMPS+N+ FS P
Sbjct  68   LRKFLRNKAPEIMPSVNKFFSSP  90



>ref|XP_002311729.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
 gb|EEE89096.1| hypothetical protein POPTR_0008s17950g [Populus trichocarpa]
Length=92

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG+KY EH 
Sbjct  5    RWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP 
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPD  88



>ref|XP_010692143.1| PREDICTED: uncharacterized protein LOC104905334 [Beta vulgaris 
subsp. vulgaris]
Length=89

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP F A+G AVG CGFQ +RNI  N  VRVNKE RAAGV +N++EG+KY EH 
Sbjct  6    RWVRPEVYPLFVAVGAAVGICGFQLVRNICINPEVRVNKENRAAGVLDNHKEGEKYAEHF  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + KF R +S EIMP LN+ FSDPQ
Sbjct  66   IRKFSRTQSAEIMPGLNKFFSDPQ  89



>gb|ACU15396.1| unknown [Glycine max]
Length=89

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+GVAVG CG Q +RNI  N  VRV K+ RAAG+ EN+ EG+KY +HS
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFAEGEKYSQHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K P++MPS+N  FSDP
Sbjct  65   LRKYVRGKQPQVMPSVNNFFSDP  87



>ref|XP_011029641.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
 ref|XP_011029642.1| PREDICTED: uncharacterized protein LOC105129336 [Populus euphratica]
Length=92

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG+KY EH 
Sbjct  5    RWIRPEVFPLFASVGVAVGICAMQLVRNICTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP 
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPD  88



>gb|KDP26755.1| hypothetical protein JCGZ_17913 [Jatropha curcas]
Length=93

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FAA+GVAVG CG Q +RNI  N  VRV KE RAAGV +N+ EG+KY EH 
Sbjct  5    RWIRPEVFPLFAAVGVAVGICGMQLVRNICINPDVRVTKEKRAAGVLDNFAEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVR K P+IMPS+N  FSDP 
Sbjct  65   LRKFVRKKQPQIMPSINGFFSDPD  88



>gb|KHG12689.1| Uncharacterized protein F383_19724 [Gossypium arboreum]
Length=89

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FA++GVAVG C  Q +RNI  N  VRV KE RAAGV  N+EEG+KY EH 
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLNNFEEGEKYAEHG  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+ P+IMPS+N  FSDP+
Sbjct  66   LRKFVRNRQPQIMPSVNNFFSDPK  89



>gb|KJB30971.1| hypothetical protein B456_005G172200 [Gossypium raimondii]
Length=89

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FA++GVAVG C  Q +RNI  N  VRV KE RAAGV  N+EEG+KY EH 
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPDVRVTKENRAAGVLNNFEEGEKYAEHG  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRN+ P+IMPS+N  FSDP+
Sbjct  66   LRKFVRNRQPQIMPSVNNFFSDPK  89



>gb|AFK42697.1| unknown [Lotus japonicus]
Length=89

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +RNI  N  VRVNK+ RAAGV +N+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFAAVGVAVGICGMQLVRNICINPEVRVNKQNRAAGVLDNFSEGEKYTEHF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            + KF R  S EIMPS+N  F+DP RN
Sbjct  64   IRKFARTSSREIMPSINSFFADPSRN  89



>ref|XP_007163724.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
 gb|ESW35718.1| hypothetical protein PHAVU_001G258900g [Phaseolus vulgaris]
Length=89

 Score = 99.0 bits (245),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+GVAVG CG Q +RNI  N  VRV K+ RAAG+ EN+EEG+KY EHS
Sbjct  5    RWLKPEVYPLFAAVGVAVGICGMQLVRNITTNPEVRVTKQNRAAGILENFEEGEKYSEHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K+P+IMPS+N  FS+P
Sbjct  65   LRKYVRGKNPQIMPSVNNFFSEP  87



>ref|XP_011042304.1| PREDICTED: uncharacterized protein LOC105138023 [Populus euphratica]
Length=92

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG CG Q +RNI  N  VRV KE RAAGV +N++EG+KY EH 
Sbjct  5    RWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VR ++P+IMPS+N  FSDP 
Sbjct  65   LRKYVRKRTPQIMPSINGFFSDPD  88



>ref|XP_006391239.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
 gb|ESQ28525.1| hypothetical protein EUTSA_v10019446mg [Eutrema salsugineum]
Length=89

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA++GVAVG C  Q +RNI  N  VRV K+ R AGV +N+ EG+KY EH 
Sbjct  5    RWIRPEVYPLFASVGVAVGICVMQLVRNISTNPEVRVTKQNRIAGVLDNFAEGEKYAEHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK+P+IMPS+N  FSDP+
Sbjct  65   LRKFVRNKTPQIMPSINGFFSDPK  88



>gb|KFK34105.1| b12d protein [Arabis alpina]
Length=90

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VRV+KE RAAG+ +N+ EG+KY E+ 
Sbjct  6    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRVSKENRAAGILDNHAEGEKYKENF  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK PEIMP +N+ F+DP 
Sbjct  66   LRKFVRNKHPEIMPGINKFFTDPT  89



>ref|XP_003538567.1| PREDICTED: uncharacterized protein LOC100527541 [Glycine max]
Length=89

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FA++GVAVG CG Q +RNI  N  VRV K+ R AG+ EN+ EG+KY +HS
Sbjct  5    RWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_002875880.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52139.1| hypothetical protein ARALYDRAFT_485174 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK PEIMP LN+ F+DP 
Sbjct  64   LRKFVRNKKPEIMPGLNKFFTDPT  87



>ref|NP_190397.1| B12D protein [Arabidopsis thaliana]
 pir||T13003 hypothetical protein T24C20.20 - Arabidopsis thaliana
 emb|CAB51061.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAL91215.1| B12D-like protein [Arabidopsis thaliana]
 gb|AAN65070.1| B12D-like protein [Arabidopsis thaliana]
 dbj|BAH19734.1| AT3G48140 [Arabidopsis thaliana]
 gb|AEE78372.1| B12D protein [Arabidopsis thaliana]
Length=88

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK PEIMP LN+ F+DP 
Sbjct  64   LRKFVRNKKPEIMPGLNKFFTDPT  87



>ref|XP_008351806.1| PREDICTED: uncharacterized protein LOC103415246 [Malus domestica]
Length=90

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVA+G CG    R+I  N  VRVNKE RAAGV +N+ EG+KY E+ 
Sbjct  5    RWLRPEVYPLFAATGVAIGICGLSLFRHITINPEVRVNKENRAAGVLDNHAEGEKYKENF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVRN++PEIMP++N  F+DP+ N
Sbjct  65   LRKFVRNRAPEIMPAINGFFTDPKNN  90



>gb|KCW61991.1| hypothetical protein EUGRSUZ_H04674, partial [Eucalyptus grandis]
Length=135

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FAA+GVAVG CG Q IRNI  N  VRV KE RAAGV +N+ EG+KY +H 
Sbjct  52   RWIRPEVFPLFAAVGVAVGICGMQLIRNICTNPEVRVTKEKRAAGVLDNFAEGEKYSQHV  111

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + +FVRN+ P++MPS+N  FSDP+
Sbjct  112  VRRFVRNRPPQVMPSINNFFSDPK  135



>ref|XP_010515125.1| PREDICTED: uncharacterized protein LOC104791023 [Camelina sativa]
 ref|XP_010426282.1| PREDICTED: uncharacterized protein LOC104711289 [Camelina sativa]
Length=88

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVRNK PEIMP +N+ F+DP+
Sbjct  64   LRKFVRNKHPEIMPGINKFFTDPK  87



>gb|KHN44408.1| hypothetical protein glysoja_014449 [Glycine soja]
Length=89

 Score = 97.4 bits (241),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FA++GVAVG CG Q +RNI  N  VRV K  R AG+ EN+ EG+KY +HS
Sbjct  5    RWLKPEVYPLFASVGVAVGICGMQLVRNITTNPEVRVTKRNRTAGILENFAEGEKYSQHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>emb|CDY44977.1| BnaCnng12070D [Brassica napus]
Length=88

 Score = 97.1 bits (240),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAGV +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGVLDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>ref|XP_002314553.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
 gb|EEF00724.2| hypothetical protein POPTR_0010s06550g [Populus trichocarpa]
Length=163

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA++GVAVG CG Q +RNI  N  VRV KE RAAGV +N++EG+KY EH 
Sbjct  76   RWIRPEVFPLFASVGVAVGICGMQLLRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHG  135

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VR ++P+IMPS+N  FSDP 
Sbjct  136  LRKYVRKRTPQIMPSINGFFSDPD  159



>ref|XP_009149843.1| PREDICTED: uncharacterized protein LOC103873171 [Brassica rapa]
 emb|CDY36902.1| BnaA06g16870D [Brassica napus]
Length=88

 Score = 96.7 bits (239),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNK PEIMP +N+ F+DP+
Sbjct  64   LRKYVRNKHPEIMPGINKFFTDPK  87



>gb|ACU16637.1| unknown [Glycine max]
Length=89

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  A++GVAVG CG Q +RNI  N  VRV K+ R AG+ EN+ EG+KY +HS
Sbjct  5    RWLKPEVYPLIASVGVAVGICGMQLVRNITTNPEVRVTKQNRTAGILENFAEGEKYSQHS  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L K+VR K P+IMPS+N  FSDP
Sbjct  65   LRKYVRGKQPQIMPSVNNFFSDP  87



>ref|XP_006290288.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
 gb|EOA23186.1| hypothetical protein CARUB_v10018322mg [Capsella rubella]
Length=88

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNFAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KFVR+K PEIMP +N+ F+DP+
Sbjct  64   LRKFVRDKHPEIMPGINKFFTDPK  87



>ref|XP_004310038.1| PREDICTED: uncharacterized protein LOC101295883 [Fragaria vesca 
subsp. vesca]
Length=87

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FAA GVAVG C  Q +RNI  N  VRV KE RAAG+ +N+EEG+KY E++
Sbjct  4    RWIRPEVYPLFAATGVAVGICAMQLVRNITGNPEVRVTKENRAAGILDNFEEGEKYRENA  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + +FVRNK P+IMPS+N  FS+P
Sbjct  64   VRRFVRNKKPQIMPSINNFFSEP  86



>gb|ACG48656.1| B12D protein [Zea mays]
Length=98

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F  M VA+G C +Q +RNI  N  VRV KE RAAGV +N++EG++Y  H 
Sbjct  12   RWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVR K PEIM S+N  F+DP ++
Sbjct  72   LRKFVRGKKPEIMASINSFFADPXKD  97



>ref|XP_004142944.1| PREDICTED: uncharacterized protein LOC101222643 [Cucumis sativus]
 ref|XP_004159555.1| PREDICTED: uncharacterized protein LOC101224466 [Cucumis sativus]
 gb|KGN62359.1| hypothetical protein Csa_2G350420 [Cucumis sativus]
Length=89

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FA++GVAVG C  Q +RNI  N  VRV KE RAAGV +N+EEG+KY EH 
Sbjct  6    RWLKPEVYPLFASVGVAVGICAMQLVRNITTNPEVRVIKERRAAGVLDNFEEGEKYAEHG  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KF+R + P+IMPS+N+ FSDP
Sbjct  66   LRKFLRTRPPQIMPSINKFFSDP  88



>gb|EMT09386.1| hypothetical protein F775_07588 [Aegilops tauschii]
Length=87

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP FAA GVA+G C F  +RNI  N  VRVNK GRAAGV EN+EEG++Y EH 
Sbjct  4    KWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVNKMGRAAGVLENHEEGRRYAEHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  +V++K+PEIMP +N+ F+ P+
Sbjct  64   LRAYVQDKTPEIMPGINKFFTSPK  87



>gb|AFK36649.1| unknown [Lotus japonicus]
Length=88

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEV+P FA +G+AVG CG Q +RNI  N  VRV K+ RAAG+ +N+EEG+KY +H 
Sbjct  5    RWIRPEVFPLFATVGIAVGICGMQLVRNISTNPEVRVTKQNRAAGILDNFEEGEKYSQHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + KFVR K  +IMPS+N+ FSDP
Sbjct  65   VRKFVRGKDTQIMPSINKFFSDP  87



>ref|XP_008651557.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG31473.1| B12D protein [Zea mays]
 tpg|DAA60235.1| TPA: hypothetical protein ZEAMMB73_939997 [Zea mays]
Length=98

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F  M VA+G C +Q +RNI  N  VRV KE RAAGV +N++EG++Y  H 
Sbjct  12   RWIRPEVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVR K PEIM S+N  F+DP ++
Sbjct  72   LRKFVRGKKPEIMASINSFFADPPKD  97



>ref|XP_004504481.1| PREDICTED: uncharacterized protein LOC101503540 [Cicer arietinum]
Length=90

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP FAA+G  VG C  Q +RNI  N  VRVNKE R AGV +N+ EG+ Y EH 
Sbjct  5    RWIKPEVYPLFAAVGAVVGICAMQLVRNISTNPEVRVNKENRLAGVLDNHAEGEAYAEHR  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
              KFVRNK  ++MPS+N  FSDPQ
Sbjct  65   FRKFVRNKPRQVMPSVNNFFSDPQ  88



>ref|XP_009150210.1| PREDICTED: uncharacterized protein LOC103873555 [Brassica rapa]
 emb|CDY21808.1| BnaA06g20770D [Brassica napus]
Length=88

 Score = 94.0 bits (232),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA G AVG C F  IRNI  N  VR  KE RAAG+ +N+ EG+KY E+ 
Sbjct  4    RWLRPEVYPLFAATGAAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENF  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VR+K PEIMP LN+ F+DP 
Sbjct  64   LRKYVRDKRPEIMPGLNKFFTDPT  87



>ref|XP_004299593.1| PREDICTED: uncharacterized protein LOC101301782 [Fragaria vesca 
subsp. vesca]
Length=88

 Score = 94.0 bits (232),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP F A+G AVG CGF  +R++  N  VRV+K  RAAGV +N+ EG+KY EH 
Sbjct  4    RWLRPEVYPLFLAVGAAVGICGFSMVRHMCINPEVRVSKVNRAAGVLDNFAEGEKYQEHM  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
            L KFVRN+SPEIMP +N  F+DP +
Sbjct  64   LRKFVRNRSPEIMPGINSFFADPAK  88



>ref|XP_002459694.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
 gb|EER96215.1| hypothetical protein SORBIDRAFT_02g008930 [Sorghum bicolor]
Length=97

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F  M  A+G C +Q +RNI  N  VRV KE RAAGV +N++EG+KY  H 
Sbjct  11   RWIRPEVYPLFVPMAAALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGEKYAMHG  70

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KFVR K PEIM S+N  F+DP ++
Sbjct  71   LRKFVRGKKPEIMASINSFFADPPKD  96



>gb|ABK24106.1| unknown [Picea sitchensis]
Length=92

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP FAA G+AV  C FQ  RN+  N  VR+ KE RAAG+ +N+EEG+KY EH 
Sbjct  9    RWLRPEAYPIFAATGIAVTMCCFQLSRNLFTNPEVRLLKENRAAGILDNFEEGEKYAEHK  68

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L K+VRNKSPEIMPS+N+ F++ +
Sbjct  69   LRKYVRNKSPEIMPSINKYFTESK  92



>emb|CAA54065.1| HvB12D [Hordeum vulgare subsp. vulgare]
 emb|CAA70936.1| B12Dg1 [Hordeum vulgare subsp. vulgare]
Length=87

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP FAA GVA+G C F  +RNI  N  VRV+K GRAAGV EN+EEG++Y EH 
Sbjct  4    KWVRPEVYPLFAATGVAIGICAFSLLRNITGNPEVRVSKMGRAAGVLENHEEGRRYAEHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L  +V++K+PEIMP +N+ F+ P+
Sbjct  64   LRAYVQDKTPEIMPGINKFFTSPK  87



>gb|KEH20547.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=91

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +WI+PEVYP FAA+G  VG C  Q +RNI  N  VRVNK+ R AGV EN+ EG+ Y EH 
Sbjct  5    KWIKPEVYPLFAAVGTVVGICAMQLVRNICTNPEVRVNKQNRIAGVLENHAEGEAYAEHR  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + KF+RNK P++MPS+N+ FS+P
Sbjct  65   VRKFLRNKPPQVMPSVNKFFSEP  87



>gb|EMS61978.1| hypothetical protein TRIUR3_19930 [Triticum urartu]
 gb|EMT04073.1| hypothetical protein F775_11885 [Aegilops tauschii]
Length=97

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA GVAV  C  Q IRNI  N  VRV KE RAAG+ EN++EGK+Y +H 
Sbjct  12   RWLRPEVYPIFAATGVAVSICAMQLIRNITTNPEVRVTKENRAAGIQENFDEGKRYSQHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              KF+  + PEIMP++N  FSDP
Sbjct  72   FRKFIDRQRPEIMPAINNFFSDP  94



>gb|AFW76868.1| hypothetical protein ZEAMMB73_758599, partial [Zea mays]
Length=141

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  408  RPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXK  229
            R +VYP FAA GVAVG CGFQ  RNI  N  VRVNK GRAAGV EN+EEG++Y  H L  
Sbjct  61   RAQVYPLFAATGVAVGICGFQLFRNITGNPEVRVNKAGRAAGVLENHEEGRRYAMHGLRS  120

Query  228  FVRNKSPEIMPSLNRXFSDPQ  166
            FV +K+PEIMP++N+ F+DP+
Sbjct  121  FVHDKTPEIMPAVNKFFTDPK  141



>ref|XP_003601829.1| B12D protein [Medicago truncatula]
 gb|AES72080.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
 gb|AFK33923.1| unknown [Medicago truncatula]
Length=88

 Score = 91.3 bits (225),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F  +G AVG C  Q +RNI  N  VRV K+ RAAG+ +N++EG+KY +H 
Sbjct  5    RWIRPEVYPLFVPVGAAVGICVMQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHF  64

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + +FVR KS EIMPSLN  FSDP+
Sbjct  65   IRRFVRGKSTEIMPSLNGFFSDPK  88



>ref|XP_006376832.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
 gb|ERP54629.1| hypothetical protein POPTR_0012s07660g [Populus trichocarpa]
Length=82

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            +VYP FAA+GVAVG CGFQ  RNI  N  VRV K+ RAAGV +N+ EG+KY EH L K V
Sbjct  2    QVYPLFAAVGVAVGICGFQLARNICINPEVRVTKQNRAAGVLDNFSEGEKYSEHGLRKLV  61

Query  222  RNKSPEIMPSLNRXFSDPQRN  160
            RN+SP+IMPS+N  F+DP+ N
Sbjct  62   RNRSPQIMPSINNFFTDPKLN  82



>ref|XP_010249439.1| PREDICTED: uncharacterized protein LOC104591985 [Nelumbo nucifera]
Length=94

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW RPEVYP   A+G  VG C FQ +RNI  N  VRVNK+ R+ GV +N+EEGK Y EHS
Sbjct  7    RWSRPEVYPLMVALGGVVGLCAFQLVRNICSNPDVRVNKQKRSEGVFDNFEEGKNYKEHS  66

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            + KF+RN+ PE+MPS+N+ FS+P+
Sbjct  67   IRKFLRNRPPEVMPSVNKFFSEPK  90



>gb|EMT27875.1| hypothetical protein F775_28789 [Aegilops tauschii]
Length=98

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP FAA GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y  H 
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
              +F+  KS EIMP +N  F+DP +N
Sbjct  73   FRRFIDGKSAEIMPGINSFFTDPPKN  98



>ref|XP_007044988.1| B12D protein [Theobroma cacao]
 gb|EOY00820.1| B12D protein [Theobroma cacao]
Length=89

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP FAA+G AVG C  Q +RNI  N  VRV KE R+AG+ EN+EEG++Y EH 
Sbjct  6    RWLKPEVYPLFAAVGFAVGICAMQLVRNISTNPEVRVTKENRSAGILENFEEGERYAEHG  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L  FVR +  +IMPS+N  FSDP
Sbjct  66   LRNFVRKRPSQIMPSINNFFSDP  88



>ref|XP_003557311.1| PREDICTED: uncharacterized protein LOC100833199 [Brachypodium 
distachyon]
Length=97

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV +N+ EG++Y  H 
Sbjct  12   RWLRPEAYPIFATTGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHAEGERYSRHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              KF+  +S EIMP+LN  F+DP
Sbjct  72   FRKFIDGRSREIMPALNSFFTDP  94



>ref|XP_011086732.1| PREDICTED: uncharacterized protein LOC105168371 [Sesamum indicum]
Length=86

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PE+YP    +G AVG CG Q IRNI  N  VRV KE RAAGV +NYEEG+KY +H+
Sbjct  3    RWMKPEIYPLLVPVGFAVGICGMQLIRNICTNPEVRVTKENRAAGVLQNYEEGEKYADHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
              K++R + P+IMP +NR FS P+
Sbjct  63   FRKYLRGQHPQIMPGINRYFSKPE  86



>ref|XP_004955942.1| PREDICTED: uncharacterized protein LOC101785845 [Setaria italica]
Length=95

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F A G AVG C  Q IRNI  N  VRV KE RAAGV EN+EEG++Y +H 
Sbjct  11   RWIRPEVYPLFLATGAAVGICAMQLIRNITGNPEVRVLKEKRAAGVLENHEEGRRYSQHG  70

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
              K++  K PEIM SLN   +DP+
Sbjct  71   FRKYIDGKKPEIMQSLNSWMADPK  94



>emb|CDP13299.1| unnamed protein product [Coffea canephora]
Length=89

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  A +   VG C  Q +RNI  N  VRV KE RAAGV  N+EEG+ Y +H 
Sbjct  6    RWIKPEVYPLLAPVAAVVGLCTMQLVRNICTNPEVRVTKENRAAGVLNNFEEGEYYAQHR  65

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L +F+R + PE+MPS+N+ FSDP
Sbjct  66   LRQFLRGRRPEVMPSVNKFFSDP  88



>ref|XP_006338343.1| PREDICTED: uncharacterized protein LOC102603988 [Solanum tuberosum]
Length=88

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP  AAM    G C FQ  RN+  N  VR+NK  R+ GV EN EEG+KY +HS
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L  F+R + P++MPS+NR FSD   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSDHDNN  88



>gb|EPS70497.1| hypothetical protein M569_04271, partial [Genlisea aurea]
Length=79

 Score = 86.7 bits (213),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  399  VYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFVR  220
            V+P FAA+GVAVG CG Q IRNI  N  VRVNK  R AGV +N+EEG+KY +HS+ KFVR
Sbjct  1    VFPLFAAVGVAVGLCGMQLIRNITINPEVRVNKMNRGAGVLDNFEEGEKYAQHSVRKFVR  60

Query  219  NKSPEIMPSLNRXFSDP  169
             +SPEIMPS+N  FS+P
Sbjct  61   KRSPEIMPSINHFFSEP  77



>gb|EMS45331.1| hypothetical protein TRIUR3_29962 [Triticum urartu]
Length=98

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP FAA GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y  H 
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
              +F+  KS EIMP +N  F+ P +N
Sbjct  73   FRRFIDGKSAEIMPGINSFFTAPPKN  98



>dbj|BAK01669.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=98

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP FAA GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y  H 
Sbjct  13   RWLRPEAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHP  72

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
              +F+  KS EIMP +N  F+ P +N
Sbjct  73   FRRFIDGKSAEIMPGINNFFTAPPKN  98



>dbj|BAK01100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE YP F   GVAV  C  Q IRNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  12   RWLRPEAYPIFLTTGVAVSICAMQLIRNITTNPEVRVTKENRAAGVQENFDEGKRYSQHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              KF+  + P+IMP++N  FSDP
Sbjct  72   FRKFIDRQRPQIMPAINNFFSDP  94



>dbj|BAC84633.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31625.1| putative B12D protein [Oryza sativa Japonica Group]
 gb|EAZ03481.1| hypothetical protein OsI_25619 [Oryza sativa Indica Group]
 gb|EAZ39393.1| hypothetical protein OsJ_23824 [Oryza sativa Japonica Group]
 dbj|BAH01595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=98

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F A GVAV  C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  13   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHG  72

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
              KF+  K PEIMP +N  FSDP +
Sbjct  73   FRKFIDGKRPEIMPGINSFFSDPPK  97



>ref|XP_001779363.1| predicted protein [Physcomitrella patens]
 gb|EDQ55870.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PE+YP FAA+G A+G CG+   RN+  N  VR+ KE RAAGV ENY+EG+ Y  H 
Sbjct  10   RWIKPEIYPLFAAIGAALGICGYSMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHG  69

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L K+++ + P+IMP +N  FS
Sbjct  70   LRKYLQQQEPQIMPGINNYFS  90



>ref|XP_009596991.1| PREDICTED: uncharacterized protein LOC104092997 [Nicotiana tomentosiformis]
Length=88

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM    G C FQ  RN+  N  VR++K  R+  V EN EEG+KY +HS
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRISKVHRSMAVLENEEEGEKYAQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KF+R + P++MPS+NR FSD  +N
Sbjct  63   LRKFLRTRPPQVMPSINRFFSDHDKN  88



>ref|XP_006658464.1| PREDICTED: uncharacterized protein LOC102702396 [Oryza brachyantha]
Length=100

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F A GVAV  C  Q +RNI  N  VRV KE RAAGV EN++EG++Y +H 
Sbjct  15   RWIRPEVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGRRYSQHG  74

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
              KF+  + PEIMPS+N  F+DP +
Sbjct  75   FRKFIDGRRPEIMPSINSFFADPPK  99



>gb|EYU20492.1| hypothetical protein MIMGU_mgv1a026736mg [Erythranthe guttata]
Length=86

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM    G C FQ  RN+  N  VR+NK  R   V EN EEG  Y EH+
Sbjct  3    RWVKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGLTYREHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PE+MPS+NR FSD
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSD  84



>ref|XP_004232140.1| PREDICTED: uncharacterized protein LOC101252543 [Solanum lycopersicum]
Length=88

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP  AAM    G C FQ  RN+  N  VR+NK  R+ GV EN EEG+KY +HS
Sbjct  3    RWIRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRINKAHRSMGVLENEEEGEKYAKHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L  F+R + P++MPS+NR FS+   N
Sbjct  63   LRNFLRTRPPQVMPSINRFFSNHDNN  88



>ref|XP_008464582.1| PREDICTED: uncharacterized protein LOC103502424 [Cucumis melo]
Length=86

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAMG     C FQ  RNI  N  VRVNK  R  GV EN EEG+KY EHS
Sbjct  3    RWMKPEVYPLLAAMGFVTSMCVFQLTRNILINPDVRVNKAHRRMGVLENEEEGEKYSEHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L +F+R + PEIMP++NR FS  +
Sbjct  63   LRRFLRTRPPEIMPTINRYFSQDK  86



>gb|EYU29787.1| hypothetical protein MIMGU_mgv1a021169mg [Erythranthe guttata]
Length=80

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 55/87 (63%), Gaps = 13/87 (15%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVN-KEGRAAGVxenyeegkkyxEH  241
            RWIRPEVYP FAA G+AVG CGFQ +RNI  N  VR N  EG             KY E 
Sbjct  6    RWIRPEVYPLFAATGLAVGICGFQLVRNICGNPEVRDNFDEGH------------KYKER  53

Query  240  SLXKFVRNKSPEIMPSLNRXFSDPQRN  160
            +L K+VRN+  EIMPSLN  F+DPQ N
Sbjct  54   ALRKYVRNRKLEIMPSLNSFFTDPQNN  80



>ref|XP_009792586.1| PREDICTED: uncharacterized protein LOC104239607 [Nicotiana sylvestris]
Length=87

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM    G C FQ  RN+  N  VR+ K  R+  + EN EEG+KY +HS
Sbjct  3    RWMRPEVYPLMAAMTFVTGMCVFQLTRNVLLNPDVRIKKAHRSMAILENEEEGEKYAQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + P++MPS+NR FSD
Sbjct  63   LRKFLRTRPPQVMPSINRFFSD  84



>ref|XP_006340507.1| PREDICTED: uncharacterized protein LOC102592850 [Solanum tuberosum]
Length=125

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FAA+GVAVG CG Q +             E RAAGV +N+ EG+KY EH+
Sbjct  52   RWLRPEVYPLFAAVGVAVGICGMQYMHQ----------PENRAAGVLDNFSEGEKYAEHA  101

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L KFVRNKSPEIMPS+N  FSDP
Sbjct  102  LRKFVRNKSPEIMPSINGFFSDP  124



>ref|XP_001776158.1| predicted protein [Physcomitrella patens]
 gb|EDQ59069.1| predicted protein [Physcomitrella patens]
Length=93

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PE+YP F A+G A+G CG+   RN+  N  VR+ KE RAAGV ENY+EG+ Y  H 
Sbjct  10   RWIKPEIYPLFFAIGAALGICGYAMARNLAINPDVRITKEDRAAGVLENYKEGEAYKMHG  69

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L  +VR + P+IMP  N  FS
Sbjct  70   LRAYVRQQEPQIMPGFNNYFS  90



>gb|EYU25265.1| hypothetical protein MIMGU_mgv1a024239mg [Erythranthe guttata]
Length=86

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAM    G C FQ  RN+  N  VR+NK  R   V EN EEG KY EH+
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCLFQLTRNVILNPDVRINKAHRTTAVLENEEEGWKYREHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PE+MPS+NR FS+
Sbjct  63   LRKFLRTRPPEVMPSVNRFFSE  84



>ref|XP_011099034.1| PREDICTED: uncharacterized protein LOC105177540 [Sesamum indicum]
Length=86

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN   N  VR+NK  R   V EN EEG+KY EHS
Sbjct  3    RWMKPDVYPLVAAMSFVTGMCLFQLTRNALLNPDVRINKAHRRRAVLENQEEGEKYAEHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PE+MPSLNR FSD
Sbjct  63   LRKFLRTRPPEVMPSLNRFFSD  84



>ref|XP_010694063.1| PREDICTED: uncharacterized protein LOC104906928 [Beta vulgaris 
subsp. vulgaris]
Length=88

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+P+VYP  AAM    G C FQ  RN+  N  VR+NK  RA  V EN+EEG+KY EH 
Sbjct  3    RWIKPDVYPLIAAMSFVTGMCIFQLTRNVLLNPDVRINKAHRATAVLENHEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
              K++R +SPE+MPS+N  FS+ +++
Sbjct  63   FRKYLRTRSPEVMPSINSFFSETKKD  88



>ref|XP_006856407.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
 gb|ERN17874.1| hypothetical protein AMTR_s00047p00213990 [Amborella trichopoda]
Length=87

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAMG     C FQ  RN+  N  VR+NK  R + V +N EEG+KY EHS
Sbjct  3    RWIKPEVYPLMAAMGFVTSLCIFQLTRNLLLNPDVRINKAHRTSAVLDNEEEGQKYAEHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L  F+R + PEIMP++N+ FS+
Sbjct  63   LRNFLRTRPPEIMPAINKIFSE  84



>ref|NP_001151846.1| B12D protein [Zea mays]
 gb|ACG44577.1| B12D protein [Zea mays]
Length=84

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            +VYP F  M VA+G C +Q +RNI  N  VRV KE RAAGV +N++EG++Y  H L KFV
Sbjct  3    QVYPLFVPMAVALGICSYQLVRNITGNPEVRVTKEKRAAGVLDNHDEGERYAMHGLRKFV  62

Query  222  RNKSPEIMPSLNRXFSDPQRN  160
            R K PEIM S+N  F+DP ++
Sbjct  63   RGKKPEIMASINSFFADPPKD  83



>emb|CDP19974.1| unnamed protein product [Coffea canephora]
Length=92

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAM    G C FQ  RN+  N  VRV+K  R   V EN EEG+KY +HS
Sbjct  3    RWIKPEVYPLMAAMSFVTGMCIFQLTRNVLLNPDVRVDKAHRKTAVLENQEEGEKYAQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L +F+R + PEIMPS+NR F+
Sbjct  63   LRRFLRTRPPEIMPSINRFFA  83



>ref|XP_006438116.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|ESR51356.1| hypothetical protein CICLE_v10033501mg [Citrus clementina]
 gb|KDO82025.1| hypothetical protein CISIN_1g047755mg [Citrus sinensis]
Length=90

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP F A+G AVG C  Q +RN   N  VR+ K  R AGV EN++EG +Y E++
Sbjct  7    KWVRPEVYPLFGALGAAVGICAMQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENA  66

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L +FVR+K P+IMPS+N  FS
Sbjct  67   LRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_006484337.1| PREDICTED: uncharacterized protein LOC102622685 [Citrus sinensis]
Length=90

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +W+RPEVYP F A+G AVG C  Q +RN   N  VR+ K  R AGV EN++EG +Y E++
Sbjct  7    KWVRPEVYPLFGALGAAVGICAVQLVRNAWTNPEVRLTKANRTAGVLENFDEGYRYKENA  66

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L +FVR+K P+IMPS+N  FS
Sbjct  67   LRRFVRDKPPQIMPSVNEFFS  87



>ref|XP_010029400.1| PREDICTED: uncharacterized protein LOC104419438 isoform X2 [Eucalyptus 
grandis]
Length=86

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM    G C FQ  RN+  N  VR+NK  R  GV +N EEG+KY +H 
Sbjct  3    RWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPAINHFFSE  84



>ref|XP_004137261.1| PREDICTED: uncharacterized protein LOC101217963 [Cucumis sativus]
 ref|XP_004154766.1| PREDICTED: uncharacterized LOC101217963 [Cucumis sativus]
Length=87

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAMG     C FQ  RNI  N  VRV K  R  GV +N EEG+KY EHS
Sbjct  3    RWMKPEVYPLLAAMGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
            L +F+R + PEIMP++N  FS   +
Sbjct  63   LRRFLRTRPPEIMPTINHYFSQDHK  87



>ref|XP_007215204.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
 gb|EMJ16403.1| hypothetical protein PRUPE_ppa014104mg [Prunus persica]
Length=86

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM      C FQ  RN+  N  VR++K  R  GV EN EEG+KY EH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKAKRGMGVLENKEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R + PEIMP++N+ FS  +
Sbjct  63   LRKFLRTRPPEIMPTINQFFSQDE  86



>ref|XP_008230281.1| PREDICTED: uncharacterized protein LOC103329570 [Prunus mume]
Length=86

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR++K  R  GV EN EEG+KY EH 
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCAFQLTRNVFLNPDVRIDKARRGMGVLENKEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R + PEIMP++NR FS  +
Sbjct  63   LRKFLRTRPPEIMPTINRFFSQDE  86



>ref|XP_002531002.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31390.1| conserved hypothetical protein [Ricinus communis]
Length=86

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAM      C FQ  RN+  N  VR+NK  R   V EN  EG++Y EH 
Sbjct  3    RWIKPEVYPLMAAMTFVTSLCAFQLTRNMFLNPDVRINKAHRRTAVLENEVEGEQYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMPS+N  FS+
Sbjct  63   LRKFLRTRPPEIMPSINHFFSE  84



>ref|XP_010099316.1| hypothetical protein L484_018178 [Morus notabilis]
 gb|EXB77662.1| hypothetical protein L484_018178 [Morus notabilis]
Length=87

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAM      C FQ  RN+  N  VR+NK  R+ GV EN EEG+KY EH 
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNMFLNPDVRINKAHRSMGVLENKEEGEKYAEHC  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
            L KF+R + PE+MPS+N  FS   +
Sbjct  63   LRKFLRTRPPEVMPSVNHFFSSQDK  87



>ref|XP_003531875.1| PREDICTED: uncharacterized protein LOC100527287 [Glycine max]
 gb|ACU16358.1| unknown [Glycine max]
 gb|KHN30319.1| hypothetical protein glysoja_037830 [Glycine soja]
Length=86

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM    G C FQ  RN+  N  VR+NK  R+  V EN EEG+KY EH 
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNVLGNPDVRINKTRRSMAVLENREEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>ref|XP_006373388.1| germination family protein [Populus trichocarpa]
 gb|ERP51185.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VRVNK  R  GV EN EEG++Y EH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRVNKANRGMGVLENKEEGERYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSE  84



>ref|XP_011021065.1| PREDICTED: uncharacterized protein LOC105123251 [Populus euphratica]
Length=86

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R  GV EN EEG+KY EH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFMNPDVRINKANRGMGVLENKEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTVNHFFSE  84



>gb|AAL17696.1| B12D-like protein [Castanea sativa]
Length=134

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAA-GVxenyeegkkyxEH  241
             W+RPEVYP FA +GVAVG C  Q +RNI  N  VRV KE  +      N+EEG+KY +H
Sbjct  31   EWLRPEVYPLFATVGVAVGICAMQLVRNICTNPEVRVTKENNSCRKCLHNFEEGEKYSQH  90

Query  240  SLXKFVRNKSPEIMPSLNRXFSDPQ  166
            ++ KFV N+SP IMPSL   FS+P+
Sbjct  91   AVRKFVLNRSPHIMPSLKSFFSEPK  115



>ref|XP_004304209.1| PREDICTED: uncharacterized protein LOC101313329 [Fragaria vesca 
subsp. vesca]
Length=89

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP  AAM      C FQ  RN+  N  VRVNK  R   V +N EEG++Y EH 
Sbjct  3    RWIRPEVYPLMAAMTFVTSLCVFQLTRNVILNPDVRVNKAHRRMAVLDNEEEGERYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L K++R + PE+MP++N  FS  Q +
Sbjct  63   LRKYLRTRRPEVMPTINHFFSHSQED  88



>ref|XP_004491894.1| PREDICTED: uncharacterized protein LOC101510215 [Cicer arietinum]
Length=86

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RNI  N  VR++K  R  GV +N EEG+KY EH 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCIFQLTRNILGNPDVRISKSRRTKGVFDNKEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMPS+N  FS+
Sbjct  63   LRKFLRTRPPEIMPSINHFFSE  84



>ref|XP_002281305.1| PREDICTED: uncharacterized protein LOC100258293 [Vitis vinifera]
Length=89

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+ PEVYP   AM +  G   F   R++  N  VR++KEGR   V +N +EG++Y EH 
Sbjct  3    RWVIPEVYPLLGAMAIVGGMVVFSLGRHVTMNPDVRISKEGRKQAVLDNADEGERYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L KF+R ++PEI P LNR FSDP+++
Sbjct  63   LRKFLRTRTPEIFPKLNRFFSDPEKS  88



>ref|XP_010260574.1| PREDICTED: uncharacterized protein LOC104599651 [Nelumbo nucifera]
Length=88

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VRVNKE R   V EN EEG+KY EH 
Sbjct  3    RWVKPEVYPLMAAMTFVASMCVFQLTRNVFMNPDVRVNKEHRQKAVLENAEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L KF+R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPAINSFFS  83



>ref|XP_008362218.1| PREDICTED: uncharacterized protein LOC103425898 [Malus domestica]
 ref|XP_009373788.1| PREDICTED: uncharacterized protein LOC103962745 [Pyrus x bretschneideri]
Length=86

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM      C FQ  RN+  N  VR+NK  R   V EN EEG+KY EH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS 
Sbjct  63   LRKFLRTRPPEIMPTINHFFSQ  84



>ref|XP_010257978.1| PREDICTED: uncharacterized protein LOC104597899 [Nelumbo nucifera]
Length=87

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWI+PEVYP  AAM      C FQ  RN   N  VRVNK+ R   V ENYEEG+KY EH 
Sbjct  3    RWIKPEVYPLMAAMTFVTSMCVFQLTRNAFLNPDVRVNKDHRKTAVLENYEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L KF+R + PEIMP++N  FS
Sbjct  63   LRKFLRTRPPEIMPTINHFFS  83



>gb|KCW56312.1| hypothetical protein EUGRSUZ_I02053 [Eucalyptus grandis]
Length=234

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM    G C FQ  RN+  N  VR+NK  R  GV +N EEG+KY +H 
Sbjct  151  RWVKPEVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHG  210

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  211  LRKFLRTRPPEIMPAINHFFSE  232



>gb|AFK43764.1| unknown [Medicago truncatula]
 gb|KEH21758.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=86

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR++K GR  GV +N EEG+KY +H 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLQNPDVRISKNGRTKGVFDNKEEGEKYAKHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L  F+R + PE+MP++N  FS+
Sbjct  63   LRNFLRTRPPEVMPTINHFFSE  84



>ref|XP_010260461.1| PREDICTED: uncharacterized protein LOC104599559 [Nelumbo nucifera]
Length=89

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  414  WIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSL  235
            WI+P+VYP  AAM      C FQ  RN+  N  VR+NK+ R   V EN EEG+KY EH L
Sbjct  6    WIKPDVYPLVAAMTFVTSMCVFQLTRNVFLNPDVRINKDRRKMAVLENQEEGEKYAEHGL  65

Query  234  XKFVRNKSPEIMPSLNRXFSDPQ  166
             KF+R + PEIMP++N  FS P+
Sbjct  66   RKFLRTRPPEIMPTINHFFSKPE  88



>ref|XP_008379445.1| PREDICTED: uncharacterized protein LOC103442440 [Malus domestica]
 ref|XP_008348095.1| PREDICTED: uncharacterized protein LOC103411226 [Malus domestica]
Length=86

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM      C FQ  RN+  N  VR+NK  R   V EN EEG+KY EH 
Sbjct  3    RWVRPEVYPLMAAMTFVTSLCAFQLTRNMFLNPEVRINKAHRRMAVLENEEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP+ N  FS 
Sbjct  63   LRKFLRTRPPEIMPTXNHFFSQ  84



>ref|XP_010514670.1| PREDICTED: uncharacterized protein LOC104790592 [Camelina sativa]
Length=87

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP   AMG       FQ  RN   N   R+NK  R  G+ EN +EG+KY +H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEDEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L K++R + P++MPSLNR FSD
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSD  84



>ref|XP_002305391.1| germination family protein [Populus trichocarpa]
 gb|EEE85902.1| germination family protein [Populus trichocarpa]
Length=86

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R+ GV  N EEG++Y EH 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L +F+R + PEIMP++N  F++
Sbjct  63   LRRFLRTRPPEIMPTINHFFTE  84



>ref|XP_009151762.1| PREDICTED: uncharacterized protein LOC103875065 [Brassica rapa]
 emb|CDX86357.1| BnaA06g30740D [Brassica napus]
Length=87

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP   AMG       FQ  RN   N   R++KE R  G+ EN +EG+KY +H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L K++R + P++MPSLNR FS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>ref|XP_009419068.1| PREDICTED: uncharacterized protein LOC103999135 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEV+P  AAM      C FQ  RN+  N  VR+NK  R   V EN EEG+KY +HS
Sbjct  3    RWVRPEVFPLMAAMTFVTSMCVFQLTRNMLMNPDVRINKTNRTTAVLENAEEGEKYSQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L +F+ ++ PE+ P+LNR FS
Sbjct  63   LRRFLSHRPPEVFPALNRFFS  83



>ref|XP_007139429.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
 gb|ESW11423.1| hypothetical protein PHAVU_008G028700g [Phaseolus vulgaris]
Length=115

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VRVNK  R+  V +N EEG+KY EH 
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVRVNKTRRSMAVLDNREEGEKYAEHG  91

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R + PEIMP++N  FS  +
Sbjct  92   LRKFLRTRPPEIMPTINHFFSQDK  115



>dbj|BAK03592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=89

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  4    RWIRPEVYPLFATTGVAVGICVMQLVRNIMTNPEVRVTKENRAAGVLENHDEGKRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + +F  +K  + M +L+   +DP
Sbjct  64   VRRFWLSKRRDYMQALDNVPTDP  86



>ref|XP_011008605.1| PREDICTED: uncharacterized protein LOC105113935 [Populus euphratica]
 ref|XP_011014073.1| PREDICTED: uncharacterized protein LOC105117942 [Populus euphratica]
Length=86

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R+ GV  N EEG++Y +H 
Sbjct  3    RWMKPEVYPLLAAMTCVTSLCIFQLTRNVFLNPDVRINKAKRSMGVLGNNEEGERYADHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L +F+R + PEIMP++N  F++
Sbjct  63   LRRFLRTRPPEIMPAINHFFTE  84



>ref|XP_006482419.1| PREDICTED: uncharacterized protein LOC102612079 [Citrus sinensis]
 gb|KDO72280.1| hypothetical protein CISIN_1g048115mg [Citrus sinensis]
Length=94

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM      C FQ  RN+  N  VR+NK  R+ GV EN EEG+KY EH 
Sbjct  3    RWMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L +F+R + P++MP++NR F+ 
Sbjct  63   LRRFLRTRPPQVMPAINRFFTQ  84



>ref|NP_189632.1| B12D protein [Arabidopsis thaliana]
 dbj|BAB02998.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77618.1| B12D protein [Arabidopsis thaliana]
Length=87

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP   AMG       FQ  RN   N   R+NKE R  G+ EN +EG+KY +H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNAFLNPDCRINKEHRKMGILENKDEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
              K++R + P++MPSLNR FS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_002875526.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51785.1| hypothetical protein ARALYDRAFT_323026 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP   AMG       FQ  RN   N   R+NKE R  G+ EN +EG+KY +H+
Sbjct  3    RWVRPEVYPLLGAMGFVTTMVVFQLTRNALLNPDCRINKEHRKMGILENEDEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
              K++R + P++MPSLNR FS
Sbjct  63   FRKYLRTRQPQVMPSLNRFFS  83



>ref|XP_007032847.1| B12D protein [Theobroma cacao]
 gb|EOY03773.1| B12D protein [Theobroma cacao]
Length=86

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP   AM      C FQ  RN+  N  VR+NK  R+  V ENYEEG+KY EH 
Sbjct  3    RWMKPEVYPLLGAMTFVTSMCIFQLTRNVFLNPAVRINKADRSKAVLENYEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PE+MP++N  FS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>gb|KJB22813.1| hypothetical protein B456_004G066900 [Gossypium raimondii]
Length=86

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP   AM      C FQ  RN+  N  VR+NK  R+  V ENYEEG+KY EH 
Sbjct  3    RWMKPEVYPLVGAMAFVTSMCIFQLTRNVFLNPAVRINKSDRSQAVLENYEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PE+MP++N  FS+
Sbjct  63   LRKFLRTRPPEVMPAINHFFSE  84



>dbj|BAC83875.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88459.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82410.1| hypothetical protein OsI_26790 [Oryza sativa Indica Group]
 gb|EEE67550.1| hypothetical protein OsJ_25042 [Oryza sativa Japonica Group]
Length=95

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN+  N  VRVNK  R + V EN EEG+KY +H+
Sbjct  3    RWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              +F+  + PE+ P+LNR F+ P
Sbjct  63   FRRFLATQRPEVFPALNRFFAGP  85



>gb|KDP24288.1| hypothetical protein JCGZ_25584 [Jatropha curcas]
Length=86

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R   V EN +EG+KY EH 
Sbjct  3    RWMKPEVYPLLAAMTFVTSMCVFQLTRNVFLNPDVRINKAHRRMAVLENEDEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQ  166
            L KF+R + PE+MP++N  FS  +
Sbjct  63   LRKFLRTRPPEVMPAINHFFSQDE  86



>ref|XP_010502994.1| PREDICTED: uncharacterized protein LOC104780196 [Camelina sativa]
Length=87

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP   AMG       FQ  RN   N   R+NK  R  G+ EN EEG+KY +H+
Sbjct  3    RWVRPEVYPLLGAMGFVTSMVVFQLTRNALFNPDCRINKAHRKMGILENEEEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L K++R + P++MPSLNR FS+
Sbjct  63   LRKYLRTRPPQVMPSLNRFFSE  84



>ref|XP_003552604.1| PREDICTED: uncharacterized protein LOC100785946 [Glycine max]
 gb|KHN37934.1| hypothetical protein glysoja_042363 [Glycine soja]
Length=86

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R+  V +N EEG+KY EH 
Sbjct  3    RWMKPEVYPLLAAMTFVSSMCVFQLTRNMLGNPDVRINKTRRSMPVLDNREEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L KF+R + PEIMP++N  FS+
Sbjct  63   LRKFLRTRPPEIMPTINHFFSE  84



>gb|AFK44347.1| unknown [Lotus japonicus]
Length=87

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeeg-kkyxEH  241
            RW++PEVYP  AAM    G C FQ  RN+  N  VR++K  R+ GV  + +E  ++Y EH
Sbjct  3    RWMKPEVYPLLAAMTFVTGMCVFQLTRNLLGNPDVRISKARRSMGVLFDNKEEGERYAEH  62

Query  240  SLXKFVRNKSPEIMPSLNRXFSD  172
             L KF+R + PEIMP++N  FS+
Sbjct  63   GLRKFLRTRQPEIMPTINHFFSE  85



>ref|XP_006395262.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
 gb|ESQ32548.1| hypothetical protein EUTSA_v10005671mg [Eutrema salsugineum]
Length=87

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPE+YP   AMG       FQ  RN   N   R+NK  R  G+ EN +EG+KY +H+
Sbjct  3    RWVRPEMYPLLGAMGFVTSMVVFQLTRNALLNPDCRINKANRKMGILENEDEGEKYAQHN  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L K++R + P++MPSLNR FS
Sbjct  63   LRKYLRTRQPQVMPSLNRFFS  83



>ref|NP_001060222.2| Os07g0604600 [Oryza sativa Japonica Group]
 dbj|BAF22136.2| Os07g0604600, partial [Oryza sativa Japonica Group]
Length=127

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN+  N  VRVNK  R + V EN EEG+KY +H+
Sbjct  35   RWLKPDVYPLIAAMTFVTGLCTFQLTRNVFMNPDVRVNKNNRKSAVLENAEEGEKYHQHA  94

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              +F+  + PE+ P+LNR F+ P
Sbjct  95   FRRFLATQRPEVFPALNRFFAGP  117



>ref|XP_010034410.1| PREDICTED: uncharacterized protein LOC104423644 [Eucalyptus grandis]
 gb|KCW51947.1| hypothetical protein EUGRSUZ_J01394 [Eucalyptus grandis]
Length=88

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM      C FQ  RN+  N  VR+NK  R   V +N EEG+KY EH 
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNVLLNPDVRINKAHRGMAVLDNAEEGRKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L KF+R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>dbj|BAG94722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=90

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLN  187
            + +F  +K  + M +L+
Sbjct  64   VRRFWLSKRRDYMQALD  80



>ref|NP_001059359.1| Os07g0274400 [Oryza sativa Japonica Group]
 dbj|BAC84630.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAD31622.1| putative B12D protein [Oryza sativa Japonica Group]
 dbj|BAF21273.1| Os07g0274400 [Oryza sativa Japonica Group]
 gb|EAZ39392.1| hypothetical protein OsJ_23823 [Oryza sativa Japonica Group]
Length=89

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVRVTKENRAAGVLENFDEGKRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLN  187
            + +F  +K  + M +L+
Sbjct  64   VRRFWLSKRRDYMQALD  80



>ref|XP_008651396.1| PREDICTED: B12D protein isoform X1 [Zea mays]
 gb|ACG30695.1| B12D protein [Zea mays]
 tpg|DAA63527.1| TPA: b12D protein [Zea mays]
Length=94

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN+  N  VRV+K  R + V +N  EG++Y +H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN*LPG  148
              +F+  + PE+ P+LN  FSD   N  P 
Sbjct  63   FRRFLATQRPEVFPALNSFFSDSNNNNTPA  92



>ref|XP_010034411.1| PREDICTED: uncharacterized protein LOC104423646 [Eucalyptus grandis]
 gb|KCW51953.1| hypothetical protein EUGRSUZ_J01397 [Eucalyptus grandis]
Length=88

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM      C FQ  RN   N  VRVNK  R   V +  EEG+KY EH 
Sbjct  3    RWVKPDVYPLMAAMTFVTSLCIFQLTRNALLNPDVRVNKAHRGMAVLDTAEEGRKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L KF+R + PE+MP++N  FS
Sbjct  63   LRKFLRTRPPEVMPTINHFFS  83



>ref|XP_010553961.1| PREDICTED: uncharacterized protein LOC104823885 [Tarenaya hassleriana]
Length=87

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP   AMG       FQ  RN   N   R+NK  R +GV EN EEG+KY +HS
Sbjct  3    RWIRPEVYPLLGAMGFVTSMVVFQLTRNAMLNPDCRINKGNRKSGVLENEEEGEKYAQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L +F+R ++P++MP++N  FS 
Sbjct  63   LRRFLRTRAPQVMPAINNFFSQ  84



>ref|XP_008664404.1| PREDICTED: uncharacterized protein LOC100383000 [Zea mays]
 gb|ACN31786.1| unknown [Zea mays]
Length=88

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+R EVYP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y +H 
Sbjct  4    RWVRAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKEKRAAGVLDNHDEGRRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
            + +F  +K  + M ++++  +DP +
Sbjct  64   VRRFWLSKRRDYMQAMDKVPTDPNK  88



>ref|XP_004958246.1| PREDICTED: uncharacterized protein LOC101775472 [Setaria italica]
Length=91

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN+  N  VRV+K  R + V +N +EG++Y +H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGMCVFQLTRNVFMNPDVRVSKASRQSAVLDNADEGQRYSQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
              +F+  + PE+ P+LNR FS+
Sbjct  63   FRRFLATQRPEVFPALNRFFSE  84



>ref|NP_001059360.2| Os07g0274700 [Oryza sativa Japonica Group]
 dbj|BAF21274.2| Os07g0274700, partial [Oryza sativa Japonica Group]
Length=130

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            EVYP F A GVAV  C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H   KF+
Sbjct  50   EVYPLFLATGVAVSICVGQLVRNITGNPEVRVLKEKRAAGVLENFDEGKRYSQHGFRKFI  109

Query  222  RNKSPEIMPSLNRXFSDPQR  163
              K PEIMP +N  FSDP +
Sbjct  110  DGKRPEIMPGINSFFSDPPK  129



>ref|XP_006657932.1| PREDICTED: uncharacterized protein LOC102705450 [Oryza brachyantha]
Length=95

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM    G C FQ  RN+  N  VRVNK  R + V EN  EG++Y +H+
Sbjct  3    RWLKPDVYPLIAAMSFVTGLCTFQLTRNVFMNPDVRVNKNNRQSAVLENATEGERYSQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              +F+  + PE+ P+ NR F+ P
Sbjct  63   FRRFLATQRPEVFPAANRFFAGP  85



>ref|XP_009406306.1| PREDICTED: uncharacterized protein LOC103989230 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM      C FQ  RN+  N  VR+NK  R   V EN +E ++Y +H 
Sbjct  3    RWVKPEVYPLMAAMTFVTSLCLFQLTRNMFLNPDVRINKSHRTTPVLENADEAQRYSQHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQRN  160
            L +F+  + PEIMP++N  FS  +R+
Sbjct  63   LRRFLSRRPPEIMPTINTFFSGIKRD  88



>dbj|BAJ88884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            + YP FAA GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y  H   +F+
Sbjct  70   QAYPIFAATGVAVGICVMQLVRNITTNPEVRVTKENRAAGVLDNHDEGRRYARHPFRRFI  129

Query  222  RNKSPEIMPSLNRXFSDPQRN  160
              KS EIMP +N  F+ P +N
Sbjct  130  DGKSAEIMPGINNFFTAPPKN  150



>ref|XP_003562728.1| PREDICTED: uncharacterized protein LOC100837236 [Brachypodium 
distachyon]
Length=88

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP   AM +  G C FQ +RN+  N  VR++K  R + V EN EEG+KY +H+
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCAFQLVRNVLLNPDVRISKSNRQSAVLENAEEGEKYSQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
              +FV    PE+ P++NR FS+
Sbjct  63   FRRFVSAHRPEVFPAINRFFSE  84



>ref|XP_008810952.1| PREDICTED: uncharacterized protein LOC103722254 [Phoenix dactylifera]
Length=87

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM    G C FQ  RN+  N  VR+NK  RA+ + +N EEG+KY +HS
Sbjct  3    RWVRPEVYPLMAAMAFVTGMCAFQLTRNMILNPDVRINKARRASAILDNAEEGEKYSQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
              KF+  +   +MP+L+   +D  +
Sbjct  63   FRKFLYRQRSAVMPALDGLSTDSDK  87



>ref|XP_006430939.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
 gb|ESR44179.1| hypothetical protein CICLE_v10013823mg [Citrus clementina]
Length=94

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            R +RPEVYP  AAM      C FQ  RN+  N  VR+NK  R+ GV EN EEG+KY EH 
Sbjct  3    RGMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L +F+R + P++MP++NR FS
Sbjct  63   LRRFLRTRPPQVMPAINRFFS  83



>gb|EPS63516.1| hypothetical protein M569_11268, partial [Genlisea aurea]
Length=86

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM    G    Q  RN+  N  VR+ K  R + + +N E+G KY EH+
Sbjct  3    RWMKPEVYPLLAAMTCVCGMVVLQLTRNVMHNPAVRLKKSERGSAIVDNEEKGMKYTEHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L KF+R + PEIMP++NR F+
Sbjct  63   LRKFLRTRPPEIMPAVNRFFA  83



>ref|XP_006658463.1| PREDICTED: uncharacterized protein LOC102702117 [Oryza brachyantha]
Length=86

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F   GVAVG C  Q +RNI  N  VRV KE RAAGV EN++EGK+Y +H 
Sbjct  4    RWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKEKRAAGVLENFDEGKRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + +F  +K  + M  L+   +DP
Sbjct  64   VRRFWLSKRRDYMHVLD---NDP  83



>ref|XP_004955938.1| PREDICTED: uncharacterized protein LOC101784102 [Setaria italica]
Length=91

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++ EVYP FA  GVAVG C  Q +RNI  N  VRV K+ RAAGV +N++EG++Y +H 
Sbjct  4    RWLKAEVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGVLDNHDEGRRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + +F  +K  + M ++++  +DP
Sbjct  64   VRRFWLSKRRDYMQAMDKVPTDP  86



>ref|XP_002459693.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
 gb|EER96214.1| hypothetical protein SORBIDRAFT_02g008920 [Sorghum bicolor]
Length=96

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP FA  GVAVG C  Q +RNI  N  VRV KE RAAGV +N++EG++Y +H 
Sbjct  5    RWVRPEVYPLFATTGVAVGICVMQLVRNITGNPEVRVTKENRAAGVLDNHDEGRRYSQHG  64

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            + +F  ++  + M +++   +D
Sbjct  65   VRRFWLSQRRDYMQAMDNVPTD  86



>ref|XP_003561264.1| PREDICTED: uncharacterized protein LOC100824762 [Brachypodium 
distachyon]
Length=87

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RWIRPEVYP F   GVAVG C  Q +RNI  N  VRV K+ RAAGV EN++EGK+Y +H 
Sbjct  4    RWIRPEVYPLFVTTGVAVGICAMQLVRNITTNPEVRVTKQNRAAGVLENHDEGKRYSQHG  63

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            + +F  ++  + M +L+   +DP
Sbjct  64   VRRFWLSQRRDYMQALD---NDP  83



>ref|NP_001060223.1| Os07g0604700 [Oryza sativa Japonica Group]
 dbj|BAC83876.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF22137.1| Os07g0604700 [Oryza sativa Japonica Group]
 gb|EAZ04641.1| hypothetical protein OsI_26791 [Oryza sativa Indica Group]
 gb|EAZ40584.1| hypothetical protein OsJ_25043 [Oryza sativa Japonica Group]
 dbj|BAH01133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=95

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP   AM +  G C FQ  RN+  N  VRVNK  R + V EN +EG+KY  H+
Sbjct  3    RWVKPDVYPLIVAMSLVGGMCVFQLTRNVFMNPDVRVNKSHRQSAVLENADEGEKYHHHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              +F+  + PE+ P++NR F+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|XP_002978639.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
 ref|XP_002984577.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ14222.1| hypothetical protein SELMODRAFT_181102 [Selaginella moellendorffii]
 gb|EFJ20086.1| hypothetical protein SELMODRAFT_152721 [Selaginella moellendorffii]
Length=95

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEV P    +G A+G   F  +RN+  N  VR+NKE R+AG+ +NY+EG +Y EH 
Sbjct  12   RWLKPEVIPLIGFIGAAMGLASFMCVRNLMLNPEVRINKEDRSAGLVQNYKEGYEYHEHG  71

Query  237  LXKFVRNKSPEIMPSLNRXFS  175
            L  ++RN+  EIMP +N  F+
Sbjct  72   LRHYMRNRKSEIMPRINEYFT  92



>ref|XP_006658786.1| PREDICTED: uncharacterized protein LOC102700818 [Oryza brachyantha]
Length=100

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP  AAM +  G C F   RN+  N  VRVNK  R + V EN EEG+KY +H+
Sbjct  3    RWVKPDVYPLIAAMSLVGGMCVFSLTRNVFMNPDVRVNKNNRQSAVPENAEEGEKYSQHA  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
              +F+  + PE+ P++NR F+ P
Sbjct  63   FRRFLGTQRPEVFPAINRFFAGP  85



>ref|XP_010029399.1| PREDICTED: uncharacterized protein LOC104419438 isoform X1 [Eucalyptus 
grandis]
Length=90

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  414  WIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSL  235
             I   VYP  AAM    G C FQ  RN+  N  VR+NK  R  GV +N EEG+KY +H L
Sbjct  8    LIEETVYPLMAAMTFVTGMCVFQLTRNVALNPDVRINKLNRRTGVLDNGEEGEKYSQHGL  67

Query  234  XKFVRNKSPEIMPSLNRXFSDPQ  166
             KF+R + PEIMP++N  FS+ +
Sbjct  68   RKFLRTRPPEIMPAINHFFSEDK  90



>ref|XP_010937886.1| PREDICTED: uncharacterized protein LOC105057112 [Elaeis guineensis]
Length=87

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP  AAM +  G C FQ  RN+  N  VR+NK  R+  + +N EEG+ Y +HS
Sbjct  3    RWVKPEVYPLMAAMTLVTGMCVFQLTRNMILNPDVRINKTRRSTAILDNAEEGEMYSQHS  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
              KF+    P ++PS +   +D  +
Sbjct  63   FRKFLYRLRPSVLPSFDGLSTDSDK  87



>ref|XP_001757013.1| predicted protein [Physcomitrella patens]
 gb|EDQ78244.1| predicted protein [Physcomitrella patens]
Length=94

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            +WI+PE+YP F A+  A+   GF   R+I  N  VR++K+ R AGV ENY+EG+ Y  H 
Sbjct  10   QWIKPEIYPLFLAVATALSMGGFVMARSIAVNPDVRISKQDREAGVLENYKEGEVYKNHR  69

Query  237  LXKFVRNKSPEIMPSLNRXFSD  172
            L  +     P+IMPSLN  FS 
Sbjct  70   LRHYALKHGPQIMPSLNNYFSS  91



>gb|AAR13310.1| B12D-like protein [Phaseolus vulgaris]
Length=128

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 54/97 (56%), Gaps = 13/97 (13%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXV-------------RVNKEGRAAGVx  277
            RW++PEVYP  AAM      C FQ  RN+  N  V             RVNK  R+  V 
Sbjct  32   RWMKPEVYPLLAAMTFVTSMCVFQLTRNLLGNPDVSILVINFWSENWYRVNKTRRSMAVL  91

Query  276  enyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
            +N EEG+KY EH L KF+R + PEIMP++N  FS  +
Sbjct  92   DNREEGEKYAEHGLRKFLRTRPPEIMPTINHFFSQDK  128



>ref|NP_001050622.2| Os03g0601500 [Oryza sativa Japonica Group]
 gb|EEC75707.1| hypothetical protein OsI_12530 [Oryza sativa Indica Group]
 dbj|BAF12536.2| Os03g0601500 [Oryza sativa Japonica Group]
Length=96

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW+RPEVYP  AAM +A G   FQ  RN+  N  V+++K  R   V ++  E ++Y  H 
Sbjct  3    RWVRPEVYPLMAAMMLASGMVVFQLGRNVCTNPEVKISKRNRRNAVPDSAAEAERYSMHG  62

Query  237  LXKFVRNKSPEIMPSLNRXFSDPQR  163
              +F   + PE+MPS+NR FS+  R
Sbjct  63   FRRFFGRRRPEVMPSINRFFSNSDR  87



>ref|NP_001147337.1| B12D protein [Zea mays]
 gb|ACG26928.1| B12D protein [Zea mays]
Length=88

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            +VYP  AAM    G C FQ  RN+  N  VRV+K  R + V +N  EG++Y +H+  +F+
Sbjct  2    QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  61

Query  222  RNKSPEIMPSLNRXFSDPQRN*LPG  148
              + PE+ P+LN  FSD   N  P 
Sbjct  62   ATQRPEVFPALNSFFSDSNNNNTPA  86



>tpg|DAA63528.1| TPA: b12D protein [Zea mays]
Length=125

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            +VYP  AAM    G C FQ  RN+  N  VRV+K  R + V +N  EG++Y +H+  +F+
Sbjct  39   QVYPLIAAMSFVTGMCVFQLARNVLMNPDVRVSKTSRQSAVLDNAGEGQRYSQHAFRRFL  98

Query  222  RNKSPEIMPSLNRXFSDPQRN*LPG  148
              + PE+ P+LN  FSD   N  P 
Sbjct  99   ATQRPEVFPALNSFFSDSNNNNTPA  123



>ref|XP_002961492.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
 gb|EFJ36752.1| hypothetical protein SELMODRAFT_76981 [Selaginella moellendorffii]
Length=95

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++PEVYP    +  AVG   +   R +  +  VRVNK+ R  G  +N+ EG+ Y  H 
Sbjct  8    RWLKPEVYPLGVFVIGAVGLAAYLSARKLITDPEVRVNKDDRKHGRLDNHSEGEVYHNHP  67

Query  237  LXKFVRNKSPEIMPSLNRXFSDP  169
            L +F+R+K  +IMP LN  FS P
Sbjct  68   LRRFLRDKKTQIMPGLNEYFSKP  90



>gb|EYU29509.1| hypothetical protein MIMGU_mgv1a024878mg [Erythranthe guttata]
Length=90

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  315  VRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQRN  160
            VRVNKE RAAG+ +N++EG KY EH+L K+VRN+ PEIMPSLN  F+DPQ N
Sbjct  39   VRVNKENRAAGILDNFDEGHKYKEHALRKYVRNRKPEIMPSLNSFFTDPQNN  90



>gb|KEH35272.1| NADH-ubiquinone reductase complex 1 MLRQ subunit [Medicago truncatula]
Length=62

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  351  FQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSD  172
             Q +RNI  N  VRV K+ RAAG+ +N++EG+KY +H + +FVR KS EIMPSLN  FSD
Sbjct  1    MQLVRNITTNPEVRVTKQNRAAGILDNHDEGEKYSQHFIRRFVRGKSTEIMPSLNGFFSD  60

Query  171  PQ  166
            P+
Sbjct  61   PK  62



>ref|XP_003601294.1| B12D-like protein [Medicago truncatula]
Length=96

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -2

Query  405  PEVYPXFAAM-GVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXK  229
            P  YP    M G +        I ++      RVNK+ RAAGV EN+ EG+KY EH L K
Sbjct  14   PWKYPFAGEMEGGSTHTYALTSIMDVCSFDGFRVNKQSRAAGVLENFAEGEKYTEHLLRK  73

Query  228  FVRNKSPEIMPSLNRXFSDPQRN  160
            F RN+SPEIMP LN  F+DP RN
Sbjct  74   FSRNRSPEIMPGLNSFFTDPSRN  96



>gb|KGN53786.1| hypothetical protein Csa_4G129030 [Cucumis sativus]
Length=72

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  378  MGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIM  199
            MG     C FQ  RNI  N  VRV K  R  GV +N EEG+KY EHSL +F+R + PEIM
Sbjct  1    MGFVTTMCIFQLTRNILINPDVRVKKSHRRMGVLDNEEEGEKYSEHSLRRFLRTRPPEIM  60

Query  198  PSLNRXFSDPQR  163
            P++N  FS   +
Sbjct  61   PTINHYFSQDHK  72



>gb|EMS53792.1| hypothetical protein TRIUR3_24112 [Triticum urartu]
Length=131

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHS  238
            RW++P+VYP   AM +  G C FQ  RN+  N  VRV+K  R + V EN EEG++Y +H+
Sbjct  3    RWLKPDVYPLIGAMSLVTGMCVFQLTRNVFLNPDVRVSKSNRQSAVPENEEEGERYSQHA  62

Query  237  LXKFVRNKSPEIMPS  193
              +FV    PE  P+
Sbjct  63   FRRFVSAHRPEGFPA  77



>ref|XP_001416807.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95100.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=101

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 9/93 (10%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyx---  247
            RW+RPEVYP FAA+G AVG CGF   R +  +      K  R AG+ E   +  +     
Sbjct  8    RWLRPEVYPIFAAIGGAVGLCGFFCTRQLVASPGFTAAKSRRMAGILETKADFDEGKNWR  67

Query  246  EHSLXKFVRN------KSPEIMPSLNRXFSDPQ  166
            +H + +F+R+        P+I P LN  F   Q
Sbjct  68   DHRVRRFLRSMYGGKGHGPQIFPGLNESFGGGQ  100



>ref|XP_008346823.1| PREDICTED: putative cyclin-B3-1 [Malus domestica]
Length=132

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  315  VRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQRN  160
            +RV KE RAAGV +N+ EG+KY EH L KFVRNK+PEIMP +N  F+DP +N
Sbjct  81   IRVTKENRAAGVLDNHAEGEKYKEHFLRKFVRNKAPEIMPGINAFFTDPSKN  132



>ref|XP_009394678.1| PREDICTED: uncharacterized protein LOC103980120 [Musa acuminata 
subsp. malaccensis]
Length=66

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  312  RVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
            RV+KEGRAAGV +N+ EG+KY EHSL KFVRNK+PEIMP++N  F+ P+
Sbjct  16   RVSKEGRAAGVLDNHAEGEKYAEHSLRKFVRNKNPEIMPAINNFFTRPE  64



>ref|XP_007511902.1| predicted protein [Bathycoccus prasinos]
 emb|CCO65990.1| predicted protein [Bathycoccus prasinos]
Length=96

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxE--  244
            RW+RPEVYP FAA+G AVG C F   R +  +     +K  RA  + E  ++ K+  +  
Sbjct  10   RWLRPEVYPIFAALGSAVGLCAFFCTRQLTTSPGFTASKAKRATAIPETAQDFKEGEKFR  69

Query  243  -HSLXKFVRNKSPEIMPSLN  187
             H + + V    PEIMP LN
Sbjct  70   NHFIRRSVLGMKPEIMPGLN  89



>ref|XP_001772578.1| predicted protein [Physcomitrella patens]
 gb|EDQ62620.1| predicted protein, partial [Physcomitrella patens]
Length=72

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAG  283
            RWI PEVYP    +G AVG CG   +RN   N  VR+NKE RAAG
Sbjct  3    RWIIPEVYPIVLVIGTAVGLCGTAIVRNASINPDVRINKEDRAAG  47



>ref|XP_009351238.1| PREDICTED: uncharacterized protein LOC103942755, partial [Pyrus 
x bretschneideri]
Length=66

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  399  VYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGV  280
            VYP FAA GVA+G CG    R+I  N  VRV+KEGRAAGV
Sbjct  1    VYPLFAATGVAIGICGLSLFRHITINPEVRVSKEGRAAGV  40



>ref|XP_002887135.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63394.1| hypothetical protein ARALYDRAFT_894514 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  315  VRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
            +RV KE R AG+ EN+ +G++Y EHSL KFVRNK+P+IMPS+N  F+DP+
Sbjct  59   IRVTKENRTAGILENHTKGERYAEHSLRKFVRNKAPQIMPSINGFFTDPK  108



>emb|CDX85280.1| BnaC07g25910D [Brassica napus]
Length=72

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -2

Query  378  MGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIM  199
            MG       FQ  RN   N   R++KE R  G+ EN +EG+KY +H+L K++R + P++M
Sbjct  1    MGFVTSMVVFQLTRNALLNPDCRISKENRKMGILENEDEGEKYAQHNLRKYLRTRPPQVM  60

Query  198  PSLNRXFSD  172
            PSLNR FS+
Sbjct  61   PSLNRFFSE  69



>gb|EEC81850.1| hypothetical protein OsI_25618 [Oryza sativa Indica Group]
Length=173

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVR  310
            RWIRPEVYP FA  GVAVG C  Q +RNI  N  VR
Sbjct  4    RWIRPEVYPLFATTGVAVGICAMQLVRNITTNPEVR  39



>ref|XP_002460987.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
 gb|EER97508.1| hypothetical protein SORBIDRAFT_02g038760 [Sorghum bicolor]
Length=76

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  378  MGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIM  199
            M    G C FQ  RN+  N  VRV+K  R + V +N +EG++Y +H+  +F+  + PE+ 
Sbjct  1    MSFVTGMCVFQLTRNVLMNPDVRVSKSHRQSAVLDNADEGQRYSQHAFRRFLSTQRPEVF  60

Query  198  PSLNRXFSD  172
            P+LNR FS+
Sbjct  61   PALNRFFSN  69



>ref|XP_002507620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68878.1| predicted protein [Micromonas sp. RCC299]
Length=99

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -2

Query  414  WIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRA-AGVxenyeegkkyx---  247
            WIRPEVYP  AA+G AV  C F   R I  +   RV K+GRA  G+ E     K+     
Sbjct  13   WIRPEVYPIVAAIGGAVSLCTFFCARQISSSPGFRVWKDGRAHEGIPEEKFRVKEGVNWR  72

Query  246  EHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
            EH + + +R+  P I P LN   + P+
Sbjct  73   EHFVRRAMRDTKPAIFPGLNDAMTSPK  99



>ref|XP_005648934.1| hypothetical protein COCSUDRAFT_52948 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24390.1| hypothetical protein COCSUDRAFT_52948 [Coccomyxa subellipsoidea 
C-169]
Length=84

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAG  283
            +W++PE+YP FAA+G+ +G C +   RN   +  VRV K  RA G
Sbjct  7    QWVKPEIYPLFAALGLGIGACVYSSTRNFLHSPEVRVYKTSRADG  51



>gb|EMS56733.1| Microspherule protein 1 [Triticum urartu]
Length=892

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGV  280
            +VYP FA  GVAVG C  Q +RNI  N  VRV K+ RAAGV
Sbjct  22   QVYPLFATTGVAVGICVMQLVRNITTNPEVRVTKQNRAAGV  62



>ref|XP_002975136.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
 ref|XP_002977540.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ21544.1| hypothetical protein SELMODRAFT_107004, partial [Selaginella 
moellendorffii]
 gb|EFJ23921.1| hypothetical protein SELMODRAFT_102690, partial [Selaginella 
moellendorffii]
Length=81

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  402  EVYPXFAAMGVAVGXCGFQXIRNIXXNXXVRVNKEGRAAGVxenyeegkkyxEHSLXKFV  223
            +VYP  A M  AVG   F  +RN+  N  VRVNK+ R AG+ +N++EGK Y +H+L +++
Sbjct  1    QVYPLIAFMAAAVGLASFVSMRNLTLNPEVRVNKDDRMAGLVQNFKEGKAYHDHALRRYL  60

Query  222  RN-KSPEIMPSLNRXF  178
               K  +I P +N  F
Sbjct  61   YTRKHFQITPGINEYF  76



>ref|NP_001168199.1| uncharacterized protein LOC100381955 [Zea mays]
 gb|ACN27425.1| unknown [Zea mays]
 gb|AFW84880.1| hypothetical protein ZEAMMB73_310499 [Zea mays]
Length=160

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -2

Query  417  RWIRPEVYPXFAAMGVAVGXCGFQXIRNIXXNXXVR  310
            RW++P+VYP F  MGVA+G CG Q   NI  N  VR
Sbjct  99   RWVQPKVYPLFMTMGVAMGICGLQLFWNITGNLEVR  134



>gb|EMS55237.1| hypothetical protein TRIUR3_19745 [Triticum urartu]
Length=64

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  309  VNKEGRAAGVxenyeegkkyxEHSLXKFVRNKSPEIMPSLNRXFSDPQ  166
            VNK GRAAGV EN+EEG++Y EH L  +V++K+PEIMP +N+ F+ P+
Sbjct  17   VNKMGRAAGVLENHEEGRRYAEHGLRAYVQDKTPEIMPGINKFFTSPK  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700