BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF029L02

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57281.1|  protein kinase family protein                          407   3e-138   Ipomoea nil [qian niu]
ref|XP_009802442.1|  PREDICTED: serine/threonine-protein kinase H...    397   2e-134   Nicotiana sylvestris
ref|XP_009628978.1|  PREDICTED: serine/threonine-protein kinase H...    396   9e-134   Nicotiana tomentosiformis
gb|EYU41453.1|  hypothetical protein MIMGU_mgv1a007874mg                392   3e-132   Erythranthe guttata [common monkey flower]
ref|XP_011090685.1|  PREDICTED: serine/threonine-protein kinase H...    390   3e-131   Sesamum indicum [beniseed]
emb|CDO99092.1|  unnamed protein product                                383   1e-128   Coffea canephora [robusta coffee]
ref|XP_010932793.1|  PREDICTED: serine/threonine-protein kinase H...    382   2e-128   
gb|EPS58146.1|  hypothetical protein M569_16670                         381   3e-128   Genlisea aurea
gb|ACU23132.1|  unknown                                                 374   1e-127   Glycine max [soybeans]
ref|XP_002300823.2|  hypothetical protein POPTR_0002s05060g             376   2e-127   
ref|XP_008813069.1|  PREDICTED: serine/threonine-protein kinase HT1     380   2e-127   Phoenix dactylifera
ref|XP_010917790.1|  PREDICTED: serine/threonine-protein kinase HT1     379   2e-127   Elaeis guineensis
ref|XP_003517568.1|  PREDICTED: serine/threonine-protein kinase H...    377   1e-126   Glycine max [soybeans]
ref|XP_010938227.1|  PREDICTED: serine/threonine-protein kinase H...    376   2e-126   Elaeis guineensis
ref|XP_011032655.1|  PREDICTED: serine/threonine-protein kinase H...    376   5e-126   Populus euphratica
ref|XP_003537586.1|  PREDICTED: serine/threonine-protein kinase H...    375   8e-126   Glycine max [soybeans]
ref|XP_002524739.1|  protein kinase atmrk1, putative                    377   1e-125   
ref|XP_002307603.2|  kinase family protein                              375   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_010092417.1|  Serine/threonine-protein kinase HT1                374   3e-125   
ref|XP_008795684.1|  PREDICTED: serine/threonine-protein kinase H...    374   3e-125   Phoenix dactylifera
ref|XP_011073446.1|  PREDICTED: serine/threonine-protein kinase H...    374   5e-125   Sesamum indicum [beniseed]
ref|XP_004511375.1|  PREDICTED: serine/threonine-protein kinase H...    373   7e-125   Cicer arietinum [garbanzo]
ref|XP_006420001.1|  hypothetical protein CICLE_v10005137mg             373   8e-125   Citrus clementina [clementine]
ref|XP_006298274.1|  hypothetical protein CARUB_v10014341mg             368   1e-124   
gb|ABK25384.1|  unknown                                                 372   2e-124   Picea sitchensis
ref|XP_002517090.1|  protein kinase atmrk1, putative                    371   4e-124   Ricinus communis
ref|XP_006360755.1|  PREDICTED: serine/threonine-protein kinase H...    371   4e-124   
gb|KDO68661.1|  hypothetical protein CISIN_1g0487241mg                  367   4e-124   Citrus sinensis [apfelsine]
ref|XP_007223356.1|  hypothetical protein PRUPE_ppa007453mg             370   4e-124   
ref|XP_011462541.1|  PREDICTED: serine/threonine-protein kinase HT1     370   5e-124   Fragaria vesca subsp. vesca
gb|KFK39560.1|  hypothetical protein AALP_AA3G260100                    369   7e-124   Arabis alpina [alpine rockcress]
ref|XP_006489437.1|  PREDICTED: serine/threonine-protein kinase H...    370   7e-124   Citrus sinensis [apfelsine]
ref|XP_010923541.1|  PREDICTED: serine/threonine-protein kinase H...    370   1e-123   Elaeis guineensis
ref|XP_007157110.1|  hypothetical protein PHAVU_002G043600g             370   1e-123   Phaseolus vulgaris [French bean]
ref|XP_008390925.1|  PREDICTED: serine/threonine-protein kinase H...    370   2e-123   Malus domestica [apple tree]
ref|XP_006406131.1|  hypothetical protein EUTSA_v10020938mg             369   3e-123   
ref|XP_009335290.1|  PREDICTED: serine/threonine-protein kinase H...    369   5e-123   Pyrus x bretschneideri [bai li]
ref|XP_008804977.1|  PREDICTED: serine/threonine-protein kinase HT1     368   6e-123   Phoenix dactylifera
ref|XP_008786039.1|  PREDICTED: serine/threonine-protein kinase HT1     368   7e-123   Phoenix dactylifera
ref|XP_011026124.1|  PREDICTED: serine/threonine-protein kinase HT1     367   1e-122   Populus euphratica
gb|KDP40216.1|  hypothetical protein JCGZ_02214                         367   2e-122   Jatropha curcas
ref|XP_002885523.1|  hypothetical protein ARALYDRAFT_898756             366   2e-122   Arabidopsis lyrata subsp. lyrata
gb|KJB46968.1|  hypothetical protein B456_008G003000                    367   2e-122   Gossypium raimondii
ref|XP_008224270.1|  PREDICTED: serine/threonine-protein kinase H...    368   2e-122   Prunus mume [ume]
ref|XP_006444022.1|  hypothetical protein CICLE_v10020502mg             367   2e-122   Citrus clementina [clementine]
ref|XP_007034830.1|  Kinase superfamily protein                         369   2e-122   
ref|XP_010466567.1|  PREDICTED: serine/threonine-protein kinase H...    366   3e-122   Camelina sativa [gold-of-pleasure]
ref|XP_008386459.1|  PREDICTED: serine/threonine-protein kinase HT1     365   5e-122   Malus domestica [apple tree]
ref|XP_007201088.1|  hypothetical protein PRUPE_ppa007037mg             365   5e-122   Prunus persica
ref|XP_008235378.1|  PREDICTED: serine/threonine-protein kinase HT1     365   6e-122   Prunus mume [ume]
ref|XP_009367596.1|  PREDICTED: serine/threonine-protein kinase H...    365   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_009371960.1|  PREDICTED: serine/threonine-protein kinase H...    366   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_010525217.1|  PREDICTED: serine/threonine-protein kinase H...    365   6e-122   Tarenaya hassleriana [spider flower]
gb|KHG26740.1|  Serine/threonine-protein kinase HT1                     365   7e-122   Gossypium arboreum [tree cotton]
ref|XP_009369877.1|  PREDICTED: serine/threonine-protein kinase H...    366   7e-122   Pyrus x bretschneideri [bai li]
ref|XP_010259112.1|  PREDICTED: serine/threonine-protein kinase H...    365   8e-122   Nelumbo nucifera [Indian lotus]
gb|AFK45479.1|  unknown                                                 365   9e-122   Lotus japonicus
ref|XP_008348902.1|  PREDICTED: serine/threonine-protein kinase H...    365   9e-122   
ref|XP_006360752.1|  PREDICTED: serine/threonine-protein kinase H...    365   1e-121   
emb|CDY34236.1|  BnaA01g24530D                                          363   1e-121   Brassica napus [oilseed rape]
ref|XP_009108716.1|  PREDICTED: serine/threonine-protein kinase H...    364   1e-121   Brassica rapa
ref|XP_004963118.1|  PREDICTED: serine/threonine-protein kinase H...    363   1e-121   Setaria italica
ref|NP_566716.1|  protein kinase family protein                         364   2e-121   Arabidopsis thaliana [mouse-ear cress]
gb|ADP37972.1|  protein kinase-like protein                             360   2e-121   Brassica napus [oilseed rape]
ref|XP_010232261.1|  PREDICTED: serine/threonine-protein kinase H...    363   3e-121   Brachypodium distachyon [annual false brome]
ref|XP_003562048.1|  PREDICTED: serine/threonine-protein kinase H...    363   3e-121   Brachypodium distachyon [annual false brome]
gb|ABK06452.1|  flag-tagged protein kinase domain of putative mit...    363   4e-121   synthetic construct
ref|XP_006838998.1|  hypothetical protein AMTR_s00002p00271860          363   4e-121   
ref|XP_004247585.1|  PREDICTED: serine/threonine-protein kinase HT1     363   4e-121   Solanum lycopersicum
ref|XP_007050528.1|  Kinase superfamily protein isoform 1               364   5e-121   
ref|XP_007050529.1|  Kinase superfamily protein isoform 2               364   7e-121   
emb|CDP03662.1|  unnamed protein product                                363   7e-121   Coffea canephora [robusta coffee]
ref|XP_010679276.1|  PREDICTED: cysteine-rich receptor-like prote...    372   7e-121   
dbj|BAJ94876.1|  predicted protein                                      362   1e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007210513.1|  hypothetical protein PRUPE_ppa007019mg             362   1e-120   Prunus persica
emb|CBI28728.3|  unnamed protein product                                362   1e-120   Vitis vinifera
emb|CAN82019.1|  hypothetical protein VITISV_003418                     361   1e-120   Vitis vinifera
ref|XP_010651999.1|  PREDICTED: serine/threonine-protein kinase HT1     362   1e-120   Vitis vinifera
ref|XP_008239746.1|  PREDICTED: serine/threonine-protein kinase H...    362   1e-120   Prunus mume [ume]
gb|KJB23020.1|  hypothetical protein B456_004G077900                    356   2e-120   Gossypium raimondii
ref|XP_006844952.1|  hypothetical protein AMTR_s00058p00169420          360   2e-120   Amborella trichopoda
gb|KHN35167.1|  Pentatricopeptide repeat-containing protein, mito...    372   2e-120   Glycine soja [wild soybean]
ref|XP_003610747.1|  Kinase-like protein                                361   2e-120   Medicago truncatula
ref|XP_009788249.1|  PREDICTED: serine/threonine-protein kinase H...    355   3e-120   Nicotiana sylvestris
gb|KJB11479.1|  hypothetical protein B456_001G261300                    360   4e-120   Gossypium raimondii
ref|XP_010511655.1|  PREDICTED: serine/threonine-protein kinase H...    360   4e-120   Camelina sativa [gold-of-pleasure]
ref|XP_004290624.1|  PREDICTED: serine/threonine-protein kinase HT1     361   4e-120   Fragaria vesca subsp. vesca
ref|XP_003523078.1|  PREDICTED: serine/threonine-protein kinase H...    360   4e-120   Glycine max [soybeans]
emb|CDP02127.1|  unnamed protein product                                360   4e-120   Coffea canephora [robusta coffee]
ref|XP_010251291.1|  PREDICTED: serine/threonine-protein kinase H...    359   5e-120   Nelumbo nucifera [Indian lotus]
gb|KJB23019.1|  hypothetical protein B456_004G077900                    357   5e-120   Gossypium raimondii
tpg|DAA47443.1|  TPA: LOW QUALITY PROTEIN: putative protein kinas...    356   6e-120   
gb|KHN30896.1|  Serine/threonine-protein kinase HT1                     362   7e-120   Glycine soja [wild soybean]
ref|XP_002312543.2|  hypothetical protein POPTR_0008s15580g             360   8e-120   
ref|XP_003527023.1|  PREDICTED: serine/threonine-protein kinase H...    360   8e-120   Glycine max [soybeans]
ref|XP_002283073.1|  PREDICTED: serine/threonine-protein kinase HT1     360   9e-120   Vitis vinifera
ref|XP_004508858.1|  PREDICTED: dual specificity protein kinase z...    360   1e-119   Cicer arietinum [garbanzo]
gb|KJB23017.1|  hypothetical protein B456_004G077900                    359   1e-119   Gossypium raimondii
ref|XP_010024234.1|  PREDICTED: serine/threonine-protein kinase HT1     359   1e-119   Eucalyptus grandis [rose gum]
ref|XP_003525335.1|  PREDICTED: dual specificity protein kinase z...    360   1e-119   Glycine max [soybeans]
gb|AAR01726.1|  putative protein kinase                                 359   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010496560.1|  PREDICTED: serine/threonine-protein kinase H...    356   1e-119   
gb|AGG38032.1|  mitogen activated protein kinase kinase kinase 27       359   1e-119   Oryza sativa Indica Group [Indian rice]
gb|KEH27357.1|  Serine/Threonine kinase family protein                  360   1e-119   Medicago truncatula
ref|XP_007155414.1|  hypothetical protein PHAVU_003G199400g             359   1e-119   Phaseolus vulgaris [French bean]
ref|XP_008443512.1|  PREDICTED: serine/threonine-protein kinase HT1     359   2e-119   Cucumis melo [Oriental melon]
ref|XP_004141085.1|  PREDICTED: serine/threonine-protein kinase H...    359   2e-119   Cucumis sativus [cucumbers]
ref|XP_009613289.1|  PREDICTED: serine/threonine-protein kinase H...    359   2e-119   Nicotiana tomentosiformis
gb|KHN19315.1|  Serine/threonine-protein kinase HT1                     359   2e-119   Glycine soja [wild soybean]
ref|XP_011087151.1|  PREDICTED: serine/threonine-protein kinase H...    358   2e-119   Sesamum indicum [beniseed]
gb|KHG06519.1|  Serine/threonine-protein kinase HT1                     358   2e-119   Gossypium arboreum [tree cotton]
ref|XP_003549630.1|  PREDICTED: dual specificity protein kinase z...    359   2e-119   Glycine max [soybeans]
ref|XP_002314673.2|  hypothetical protein POPTR_0010s09360g             359   2e-119   Populus trichocarpa [western balsam poplar]
gb|KHN18465.1|  Serine/threonine-protein kinase HT1                     359   2e-119   Glycine soja [wild soybean]
ref|XP_009405934.1|  PREDICTED: serine/threonine-protein kinase H...    358   3e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650329.1|  PREDICTED: serine/threonine-protein kinase H...    358   3e-119   Oryza brachyantha
ref|XP_010242982.1|  PREDICTED: serine/threonine-protein kinase H...    358   3e-119   Nelumbo nucifera [Indian lotus]
gb|EAY91142.1|  hypothetical protein OsI_12749                          359   3e-119   Oryza sativa Indica Group [Indian rice]
gb|EAZ27891.1|  hypothetical protein OsJ_11846                          359   3e-119   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72260.1|  hypothetical protein B456_011G167400                    358   3e-119   Gossypium raimondii
ref|XP_010678745.1|  PREDICTED: serine/threonine-protein kinase H...    357   3e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007151088.1|  hypothetical protein PHAVU_004G016900g             357   3e-119   Phaseolus vulgaris [French bean]
ref|NP_001131428.2|  uncharacterized LOC100192758                       358   4e-119   Zea mays [maize]
ref|XP_004138114.1|  PREDICTED: serine/threonine-protein kinase H...    358   5e-119   Cucumis sativus [cucumbers]
ref|XP_008451641.1|  PREDICTED: serine/threonine-protein kinase HT1     353   5e-119   
ref|XP_004241510.1|  PREDICTED: serine/threonine-protein kinase HT1     358   6e-119   Solanum lycopersicum
ref|XP_008453100.1|  PREDICTED: serine/threonine-protein kinase H...    357   6e-119   Cucumis melo [Oriental melon]
ref|XP_008374458.1|  PREDICTED: serine/threonine-protein kinase H...    358   6e-119   Malus domestica [apple tree]
ref|XP_002511419.1|  protein kinase atmrk1, putative                    358   8e-119   Ricinus communis
ref|XP_010496308.1|  PREDICTED: serine/threonine-protein kinase HT1     358   8e-119   Camelina sativa [gold-of-pleasure]
ref|XP_011030650.1|  PREDICTED: serine/threonine-protein kinase HT1     357   8e-119   Populus euphratica
ref|XP_011079887.1|  PREDICTED: serine/threonine-protein kinase HT1     357   9e-119   Sesamum indicum [beniseed]
ref|XP_011026861.1|  PREDICTED: serine/threonine-protein kinase H...    357   1e-118   Populus euphratica
gb|KHN23551.1|  Serine/threonine-protein kinase HT1                     355   1e-118   Glycine soja [wild soybean]
ref|XP_003542696.1|  PREDICTED: serine/threonine-protein kinase H...    356   1e-118   Glycine max [soybeans]
ref|XP_006603815.1|  PREDICTED: serine/threonine-protein kinase HT1     356   1e-118   Glycine max [soybeans]
ref|XP_006299114.1|  hypothetical protein CARUB_v10015255mg             358   1e-118   Capsella rubella
ref|XP_002278739.1|  PREDICTED: serine/threonine-protein kinase HT1     355   2e-118   Vitis vinifera
gb|KJB75695.1|  hypothetical protein B456_012G061300                    353   2e-118   Gossypium raimondii
ref|XP_011071834.1|  PREDICTED: serine/threonine-protein kinase H...    357   2e-118   Sesamum indicum [beniseed]
gb|KJB53126.1|  hypothetical protein B456_008G294700                    351   2e-118   Gossypium raimondii
ref|XP_006439794.1|  hypothetical protein CICLE_v10020546mg             356   2e-118   Citrus clementina [clementine]
ref|XP_009408505.1|  PREDICTED: serine/threonine-protein kinase H...    356   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO69703.1|  hypothetical protein CISIN_1g018489mg                   355   2e-118   Citrus sinensis [apfelsine]
gb|KJB53123.1|  hypothetical protein B456_008G294700                    350   2e-118   Gossypium raimondii
gb|AES91171.2|  Serine/Threonine-kinase HT1-like protein                356   2e-118   Medicago truncatula
ref|XP_006414642.1|  hypothetical protein EUTSA_v10025537mg             355   3e-118   Eutrema salsugineum [saltwater cress]
ref|XP_002318645.1|  kinase family protein                              356   3e-118   Populus trichocarpa [western balsam poplar]
emb|CBI26291.3|  unnamed protein product                                358   3e-118   Vitis vinifera
gb|KCW84187.1|  hypothetical protein EUGRSUZ_B01052                     351   3e-118   Eucalyptus grandis [rose gum]
ref|XP_007036183.1|  Kinase superfamily protein isoform 1               356   3e-118   
emb|CDP12370.1|  unnamed protein product                                357   4e-118   Coffea canephora [robusta coffee]
ref|XP_004146993.1|  PREDICTED: serine/threonine-protein kinase H...    356   4e-118   Cucumis sativus [cucumbers]
ref|XP_007216049.1|  hypothetical protein PRUPE_ppa017603mg             355   4e-118   Prunus persica
ref|XP_010532573.1|  PREDICTED: serine/threonine-protein kinase H...    356   4e-118   Tarenaya hassleriana [spider flower]
gb|KJB75694.1|  hypothetical protein B456_012G061300                    355   4e-118   Gossypium raimondii
ref|XP_009145271.1|  PREDICTED: serine/threonine-protein kinase HT1     355   4e-118   Brassica rapa
emb|CAN64754.1|  hypothetical protein VITISV_010542                     355   6e-118   Vitis vinifera
emb|CBI15048.3|  unnamed protein product                                353   6e-118   Vitis vinifera
ref|XP_002283021.1|  PREDICTED: serine/threonine-protein kinase H...    355   6e-118   Vitis vinifera
gb|AES71542.2|  Serine/Threonine-kinase HT1-like protein                354   7e-118   Medicago truncatula
gb|KJB40735.1|  hypothetical protein B456_007G076700                    352   7e-118   Gossypium raimondii
gb|KDP21418.1|  hypothetical protein JCGZ_21889                         357   7e-118   Jatropha curcas
ref|XP_002322160.1|  kinase family protein                              355   8e-118   Populus trichocarpa [western balsam poplar]
gb|KFK37616.1|  hypothetical protein AALP_AA3G006100                    355   8e-118   Arabis alpina [alpine rockcress]
ref|NP_001142326.1|  uncharacterized protein LOC100274496               354   8e-118   Zea mays [maize]
ref|NP_186798.1|  Protein kinase superfamily protein                    355   9e-118   Arabidopsis thaliana [mouse-ear cress]
gb|KJB53127.1|  hypothetical protein B456_008G294700                    355   9e-118   Gossypium raimondii
ref|XP_010034835.1|  PREDICTED: serine/threonine-protein kinase H...    354   1e-117   
ref|XP_008230622.1|  PREDICTED: serine/threonine-protein kinase HT1     354   1e-117   Prunus mume [ume]
ref|XP_007031440.1|  Kinase superfamily protein isoform 2               354   1e-117   
ref|XP_004298934.1|  PREDICTED: serine/threonine-protein kinase H...    355   1e-117   Fragaria vesca subsp. vesca
gb|KJB40732.1|  hypothetical protein B456_007G076700                    354   1e-117   Gossypium raimondii
gb|KHG08462.1|  Serine/threonine-protein kinase HT1                     354   1e-117   Gossypium arboreum [tree cotton]
gb|ABK06450.1|  flag-tagged protein kinase domain of putative mit...    355   1e-117   synthetic construct
gb|KHN47176.1|  Serine/threonine-protein kinase HT1                     355   2e-117   Glycine soja [wild soybean]
emb|CDY37517.1|  BnaA05g33820D                                          353   2e-117   Brassica napus [oilseed rape]
ref|XP_010029202.1|  PREDICTED: serine/threonine-protein kinase HT1     353   2e-117   Eucalyptus grandis [rose gum]
ref|XP_011098491.1|  PREDICTED: serine/threonine-protein kinase H...    353   2e-117   Sesamum indicum [beniseed]
emb|CDY49058.1|  BnaC05g48860D                                          353   2e-117   Brassica napus [oilseed rape]
ref|XP_008782437.1|  PREDICTED: serine/threonine-protein kinase H...    348   3e-117   
ref|XP_004158316.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    353   3e-117   
ref|XP_010695285.1|  PREDICTED: serine/threonine-protein kinase H...    352   3e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501940.1|  PREDICTED: serine/threonine-protein kinase H...    353   4e-117   Cicer arietinum [garbanzo]
gb|EYU42556.1|  hypothetical protein MIMGU_mgv1a008245mg                353   4e-117   Erythranthe guttata [common monkey flower]
ref|XP_010111765.1|  Serine/threonine-protein kinase HT1                353   4e-117   Morus notabilis
ref|XP_002882179.1|  predicted protein                                  354   4e-117   Arabidopsis lyrata subsp. lyrata
ref|XP_008348029.1|  PREDICTED: serine/threonine-protein kinase H...    347   4e-117   
ref|XP_009147438.1|  PREDICTED: serine/threonine-protein kinase HT1     354   4e-117   Brassica rapa
ref|XP_004236113.1|  PREDICTED: serine/threonine-protein kinase H...    353   4e-117   Solanum lycopersicum
gb|KJB38187.1|  hypothetical protein B456_006G241500                    353   5e-117   Gossypium raimondii
gb|KDP45365.1|  hypothetical protein JCGZ_09614                         352   5e-117   Jatropha curcas
ref|XP_010094284.1|  Serine/threonine-protein kinase HT1                353   5e-117   Morus notabilis
gb|AFK43156.1|  unknown                                                 353   6e-117   Lotus japonicus
ref|XP_006408511.1|  hypothetical protein EUTSA_v10020819mg             353   6e-117   Eutrema salsugineum [saltwater cress]
ref|XP_004982354.1|  PREDICTED: serine/threonine-protein kinase H...    352   7e-117   Setaria italica
emb|CDY08298.1|  BnaA05g13210D                                          352   7e-117   Brassica napus [oilseed rape]
ref|XP_009144699.1|  PREDICTED: serine/threonine-protein kinase H...    352   7e-117   Brassica rapa
gb|KDP31115.1|  hypothetical protein JCGZ_11491                         352   8e-117   Jatropha curcas
ref|XP_010532275.1|  PREDICTED: serine/threonine-protein kinase H...    352   9e-117   Tarenaya hassleriana [spider flower]
gb|KHG05976.1|  Serine/threonine-protein kinase HT1                     352   9e-117   Gossypium arboreum [tree cotton]
gb|EMT33153.1|  Serine/threonine-protein kinase HT1                     349   9e-117   
ref|XP_010524307.1|  PREDICTED: serine/threonine-protein kinase H...    352   1e-116   Tarenaya hassleriana [spider flower]
ref|XP_008782436.1|  PREDICTED: serine/threonine-protein kinase H...    351   1e-116   Phoenix dactylifera
ref|XP_010435069.1|  PREDICTED: serine/threonine-protein kinase H...    351   1e-116   Camelina sativa [gold-of-pleasure]
emb|CDY06483.1|  BnaC06g11610D                                          351   1e-116   
ref|XP_006644420.1|  PREDICTED: serine/threonine-protein kinase H...    346   1e-116   Oryza brachyantha
ref|NP_193214.1|  protein kinase family protein                         351   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449990.1|  PREDICTED: serine/threonine-protein kinase H...    351   1e-116   Camelina sativa [gold-of-pleasure]
gb|ABK06453.1|  flag-tagged protein kinase domain of putative mit...    350   3e-116   synthetic construct
ref|XP_008379254.1|  PREDICTED: serine/threonine-protein kinase H...    350   3e-116   Malus domestica [apple tree]
gb|KEH24853.1|  Serine/Threonine-kinase HT1-like protein                350   4e-116   Medicago truncatula
gb|EYU45671.1|  hypothetical protein MIMGU_mgv1a007529mg                351   4e-116   Erythranthe guttata [common monkey flower]
gb|KJB42143.1|  hypothetical protein B456_007G139200                    350   5e-116   Gossypium raimondii
ref|XP_009134038.1|  PREDICTED: serine/threonine-protein kinase HT1     350   5e-116   Brassica rapa
ref|XP_002865771.1|  hypothetical protein ARALYDRAFT_918001             350   6e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_008812495.1|  PREDICTED: serine/threonine-protein kinase H...    348   6e-116   Phoenix dactylifera
ref|XP_006402198.1|  hypothetical protein EUTSA_v10013816mg             350   6e-116   Eutrema salsugineum [saltwater cress]
ref|XP_010028228.1|  PREDICTED: serine/threonine-protein kinase H...    352   6e-116   Eucalyptus grandis [rose gum]
ref|NP_199811.1|  protein kinase                                        350   7e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489293.1|  PREDICTED: serine/threonine-protein kinase H...    349   8e-116   Cicer arietinum [garbanzo]
emb|CDY21438.1|  BnaC03g27590D                                          350   9e-116   Brassica napus [oilseed rape]
ref|XP_006280611.1|  hypothetical protein CARUB_v10026576mg             349   1e-115   Capsella rubella
ref|XP_010533472.1|  PREDICTED: serine/threonine-protein kinase H...    349   1e-115   Tarenaya hassleriana [spider flower]
gb|ABK06451.1|  flag-tagged protein kinase domain of putative mit...    349   1e-115   synthetic construct
ref|XP_010441391.1|  PREDICTED: serine/threonine-protein kinase H...    349   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010442480.1|  PREDICTED: serine/threonine-protein kinase HT1     349   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_004304609.1|  PREDICTED: serine/threonine-protein kinase HT1     348   2e-115   Fragaria vesca subsp. vesca
ref|XP_010482303.1|  PREDICTED: serine/threonine-protein kinase H...    349   2e-115   Camelina sativa [gold-of-pleasure]
ref|NP_001043682.1|  Os01g0641000                                       348   2e-115   
ref|NP_001132838.1|  uncharacterized LOC100194330                       343   2e-115   
emb|CDM83508.1|  unnamed protein product                                348   2e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006446475.1|  hypothetical protein CICLE_v10015466mg             349   2e-115   Citrus clementina [clementine]
ref|XP_003569430.1|  PREDICTED: serine/threonine-protein kinase H...    348   3e-115   Brachypodium distachyon [annual false brome]
ref|XP_006470349.1|  PREDICTED: serine/threonine-protein kinase H...    349   3e-115   Citrus sinensis [apfelsine]
gb|EEE55065.1|  hypothetical protein OsJ_02781                          348   3e-115   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26634.1|  hypothetical protein AALP_AA8G274000                    348   3e-115   Arabis alpina [alpine rockcress]
ref|XP_004969282.1|  PREDICTED: serine/threonine-protein kinase H...    348   3e-115   Setaria italica
gb|KDO66226.1|  hypothetical protein CISIN_1g015594mg                   348   4e-115   Citrus sinensis [apfelsine]
ref|XP_011012834.1|  PREDICTED: serine/threonine-protein kinase H...    348   4e-115   Populus euphratica
ref|XP_004961129.1|  PREDICTED: serine/threonine-protein kinase H...    348   5e-115   Setaria italica
gb|EMS54076.1|  Serine/threonine-protein kinase HT1                     349   6e-115   Triticum urartu
ref|XP_010440392.1|  PREDICTED: serine/threonine-protein kinase H...    347   6e-115   Camelina sativa [gold-of-pleasure]
ref|XP_011007522.1|  PREDICTED: serine/threonine-protein kinase H...    347   6e-115   Populus euphratica
ref|XP_009609245.1|  PREDICTED: serine/threonine-protein kinase H...    346   6e-115   Nicotiana tomentosiformis
ref|XP_010101194.1|  Serine/threonine-protein kinase HT1                348   6e-115   Morus notabilis
ref|XP_010936750.1|  PREDICTED: serine/threonine-protein kinase H...    346   6e-115   Elaeis guineensis
ref|XP_009801079.1|  PREDICTED: serine/threonine-protein kinase H...    346   7e-115   Nicotiana sylvestris
ref|XP_002300019.1|  kinase family protein                              347   7e-115   Populus trichocarpa [western balsam poplar]
gb|AAM62495.1|  protein kinase                                          347   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925403.1|  PREDICTED: serine/threonine-protein kinase H...    346   9e-115   Elaeis guineensis
ref|NP_001056408.1|  Os05g0577700                                       347   1e-114   
ref|XP_002517344.1|  protein kinase atmrk1, putative                    348   2e-114   
ref|XP_002441568.1|  hypothetical protein SORBIDRAFT_09g029440          345   2e-114   Sorghum bicolor [broomcorn]
gb|KHG04358.1|  Serine/threonine-protein kinase HT1                     344   3e-114   Gossypium arboreum [tree cotton]
ref|XP_009398135.1|  PREDICTED: serine/threonine-protein kinase H...    344   4e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608974.1|  Protein kinase                                     345   6e-114   
ref|XP_002324014.2|  kinase family protein                              345   7e-114   Populus trichocarpa [western balsam poplar]
ref|XP_008387432.1|  PREDICTED: dual specificity protein kinase s...    352   1e-113   
ref|NP_001151897.1|  ATP binding protein                                344   1e-113   Zea mays [maize]
ref|XP_002456035.1|  hypothetical protein SORBIDRAFT_03g029240          344   1e-113   Sorghum bicolor [broomcorn]
ref|XP_008672225.1|  PREDICTED: uncharacterized LOC100194330 isof...    344   1e-113   
ref|XP_009784564.1|  PREDICTED: serine/threonine-protein kinase HT1     343   2e-113   Nicotiana sylvestris
ref|XP_006654831.1|  PREDICTED: serine/threonine-protein kinase H...    343   2e-113   Oryza brachyantha
ref|XP_002870283.1|  hypothetical protein ARALYDRAFT_915359             342   3e-113   Arabidopsis lyrata subsp. lyrata
gb|KJB28365.1|  hypothetical protein B456_005G044700                    342   4e-113   Gossypium raimondii
ref|XP_009609063.1|  PREDICTED: serine/threonine-protein kinase H...    343   5e-113   Nicotiana tomentosiformis
ref|XP_006285018.1|  hypothetical protein CARUB_v10006325mg             341   6e-113   Capsella rubella
ref|XP_003565864.1|  PREDICTED: serine/threonine-protein kinase H...    341   1e-112   Brachypodium distachyon [annual false brome]
gb|KHG19559.1|  Serine/threonine-protein kinase HT1                     339   2e-112   Gossypium arboreum [tree cotton]
gb|KCW79810.1|  hypothetical protein EUGRSUZ_C01141                     337   2e-112   Eucalyptus grandis [rose gum]
gb|EMS51637.1|  Serine/threonine-protein kinase HT1                     343   2e-112   Triticum urartu
gb|EYU29919.1|  hypothetical protein MIMGU_mgv1a022188mg                338   1e-111   Erythranthe guttata [common monkey flower]
gb|EPS67012.1|  hypothetical protein M569_07763                         335   2e-111   Genlisea aurea
ref|XP_009398980.1|  PREDICTED: serine/threonine-protein kinase H...    337   3e-111   
gb|EMT10391.1|  Serine/threonine-protein kinase HT1                     338   4e-111   
ref|XP_008787949.1|  PREDICTED: serine/threonine-protein kinase H...    337   5e-111   Phoenix dactylifera
ref|XP_010551896.1|  PREDICTED: serine/threonine-protein kinase H...    337   6e-111   Tarenaya hassleriana [spider flower]
gb|EMS64705.1|  Serine/threonine-protein kinase HT1                     333   8e-111   Triticum urartu
ref|XP_004496695.1|  PREDICTED: serine/threonine-protein kinase H...    336   2e-110   
ref|XP_010524023.1|  PREDICTED: serine/threonine-protein kinase H...    335   2e-110   
ref|NP_001167923.1|  uncharacterized LOC100381637                       335   4e-110   
dbj|BAK01034.1|  predicted protein                                      334   5e-110   
ref|XP_006341320.1|  PREDICTED: serine/threonine-protein kinase H...    333   8e-110   
ref|XP_004252665.1|  PREDICTED: serine/threonine-protein kinase H...    333   9e-110   
gb|EYU44737.1|  hypothetical protein MIMGU_mgv1a008252mg                332   5e-109   
ref|XP_009367236.1|  PREDICTED: serine/threonine-protein kinase H...    330   6e-109   
gb|AAO72572.1|  putative protein kinase                                 330   3e-108   
ref|XP_010695489.1|  PREDICTED: serine/threonine-protein kinase H...    329   1e-107   
ref|XP_009138650.1|  PREDICTED: serine/threonine-protein kinase HT1     328   2e-107   
emb|CDY53719.1|  BnaAnng12600D                                          327   3e-107   
emb|CDX93916.1|  BnaC04g20750D                                          327   5e-107   
ref|XP_010695487.1|  PREDICTED: serine/threonine-protein kinase H...    327   1e-106   
ref|XP_009116992.1|  PREDICTED: serine/threonine-protein kinase H...    326   1e-106   
ref|NP_191885.1|  protein kinase ATMRK1                                 326   2e-106   
emb|CDY56447.1|  BnaA09g55660D                                          326   2e-106   
ref|XP_002878508.1|  hypothetical protein ARALYDRAFT_486830             326   2e-106   
gb|KFK35486.1|  hypothetical protein AALP_AA5G290700                    325   3e-106   
ref|XP_006402293.1|  hypothetical protein EUTSA_v10006026mg             325   3e-106   
ref|XP_006292989.1|  hypothetical protein CARUB_v10019267mg             325   3e-106   
ref|XP_004134436.1|  PREDICTED: serine/threonine-protein kinase H...    325   3e-106   
gb|ABK06454.1|  flag-tagged protein kinase domain of putative mit...    325   4e-106   
ref|XP_008349491.1|  PREDICTED: serine/threonine-protein kinase H...    322   4e-106   
emb|CAN60343.1|  hypothetical protein VITISV_017020                     322   8e-106   
ref|XP_008438632.1|  PREDICTED: serine/threonine-protein kinase H...    323   1e-105   
gb|AAM63482.1|  ATMRK1                                                  323   2e-105   
ref|XP_010512736.1|  PREDICTED: serine/threonine-protein kinase H...    323   3e-105   
ref|XP_010468868.1|  PREDICTED: serine/threonine-protein kinase H...    323   3e-105   
ref|XP_009370793.1|  PREDICTED: serine/threonine-protein kinase H...    316   8e-105   
ref|XP_010413176.1|  PREDICTED: serine/threonine-protein kinase H...    320   3e-104   
ref|XP_001760569.1|  predicted protein                                  316   6e-104   
gb|KEH43838.1|  tyrosine kinase family protein                          318   1e-103   
ref|XP_001780552.1|  predicted protein                                  315   8e-103   
ref|XP_002979421.1|  hypothetical protein SELMODRAFT_177674             315   9e-103   
ref|XP_002977901.1|  hypothetical protein SELMODRAFT_271276             315   1e-102   
ref|XP_004248828.1|  PREDICTED: serine/threonine-protein kinase H...    313   4e-102   
ref|XP_010327514.1|  PREDICTED: serine/threonine-protein kinase H...    314   7e-102   
ref|XP_003579176.1|  PREDICTED: serine/threonine-protein kinase H...    312   4e-101   
emb|CDX76692.1|  BnaC08g32780D                                          318   9e-100   
ref|XP_007031439.1|  Kinase superfamily protein isoform 1               306   5e-97    
gb|KHN15740.1|  Serine/threonine-protein kinase HT1                     300   8e-97    
gb|EMT06750.1|  Serine/threonine-protein kinase HT1                     298   1e-96    
ref|XP_003555349.1|  PREDICTED: serine/threonine-protein kinase H...    300   3e-96    
ref|XP_006664725.1|  PREDICTED: serine/threonine-protein kinase H...    295   3e-94    
ref|NP_001067227.1|  Os12g0605900                                       294   5e-94    
gb|EAY83813.1|  hypothetical protein OsI_39030                          294   6e-94    
ref|XP_007143297.1|  hypothetical protein PHAVU_007G060400g             291   4e-93    
dbj|BAK07251.1|  predicted protein                                      291   8e-93    
ref|XP_010102379.1|  Methylcrotonoyl-CoA carboxylase subunit alpha      305   5e-92    
gb|KDP26574.1|  hypothetical protein JCGZ_17732                         286   9e-92    
gb|EMT12165.1|  Serine/threonine-protein kinase HT1                     286   2e-90    
ref|XP_009389740.1|  PREDICTED: serine/threonine-protein kinase H...    281   2e-90    
gb|EMS66251.1|  Serine/threonine-protein kinase HT1                     288   6e-89    
ref|XP_006651812.1|  PREDICTED: serine/threonine-protein kinase H...    280   2e-88    
ref|XP_009389742.1|  PREDICTED: serine/threonine-protein kinase H...    276   3e-88    
ref|XP_008237834.1|  PREDICTED: serine/threonine-protein kinase H...    275   3e-87    
ref|XP_007199387.1|  hypothetical protein PRUPE_ppa025876mg             273   7e-87    
ref|XP_002466472.1|  hypothetical protein SORBIDRAFT_01g008340          275   1e-86    
gb|EAY90862.1|  hypothetical protein OsI_12469                          276   1e-86    
dbj|BAJ93563.1|  predicted protein                                      275   1e-86    
dbj|BAK01060.1|  predicted protein                                      275   1e-86    
gb|EMS55472.1|  Serine/threonine-protein kinase HT1                     274   4e-86    
gb|EMT12243.1|  Serine/threonine-protein kinase HT1                     273   9e-86    
ref|XP_004981804.1|  PREDICTED: serine/threonine-protein kinase H...    273   1e-85    
ref|XP_008665404.1|  PREDICTED: serine/threonine-protein kinase H...    273   1e-85    
gb|AAK71566.1|AC087852_26  putative protein kinase                      273   1e-85    
ref|XP_006655138.1|  PREDICTED: serine/threonine-protein kinase H...    271   2e-85    
ref|XP_008345194.1|  PREDICTED: serine/threonine-protein kinase H...    263   2e-85    
ref|XP_010932795.1|  PREDICTED: serine/threonine-protein kinase H...    270   3e-85    
ref|XP_008646500.1|  PREDICTED: serine/threonine-protein kinase H...    270   3e-84    
ref|XP_003559434.2|  PREDICTED: serine/threonine-protein kinase H...    265   3e-84    
ref|XP_007224028.1|  hypothetical protein PRUPE_ppa015144mg             267   4e-84    
ref|XP_004298582.1|  PREDICTED: serine/threonine-protein kinase H...    266   1e-83    
ref|XP_007224201.1|  hypothetical protein PRUPE_ppa017368mg             266   1e-83    
ref|XP_008221867.1|  PREDICTED: serine/threonine-protein kinase H...    265   3e-83    
ref|XP_006655136.1|  PREDICTED: serine/threonine-protein kinase H...    257   2e-80    
ref|XP_010932796.1|  PREDICTED: serine/threonine-protein kinase H...    253   8e-79    
ref|XP_008342006.1|  PREDICTED: serine/threonine-protein kinase H...    253   2e-78    
ref|XP_008353113.1|  PREDICTED: serine/threonine-protein kinase H...    253   3e-78    
gb|AFW67648.1|  putative protein kinase superfamily protein             254   6e-78    
ref|XP_004309026.2|  PREDICTED: serine/threonine-protein kinase H...    248   4e-77    
ref|XP_006662364.1|  PREDICTED: serine/threonine-protein kinase H...    248   9e-77    
ref|XP_006663314.1|  PREDICTED: serine/threonine-protein kinase H...    246   2e-76    
gb|KGN63590.1|  hypothetical protein Csa_1G005510                       239   5e-76    
gb|KCW60698.1|  hypothetical protein EUGRSUZ_H03426                     242   1e-74    
ref|XP_010436728.1|  PREDICTED: serine/threonine-protein kinase H...    242   3e-74    
ref|XP_006664565.1|  PREDICTED: serine/threonine-protein kinase H...    243   3e-74    
gb|KJB38188.1|  hypothetical protein B456_006G241500                    242   4e-74    
ref|XP_011026870.1|  PREDICTED: serine/threonine-protein kinase H...    240   1e-73    
ref|XP_006653213.1|  PREDICTED: serine/threonine-protein kinase H...    240   1e-73    
ref|XP_009589903.1|  PREDICTED: serine/threonine-protein kinase H...    240   1e-73    
ref|XP_007044614.1|  Kinase superfamily protein, putative               239   7e-73    
gb|KDO69704.1|  hypothetical protein CISIN_1g018489mg                   236   1e-72    
ref|XP_011007524.1|  PREDICTED: serine/threonine-protein kinase H...    238   1e-72    
gb|AFW81227.1|  putative protein kinase superfamily protein             236   3e-72    
ref|XP_006655137.1|  PREDICTED: serine/threonine-protein kinase H...    236   3e-72    
ref|XP_006402197.1|  hypothetical protein EUTSA_v10013816mg             235   6e-72    
ref|XP_009799174.1|  PREDICTED: serine/threonine-protein kinase H...    239   1e-71    
gb|KEH31851.1|  Serine/Threonine-kinase HT1-like protein                234   1e-71    
ref|XP_006653214.1|  PREDICTED: serine/threonine-protein kinase H...    228   3e-71    
ref|XP_009801080.1|  PREDICTED: serine/threonine-protein kinase H...    232   1e-70    
ref|XP_006339295.1|  PREDICTED: serine/threonine-protein kinase H...    230   2e-69    
gb|EPS65163.1|  hypothetical protein M569_09615                         227   5e-69    
ref|XP_006341856.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-68    
ref|NP_974483.1|  protein kinase ATMRK1                                 218   4e-65    
gb|EEC69302.1|  hypothetical protein OsI_38367                          216   1e-64    
ref|XP_010319643.1|  PREDICTED: probable LIM domain-containing se...    218   2e-64    
gb|EEE53231.1|  hypothetical protein OsJ_36131                          214   1e-63    
gb|ABA98283.1|  ATMRK1, putative                                        215   2e-63    
ref|XP_002963737.1|  hypothetical protein SELMODRAFT_34528              209   2e-62    
gb|EEE59917.1|  hypothetical protein OsJ_12544                          208   1e-60    
ref|XP_008349494.1|  PREDICTED: serine/threonine-protein kinase H...    204   3e-60    
ref|XP_006353824.1|  PREDICTED: serine/threonine-protein kinase H...    194   5e-57    
ref|XP_006343130.1|  PREDICTED: dual specificity protein kinase z...    197   1e-56    
ref|XP_010319080.1|  PREDICTED: serine/threonine-protein kinase H...    193   6e-56    
gb|AAU87883.1|  serine/threonine protein kinase 1                       186   3e-54    
ref|XP_001770041.1|  predicted protein                                  185   8e-52    
ref|XP_004309028.1|  PREDICTED: serine/threonine-protein kinase H...    182   2e-51    
ref|NP_001051247.2|  Os03g0745700                                       182   3e-51    
ref|XP_001764651.1|  predicted protein                                  183   5e-51    
ref|XP_010928730.1|  PREDICTED: serine/threonine-protein kinase H...    182   1e-50    
gb|ACN41173.1|  unknown                                                 181   3e-50    
ref|XP_008809078.1|  PREDICTED: serine/threonine-protein kinase HT1     181   6e-50    
ref|XP_010099737.1|  Serine/threonine-protein kinase HT1                174   6e-50    
ref|XP_010927157.1|  PREDICTED: serine/threonine-protein kinase H...    180   6e-50    
ref|XP_011093940.1|  PREDICTED: serine/threonine-protein kinase H...    180   9e-50    
ref|NP_001061274.1|  Os08g0224100                                       180   1e-49    
ref|XP_006659220.1|  PREDICTED: serine/threonine-protein kinase H...    180   1e-49    
emb|CDP14242.1|  unnamed protein product                                179   1e-49    
ref|XP_006850997.1|  hypothetical protein AMTR_s00025p00215680          179   3e-49    
ref|XP_011078178.1|  PREDICTED: serine/threonine-protein kinase H...    178   4e-49    
ref|XP_009408070.1|  PREDICTED: serine/threonine-protein kinase H...    178   6e-49    
ref|XP_008781707.1|  PREDICTED: serine/threonine-protein kinase HT1     178   6e-49    
ref|XP_009620133.1|  PREDICTED: serine/threonine-protein kinase H...    177   7e-49    
emb|CDY13414.1|  BnaA03g51320D                                          177   8e-49    
ref|XP_009137995.1|  PREDICTED: serine/threonine-protein kinase H...    177   8e-49    
dbj|BAJ94760.1|  predicted protein                                      177   1e-48    
gb|AAK64576.1|  serine/threonine protein kinase                         177   1e-48    
ref|XP_002970062.1|  hypothetical protein SELMODRAFT_146775             173   1e-48    
ref|XP_010913802.1|  PREDICTED: serine/threonine-protein kinase H...    177   1e-48    
ref|XP_010656692.1|  PREDICTED: serine/threonine-protein kinase H...    176   2e-48    
gb|AFG73671.1|  DPK1                                                    177   2e-48    
gb|ABC54583.1|  serine/threonine protein kinase 1                       176   2e-48    
gb|EMT05716.1|  Serine/threonine-protein kinase HT1                     176   2e-48    
gb|EMS47850.1|  Serine/threonine-protein kinase HT1                     176   2e-48    
gb|ADX30734.1|  protein kinase                                          176   2e-48    
dbj|BAJ92125.1|  predicted protein                                      176   2e-48    
ref|XP_010429415.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-48    
ref|XP_009799013.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-48    
gb|AGA37223.1|  mitogen-activated protein kinase kinase kinase Ra...    176   3e-48    
gb|ABG45945.1|  DSK2                                                    176   3e-48    
ref|XP_010472442.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-48    
ref|XP_008789612.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-48    
ref|XP_009604445.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-48    
emb|CDX72296.1|  BnaC07g43180D                                          176   3e-48    
gb|EYU25771.1|  hypothetical protein MIMGU_mgv1a007364mg                176   3e-48    
ref|XP_010548514.1|  PREDICTED: serine/threonine-protein kinase H...    175   5e-48    
ref|XP_010526285.1|  PREDICTED: serine/threonine-protein kinase H...    175   5e-48    
ref|XP_002985254.1|  hypothetical protein SELMODRAFT_157107             172   5e-48    
ref|XP_009380723.1|  PREDICTED: serine/threonine-protein kinase H...    175   5e-48    
ref|XP_007222679.1|  hypothetical protein PRUPE_ppa006326mg             175   5e-48    
ref|XP_003573566.1|  PREDICTED: serine/threonine-protein kinase H...    175   6e-48    
ref|XP_008224567.1|  PREDICTED: serine/threonine-protein kinase H...    175   6e-48    
ref|XP_004243664.1|  PREDICTED: serine/threonine-protein kinase H...    175   7e-48    
gb|EYU26571.1|  hypothetical protein MIMGU_mgv1a0073062mg               175   9e-48    
ref|XP_002880577.1|  hypothetical protein ARALYDRAFT_900963             174   9e-48    
ref|XP_006353756.1|  PREDICTED: serine/threonine-protein kinase H...    174   9e-48    
ref|XP_006294309.1|  hypothetical protein CARUB_v10023317mg             174   9e-48    
ref|XP_004243673.1|  PREDICTED: serine/threonine-protein kinase H...    174   1e-47    
ref|XP_009787232.1|  PREDICTED: serine/threonine-protein kinase H...    174   1e-47    
ref|XP_004972555.1|  PREDICTED: serine/threonine-protein kinase H...    174   1e-47    
emb|CDY36453.1|  BnaC03g67730D                                          174   1e-47    
ref|NP_001151086.1|  LOC100284719                                       174   1e-47    
emb|CDY23284.1|  BnaA08g12620D                                          174   2e-47    
ref|XP_010247203.1|  PREDICTED: serine/threonine-protein kinase HT1     174   2e-47    
ref|XP_002969869.1|  hypothetical protein SELMODRAFT_146897             174   2e-47    
ref|XP_006404963.1|  hypothetical protein EUTSA_v10000182mg             174   2e-47    
ref|XP_009403297.1|  PREDICTED: serine/threonine-protein kinase H...    174   2e-47    
ref|NP_565568.1|  putative serine/threonine/tyrosine kinase             174   2e-47    
ref|XP_009140540.1|  PREDICTED: serine/threonine-protein kinase HT1     174   2e-47    
ref|XP_008348448.1|  PREDICTED: serine/threonine-protein kinase H...    174   2e-47    
ref|XP_006371836.1|  hypothetical protein POPTR_0018s04090g             174   2e-47    
ref|XP_011006671.1|  PREDICTED: serine/threonine-protein kinase H...    174   3e-47    
ref|XP_008668092.1|  PREDICTED: LOC100284719 isoform X1                 173   3e-47    
ref|XP_010046872.1|  PREDICTED: serine/threonine-protein kinase H...    174   3e-47    
ref|XP_006382214.1|  hypothetical protein POPTR_0006s29430g             173   3e-47    
ref|XP_009117138.1|  PREDICTED: serine/threonine-protein kinase H...    173   3e-47    
ref|XP_010252176.1|  PREDICTED: serine/threonine-protein kinase H...    173   3e-47    
ref|XP_006412622.1|  hypothetical protein EUTSA_v10025332mg             173   3e-47    
ref|XP_004169709.1|  PREDICTED: serine/threonine-protein kinase H...    170   3e-47    
gb|ABK06448.1|  flag-tagged protein kinase domain of putative mit...    173   4e-47    
emb|CDY55246.1|  BnaC02g44950D                                          174   4e-47    
ref|NP_001141376.1|  uncharacterized protein LOC100273467               173   4e-47    
ref|XP_010438071.1|  PREDICTED: serine/threonine-protein kinase H...    173   4e-47    
ref|XP_010046873.1|  PREDICTED: serine/threonine-protein kinase H...    173   4e-47    
ref|XP_010447609.1|  PREDICTED: serine/threonine-protein kinase H...    173   4e-47    
ref|NP_001148926.1|  LOC100282546                                       173   5e-47    
ref|XP_006285418.1|  hypothetical protein CARUB_v10006831mg             173   5e-47    
gb|ACL53806.1|  unknown                                                 173   5e-47    
ref|XP_010432897.1|  PREDICTED: serine/threonine-protein kinase H...    172   5e-47    
ref|XP_002444045.1|  hypothetical protein SORBIDRAFT_07g006320          173   5e-47    
ref|XP_002986767.1|  hypothetical protein SELMODRAFT_43546              169   5e-47    
ref|XP_006652796.1|  PREDICTED: serine/threonine-protein kinase H...    172   6e-47    
ref|NP_194846.1|  protein kinase family protein                         172   6e-47    
gb|AHL77714.1|  mitogen activated kinase kinase kinase Raf22            172   6e-47    
gb|EPS66153.1|  hypothetical protein M569_08620                         172   6e-47    
ref|XP_009127195.1|  PREDICTED: serine/threonine-protein kinase H...    172   7e-47    
ref|NP_001152919.1|  uncharacterized protein LOC100279233               172   7e-47    
ref|XP_009398611.1|  PREDICTED: serine/threonine-protein kinase H...    172   7e-47    
ref|NP_001149811.1|  serine/threonine protein kinase                    172   7e-47    
emb|CDX68725.1|  BnaC01g07280D                                          172   7e-47    
ref|XP_002444043.1|  hypothetical protein SORBIDRAFT_07g006310          172   8e-47    
ref|XP_002448496.1|  hypothetical protein SORBIDRAFT_06g027970          172   9e-47    
ref|XP_006404431.1|  hypothetical protein EUTSA_v10010300mg             174   9e-47    
gb|KDP32482.1|  hypothetical protein JCGZ_13407                         172   9e-47    
ref|XP_007222656.1|  hypothetical protein PRUPE_ppa006319mg             172   9e-47    
ref|XP_008224568.1|  PREDICTED: serine/threonine-protein kinase H...    172   1e-46    
gb|KDP33407.1|  hypothetical protein JCGZ_06978                         172   1e-46    
ref|XP_002969519.1|  hypothetical protein SELMODRAFT_63609              169   1e-46    
gb|ADH59532.1|  serine/threonine/tyrosine protein kinase                172   1e-46    



>dbj|BAO57281.1| protein kinase family protein [Ipomoea nil]
Length=401

 Score =   407 bits (1047),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/195 (99%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR
Sbjct  207  LYKNRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  266

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV
Sbjct  267  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  326

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE
Sbjct  327  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  386

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAPTRGP
Sbjct  387  DQAGGCFCFAPTRGP  401



>ref|XP_009802442.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802443.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802444.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802445.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802446.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=404

 Score =   397 bits (1021),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDT+R LKIADFGVAR
Sbjct  210  LYKNRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTNRTLKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAEV
Sbjct  270  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSL+ IMKKCWDANPDKRPEMDEVV+L+EAIDTSKGGGMIPE
Sbjct  330  SSAVVRQNLRPDIPRCCPSSLSHIMKKCWDANPDKRPEMDEVVKLLEAIDTSKGGGMIPE  389

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAPTRGP
Sbjct  390  DQAGGCFCFAPTRGP  404



>ref|XP_009628978.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628979.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628980.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628981.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628983.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628984.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   396 bits (1017),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKK+AFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDT+R LKIADFGVAR
Sbjct  211  LYKNRKKKVAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTNRTLKIADFGVAR  270

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAEV
Sbjct  271  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEV  330

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSL+ IMKKCWDANPDKRPEMDEVV+L+EAIDTSKGGGMIPE
Sbjct  331  SSAVVRQNLRPDIPRCCPSSLSHIMKKCWDANPDKRPEMDEVVKLVEAIDTSKGGGMIPE  390

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAPTRGP
Sbjct  391  DQAGGCFCFAPTRGP  405



>gb|EYU41453.1| hypothetical protein MIMGU_mgv1a007874mg [Erythranthe guttata]
 gb|EYU41454.1| hypothetical protein MIMGU_mgv1a007874mg [Erythranthe guttata]
Length=392

 Score =   392 bits (1006),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVAR
Sbjct  198  LFKNRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTQRTLKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPY+RKCDVYSFG+CLWEIYCCDLPYPDLSFAEV
Sbjct  258  VEAQNPRDMTGETGTLGYMAPEVLDGKPYDRKCDVYSFGICLWEIYCCDLPYPDLSFAEV  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANP+KRP MDEVVR +EAIDT++GGGMIPE
Sbjct  318  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPEKRPNMDEVVRWLEAIDTTRGGGMIPE  377

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAPTRGP
Sbjct  378  DQAGGCFCFAPTRGP  392



>ref|XP_011090685.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
 ref|XP_011090686.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
 ref|XP_011090687.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=407

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKL FK+VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVAR
Sbjct  213  LYKNRKKKLPFKVVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTQRTLKIADFGVAR  272

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEV
Sbjct  273  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYTDLSFAEV  332

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPSSLA+IMKKCWDANP+KRP+MDEVVRL+EA+DTSKGGGMIPE
Sbjct  333  SSAVVSQNLRPEIPRCCPSSLANIMKKCWDANPEKRPDMDEVVRLLEAVDTSKGGGMIPE  392

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAPTRGP
Sbjct  393  DQAGGCFCFAPTRGP  407



>emb|CDO99092.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K RKKKLAF++VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVAR
Sbjct  210  LFKNRKKKLAFRVVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTYRTLKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEV
Sbjct  270  VEAQNPQDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYTDLSFAEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS LA+IMK+CWDANP+KRP+MDEVVR++E IDTS+GGGMIPE
Sbjct  330  SSAVVRQNLRPEIPRCCPSPLANIMKRCWDANPEKRPDMDEVVRMLEGIDTSRGGGMIPE  389

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCFAP RGP
Sbjct  390  DQAGGCFCFAPARGP  404



>ref|XP_010932793.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010932794.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Elaeis 
guineensis]
Length=390

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+KIVIQLALDL+RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKIVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF EV
Sbjct  256  VEAQNPKDMTGETGTLGYMAPEVLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFVEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDANPDKRPEMDEVV+L+EA DTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANPDKRPEMDEVVKLLEATDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGCFCF P RGP
Sbjct  376  DQVGGCFCFNPARGP  390



>gb|EPS58146.1| hypothetical protein M569_16670, partial [Genlisea aurea]
Length=377

 Score =   381 bits (979),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLD  R LKIADFGVAR
Sbjct  183  LYKNRKKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDQHRTLKIADFGVAR  242

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAE+
Sbjct  243  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEI  302

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP IPRCCPSSL SIMKKCWD+NP++RP MDEVVR++E IDTSKGGGMIPE
Sbjct  303  SSAVVRQNLRPGIPRCCPSSLGSIMKKCWDSNPERRPGMDEVVRMLEGIDTSKGGGMIPE  362

Query  258  DQAGGCFCFAPTRGP  214
            D+AGGCFCFAP RGP
Sbjct  363  DEAGGCFCFAPHRGP  377



>gb|ACU23132.1| unknown [Glycine max]
Length=223

 Score =   374 bits (959),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R++KLA+KIVIQLALDL+RGL+YLHSKKIVHRDVK ENMLLDTSRNLKIADFGVAR
Sbjct  29   LFKSRRRKLAYKIVIQLALDLARGLNYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVAR  88

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  89   VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  148

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPS+LA+IM+KCWDANP+KRPEM+EVVR++EA+DTSKGGGMIPE
Sbjct  149  SSAVVRQNLRPDIPRCCPSALANIMRKCWDANPNKRPEMEEVVRMLEALDTSKGGGMIPE  208

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAPTRGP
Sbjct  209  DQSSGCFCFAPTRGP  223



>ref|XP_002300823.2| hypothetical protein POPTR_0002s05060g [Populus trichocarpa]
 gb|EEE80096.2| hypothetical protein POPTR_0002s05060g [Populus trichocarpa]
Length=291

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  97   LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVAR  156

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  157  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  216

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQ+LRPEIPRCCPSSLAS+M+KCWDANP+KRPEMDEVVRL+EAIDTSKGGGM+PE
Sbjct  217  SSAVVRQHLRPEIPRCCPSSLASVMRKCWDANPEKRPEMDEVVRLLEAIDTSKGGGMLPE  276

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF P RGP
Sbjct  277  DQSTGCLCFTPARGP  291



>ref|XP_008813069.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008813072.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+KIVIQLALDL+RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKIVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVL+GKPYN KCDVYSFG+CLWEIYCCD+PYPDLSF EV
Sbjct  256  VEAQNPKDMTGETGTLGYMAPEVLEGKPYNHKCDVYSFGICLWEIYCCDMPYPDLSFVEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP+SLA+IM+KCWDANPDKRPEMDEVV+L+EAIDT+KGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPNSLANIMRKCWDANPDKRPEMDEVVKLLEAIDTNKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGCFCF P RGP
Sbjct  376  DQVGGCFCFNPARGP  390



>ref|XP_010917790.1| PREDICTED: serine/threonine-protein kinase HT1 [Elaeis guineensis]
Length=390

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+KIVIQLALDL+RGLSYLHSKKIVHRDVK ENMLLDT +NLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKIVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDTQQNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVL+GKPYN +CDVYSFG+CLWEIYCCD+PYPDLSF EV
Sbjct  256  VEAQNPKDMTGETGTLGYMAPEVLEGKPYNHRCDVYSFGICLWEIYCCDMPYPDLSFVEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM++CWDANPDKR EMDEVV+L+EAIDTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRRCWDANPDKRLEMDEVVKLLEAIDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQAGGCFCF PTRGP
Sbjct  376  DQAGGCFCFTPTRGP  390



>ref|XP_003517568.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Glycine 
max]
 ref|XP_006573871.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Glycine 
max]
 ref|XP_006573872.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X3 [Glycine 
max]
 ref|XP_006573873.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X4 [Glycine 
max]
 gb|KHN34113.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=387

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R++KLA+KIVIQLALDL+RGL+YLHSKKIVHRDVK ENMLLDTSRNLKIADFGVAR
Sbjct  193  LFKSRRRKLAYKIVIQLALDLARGLNYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  253  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPS+LA+IM+KCWDANP+KRPEM+EVVR++EA+DTSKGGGMIPE
Sbjct  313  SSAVVRQNLRPDIPRCCPSALANIMRKCWDANPNKRPEMEEVVRMLEALDTSKGGGMIPE  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAPTRGP
Sbjct  373  DQSSGCFCFAPTRGP  387



>ref|XP_010938227.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=386

 Score =   376 bits (966),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R+KKLA+K+VIQLALDLSRGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  193  LFKNRRKKLAYKVVIQLALDLSRGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  253  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LA+IM+KCWDANPDKRP+MDEVVRL+E IDTSKGGGMIPE
Sbjct  313  SSAVVRQNLRPEIPRCCPSALANIMRKCWDANPDKRPDMDEVVRLLEMIDTSKGGGMIPE  372

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF P RGP
Sbjct  373  DQARGCFCF-PYRGP  386



>ref|XP_011032655.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
Length=399

 Score =   376 bits (965),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  205  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDASRTLKIADFGVAR  264

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFAEV
Sbjct  265  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFAEV  324

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQ+LRPEIPRCCPSSLAS+M+KCWDAN +KRPEMDEVVRL+EAIDTSKGGGM+PE
Sbjct  325  SSAVVRQHLRPEIPRCCPSSLASVMRKCWDANSEKRPEMDEVVRLLEAIDTSKGGGMLPE  384

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF P RGP
Sbjct  385  DQSTGCLCFTPARGP  399



>ref|XP_003537586.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Glycine max]
 ref|XP_006590407.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Glycine max]
Length=385

 Score =   375 bits (963),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R++KLA+KIVIQLALDL+RGL+YLHSKKIVHRDVK ENMLL TSRNLKIADFGVAR
Sbjct  191  LFKSRRRKLAYKIVIQLALDLARGLNYLHSKKIVHRDVKTENMLLSTSRNLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  251  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPS+LA+IM+KCWDANP+KRPEM+EVVR++EA+DTSKGGGMIPE
Sbjct  311  SSAVVRQNLRPDIPRCCPSALANIMRKCWDANPNKRPEMEEVVRMLEALDTSKGGGMIPE  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAPTRGP
Sbjct  371  DQSSGCFCFAPTRGP  385



>ref|XP_002524739.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF37582.1| protein kinase atmrk1, putative [Ricinus communis]
Length=444

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  203  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  262

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  263  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  322

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SS VVRQNLRPEIPRCCP+S+ASIM+KCWDANPDKRPEMDEVVRL+EAIDTSKGGGMIPE
Sbjct  323  SSQVVRQNLRPEIPRCCPNSVASIMRKCWDANPDKRPEMDEVVRLLEAIDTSKGGGMIPE  382

Query  258  DQAGGCFCFAPTRG  217
             Q+ GCFCF P RG
Sbjct  383  GQSTGCFCFTPVRG  396



>ref|XP_002307603.2| kinase family protein [Populus trichocarpa]
 gb|EEE94599.2| kinase family protein [Populus trichocarpa]
Length=399

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  205  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVAR  264

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFAEV
Sbjct  265  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFAEV  324

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQ+LRPEIPRCCPSSLAS+M+KCWDAN +KRPEMDEVVRL+EAIDTSKGGGM+PE
Sbjct  325  SSAVVRQHLRPEIPRCCPSSLASVMRKCWDANSEKRPEMDEVVRLLEAIDTSKGGGMLPE  384

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF P RGP
Sbjct  385  DQSTGCLCFTPARGP  399



>ref|XP_010092417.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB51135.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=384

 Score =   374 bits (959),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  190  LIRNRRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRNLKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA++
Sbjct  250  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADI  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWD N DKR EMDEVVRL+EAIDT+KGGGMIPE
Sbjct  310  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDGNADKRLEMDEVVRLLEAIDTTKGGGMIPE  369

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF P RGP
Sbjct  370  DQASGCFCFRPARGP  384



>ref|XP_008795684.1| PREDICTED: serine/threonine-protein kinase HT1-like [Phoenix 
dactylifera]
Length=386

 Score =   374 bits (959),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R+KKLA+KIVIQLALDLSRGLSYLHS+KIVHRDVK ENM+LD  RNLKIADFGVAR
Sbjct  193  LFKNRRKKLAYKIVIQLALDLSRGLSYLHSRKIVHRDVKTENMILDAHRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  253  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LA+IM+KCWDANPDKRP+MDEVVRL+E IDTSKGGGMIPE
Sbjct  313  SSAVVRQNLRPEIPRCCPSALANIMRKCWDANPDKRPDMDEVVRLLEMIDTSKGGGMIPE  372

Query  258  DQAGGCFCFAPTRGP  214
             QA GCFCF P RGP
Sbjct  373  GQARGCFCF-PYRGP  386



>ref|XP_011073446.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=402

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K RKKKLAF++VI+LALDLSRGLSYLHSKKIVHRDVKAENMLLD  R LKIADFGVAR
Sbjct  207  LFKNRKKKLAFRVVIELALDLSRGLSYLHSKKIVHRDVKAENMLLDHHRTLKIADFGVAR  266

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCDLPY D SFAEV
Sbjct  267  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDLPYTDFSFAEV  326

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP-  262
            S AVVRQNLRPEIPRCCPSSLA+IMK+CWDANPDKRP+MDEVVRL+EAIDTSKGGGMIP 
Sbjct  327  SYAVVRQNLRPEIPRCCPSSLANIMKRCWDANPDKRPDMDEVVRLLEAIDTSKGGGMIPD  386

Query  261  EDQAGGCFCFAPTRGP  214
            ED  GGCFCFAPTRGP
Sbjct  387  EDHPGGCFCFAPTRGP  402



>ref|XP_004511375.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Cicer arietinum]
 ref|XP_004511376.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Cicer arietinum]
Length=387

 Score =   373 bits (957),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+K+V+QLALDLSRGLSYLHSKKIVHRDVK ENMLLD SRNLKIADFGVAR
Sbjct  193  LIKNRRKKLAYKVVVQLALDLSRGLSYLHSKKIVHRDVKTENMLLDGSRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  253  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPE+PRCCPS++A+IM+KCWDANP+KRPEMDEVV+++EA+DTSKGGGMIP+
Sbjct  313  SSAVVRQNLRPEMPRCCPSAMANIMRKCWDANPNKRPEMDEVVKMLEALDTSKGGGMIPD  372

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCFAP+RGP
Sbjct  373  DQASGCFCFAPSRGP  387



>ref|XP_006420001.1| hypothetical protein CICLE_v10005137mg [Citrus clementina]
 gb|ESR33241.1| hypothetical protein CICLE_v10005137mg [Citrus clementina]
Length=390

 Score =   373 bits (957),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ R LKIADFGVAR
Sbjct  196  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSQRTLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVL GKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  256  VEAQNPRDMTGETGTLGYMAPEVLQGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDAN +KRPEM EVV+++EAIDTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANAEKRPEMGEVVKMLEAIDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF+P RGP
Sbjct  376  DQATGCFCFSPVRGP  390



>ref|XP_006298274.1| hypothetical protein CARUB_v10014341mg [Capsella rubella]
 gb|EOA31172.1| hypothetical protein CARUB_v10014341mg [Capsella rubella]
Length=281

 Score =   368 bits (945),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  87   LFRNRRKKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDYQRNLKIADFGVAR  146

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  147  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  206

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP++PRCCP+SLA+IMK+CW+ANP+KRPEMDEVVR++EA+DTSKGGGMIPE
Sbjct  207  SSAVVRQNLRPDMPRCCPTSLATIMKRCWEANPEKRPEMDEVVRMLEAVDTSKGGGMIPE  266

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  267  DQISGCFCFVSGRGP  281



>gb|ABK25384.1| unknown [Picea sitchensis]
Length=390

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  196  LIKNRRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCC++PYPDLSFAE+
Sbjct  256  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCEMPYPDLSFAEL  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MKKCWDAN DKRPEMDEVVRL+EAIDTSKGGGMIP 
Sbjct  316  TSAVVRQNLRPEIPRCCPSSLANVMKKCWDANSDKRPEMDEVVRLLEAIDTSKGGGMIPV  375

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF  +RGP
Sbjct  376  DQSQGCLCFGKSRGP  390



>ref|XP_002517090.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF45253.1| protein kinase atmrk1, putative [Ricinus communis]
Length=393

 Score =   371 bits (953),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  199  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  258

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  259  VEAQNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  318

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            S+AVVRQNLRPEIPRCCPSSLA+IM+KCWDAN +KRPEM EVVR++EAIDTSKGGGMIP+
Sbjct  319  STAVVRQNLRPEIPRCCPSSLANIMRKCWDANAEKRPEMAEVVRMLEAIDTSKGGGMIPD  378

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCFAP RGP
Sbjct  379  DQATGCFCFAPARGP  393



>ref|XP_006360755.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X4 
[Solanum tuberosum]
Length=393

 Score =   371 bits (953),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFKIV QLALDL+RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR
Sbjct  198  LYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEV
Sbjct  258  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEV  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP IP+CCPSS+++IMKKCWDANPDKRPEMDEVV+++EAIDT+KGGGMIPE
Sbjct  318  SSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKGGGMIPE  377

Query  258  DQA-GGCFCFAPTRGP  214
            DQ   GCFC   ++GP
Sbjct  378  DQVIQGCFCIVRSKGP  393



>gb|KDO68661.1| hypothetical protein CISIN_1g0487241mg, partial [Citrus sinensis]
Length=281

 Score =   367 bits (942),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + ++KKLAFK+VIQ+ALDL+RGLSYLHSK IVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  87   LIRNKRKKLAFKVVIQIALDLARGLSYLHSKTIVHRDVKTENMLLDANRTLKIADFGVAR  146

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  147  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFTDV  206

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLASIM+KCWDANPDKRP MDEVV+L+EA++TSKGGGMIPE
Sbjct  207  SSAVVRQNLRPDIPRCCPSSLASIMRKCWDANPDKRPVMDEVVKLLEAVNTSKGGGMIPE  266

Query  258  DQAGGCFCFAPTRGP  214
            DQA GC CF PTRGP
Sbjct  267  DQAHGCLCFIPTRGP  281



>ref|XP_007223356.1| hypothetical protein PRUPE_ppa007453mg [Prunus persica]
 gb|EMJ24555.1| hypothetical protein PRUPE_ppa007453mg [Prunus persica]
Length=367

 Score =   370 bits (950),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  173  LIRNRQKKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDTRRNLKIADFGVAR  232

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+V
Sbjct  233  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEVYCCDMPYPDLSFADV  292

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSS ++IM+KCWDAN +KRPEM EVVR++EAIDTSKGGGMIPE
Sbjct  293  SSAVVRQNLRPEIPRCCPSSFSNIMRKCWDANANKRPEMGEVVRMLEAIDTSKGGGMIPE  352

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  353  DRSPGCFCFAPTRGP  367



>ref|XP_011462541.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462542.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=390

 Score =   370 bits (951),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K RKKKLA K+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  196  LIKNRKKKLALKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDIDRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+V
Sbjct  256  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEMYCCDMPYPDLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLAS+M+KCWD N +KRPEMDEVV+++EAIDTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLASVMRKCWDGNANKRPEMDEVVKMLEAIDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            D+  GCFCFAP RGP
Sbjct  376  DKNPGCFCFAPARGP  390



>gb|KFK39560.1| hypothetical protein AALP_AA3G260100 [Arabis alpina]
Length=350

 Score =   369 bits (947),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  156  LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  215

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  216  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  275

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP+SL+SIMKKCWDANP++RPEM+EVV+L+EA+DT+KGGGMIPE
Sbjct  276  SSAVVRQNLRPEIPRCCPTSLSSIMKKCWDANPERRPEMEEVVKLLEAVDTTKGGGMIPE  335

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  336  DQRSGCFCFVSGRGP  350



>ref|XP_006489437.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|KDO74495.1| hypothetical protein CISIN_1g036382mg [Citrus sinensis]
Length=390

 Score =   370 bits (951),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA KIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ R LKIADFGVAR
Sbjct  196  LIRNRRKKLALKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSQRTLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVL GKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  256  VEAQNPRDMTGETGTLGYMAPEVLQGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDAN +KRPEM EVV+++EAIDTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANAEKRPEMGEVVKMLEAIDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF+P RGP
Sbjct  376  DQATGCFCFSPVRGP  390



>ref|XP_010923541.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=390

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+K VIQLALDLSRGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKTVIQLALDLSRGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP LSFA+V
Sbjct  256  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPHLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV+QNLRPEIPRCCPS+LA+IM+KCWDANPDKRP+MD+VVRL+EA+DTSKGGGMIPE
Sbjct  316  SSAVVQQNLRPEIPRCCPSALANIMRKCWDANPDKRPDMDQVVRLLEAMDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
             QA GCFCF P+RGP
Sbjct  376  GQARGCFCFFPSRGP  390



>ref|XP_007157110.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 ref|XP_007157111.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 gb|ESW29104.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 gb|ESW29105.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
Length=387

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+K+V+QLALDL+RGLSYLHSKKIVHRDVK+ENMLL+ SRNLKIADFGVAR
Sbjct  193  LIKNRRKKLAYKVVVQLALDLARGLSYLHSKKIVHRDVKSENMLLNPSRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  253  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVR NLRP+IPRCCPSSLA+IM+KCWDANP+KRPEM+EVV+++EA+DTSKGGGMIPE
Sbjct  313  SSAVVRHNLRPDIPRCCPSSLANIMRKCWDANPNKRPEMEEVVKMLEALDTSKGGGMIPE  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAPTRGP
Sbjct  373  DQSPGCFCFAPTRGP  387



>ref|XP_008390925.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Malus 
domestica]
Length=406

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVAR
Sbjct  212  LIRNRQKKLAFKVVIQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVAR  271

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  272  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  331

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIP+CCPSSLASIM+KCWD N DKRPEM EVV+++E IDTSKGGGMIPE
Sbjct  332  SSAVVRQNLRPEIPKCCPSSLASIMRKCWDGNADKRPEMGEVVKMLEVIDTSKGGGMIPE  391

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  392  DRSPGCFCFAPTRGP  406



>ref|XP_006406131.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 ref|XP_006406132.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 gb|ESQ47584.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 gb|ESQ47585.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
Length=378

 Score =   369 bits (946),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  184  LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP+SL+SIMKKCW+ANP+KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  304  SSAVVRQNLRPEIPRCCPTSLSSIMKKCWEANPEKRPEMEEVVKMLEGVDTSKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  364  DQRSGCFCFVSGRGP  378



>ref|XP_009335290.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   369 bits (946),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVAR
Sbjct  212  LIRNRQKKLAFKVVIQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVAR  271

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  272  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  331

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIP+CCPSSLA+IM+KCWD N DKRPEM EVV+++E IDTSKGGGMIPE
Sbjct  332  SSAVVRQNLRPEIPKCCPSSLANIMRKCWDGNADKRPEMGEVVKMLEVIDTSKGGGMIPE  391

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  392  DRSPGCFCFAPTRGP  406



>ref|XP_008804977.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804978.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804979.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804980.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   368 bits (944),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+KIVIQLALDL+RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKIVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVL+GKPYN +CDVYSFG+CLWEIYCCD+PYPDLSF EV
Sbjct  256  VEAQNPQDMTGETGTLGYMAPEVLEGKPYNHRCDVYSFGICLWEIYCCDMPYPDLSFVEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDANPDKR E  EVV+L+EAIDTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANPDKRLEAVEVVKLLEAIDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGC CF  TRGP
Sbjct  376  DQVGGCLCFNRTRGP  390



>ref|XP_008786039.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   368 bits (944),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+KIVIQLALDLSRGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  196  LIKNRRKKLAYKIVIQLALDLSRGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFAEV
Sbjct  256  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFAEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPS+LA+IM+KC DANPDKRP+MDEVVRL+EA+DTSKGGGMIPE
Sbjct  316  SSAVVWQNLRPEIPRCCPSALANIMRKCCDANPDKRPDMDEVVRLLEAVDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF  +RGP
Sbjct  376  DQARGCFCFIRSRGP  390



>ref|XP_011026124.1| PREDICTED: serine/threonine-protein kinase HT1 [Populus euphratica]
Length=400

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQL+LDLSRGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  205  LIRNRRKKLAFKIVIQLSLDLSRGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVAR  264

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA-E  442
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPD SFA E
Sbjct  265  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDPSFASE  324

Query  441  VSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP  262
            VSSAVVRQ+LRPEIPRCCPSSLAS+M+KCWDANP+KRPEMDEVV L+EAIDTSKGGGM+P
Sbjct  325  VSSAVVRQHLRPEIPRCCPSSLASVMRKCWDANPEKRPEMDEVVGLLEAIDTSKGGGMLP  384

Query  261  EDQAGGCFCFAPTRGP  214
            EDQ+ GC CF+P RGP
Sbjct  385  EDQSTGCLCFSPARGP  400



>gb|KDP40216.1| hypothetical protein JCGZ_02214 [Jatropha curcas]
Length=387

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R++KLA+K+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  192  LIRNRRRKLAYKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  252  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIM+KCWDANP+KRPEM +VVR++E IDTSKGGGMIP+
Sbjct  312  SSAVVRQNLRPEIPRCCPSSLASIMRKCWDANPEKRPEMSDVVRMLENIDTSKGGGMIPD  371

Query  258  DQA-GGCFCFAPTRGP  214
            D + GGCFCFAP RGP
Sbjct  372  DHSPGGCFCFAPARGP  387



>ref|XP_002885523.1| hypothetical protein ARALYDRAFT_898756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61782.1| hypothetical protein ARALYDRAFT_898756 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  184  LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SLA+IMK+CW+ANP+KRPEM+EVVRL+EA+DTSKGGGMIPE
Sbjct  304  SSAVVRQNLRPDIPRCCPTSLATIMKRCWEANPEKRPEMEEVVRLLEAVDTSKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF   RGP
Sbjct  364  DQRPACFCFVSGRGP  378



>gb|KJB46968.1| hypothetical protein B456_008G003000 [Gossypium raimondii]
Length=390

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  197  LIRNRRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDTRRNLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DL+FAEV
Sbjct  257  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLTFAEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP SLASIM+KCWDA+PD+RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  317  SSAVVRQNLRPEIPRCCPGSLASIMRKCWDAHPDRRPDMDEVVRLLEAVDTSKGGGMIPD  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  377  DQSPGCFCFT-RRGP  390



>ref|XP_008224270.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=423

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDL+RGL YLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  229  LIRNRQKKLAFKVVIQLALDLARGLCYLHSQKIVHRDVKTENMLLDTRRNLKIADFGVAR  288

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+V
Sbjct  289  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEVYCCDMPYPDLSFADV  348

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSS ++IM+KCWDAN +KRPEM EVVR++E IDTSKGGGMIPE
Sbjct  349  SSAVVRQNLRPEIPRCCPSSFSNIMRKCWDANANKRPEMGEVVRMLETIDTSKGGGMIPE  408

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  409  DRSPGCFCFAPTRGP  423



>ref|XP_006444022.1| hypothetical protein CICLE_v10020502mg [Citrus clementina]
 ref|XP_006479679.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|ESR57262.1| hypothetical protein CICLE_v10020502mg [Citrus clementina]
Length=394

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + ++KKLAFK+VIQ+ALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  200  LIRNKRKKLAFKVVIQIALDLARGLSYLHSKKIVHRDVKTENMLLDANRTLKIADFGVAR  259

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  260  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFTDV  319

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLASIM+KCWDANPDKRP MDEVV+L+EA++T+KGGGMIPE
Sbjct  320  SSAVVRQNLRPDIPRCCPSSLASIMRKCWDANPDKRPVMDEVVKLLEAVNTNKGGGMIPE  379

Query  258  DQAGGCFCFAPTRGP  214
             QA GC CF PTRGP
Sbjct  380  GQAHGCLCFIPTRGP  394



>ref|XP_007034830.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY05756.1| Kinase superfamily protein [Theobroma cacao]
Length=477

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  199  LIRNRRKKLAFKVVVQLALDLSRGLSYLHSRKIVHRDVKTENMLLDIHRNLKIADFGVAR  258

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  259  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  318

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIM+KCWDANP+KRPEMDEVVR++EA+DTSKGGGMIP+
Sbjct  319  SSAVVRQNLRPEIPRCCPSSLASIMRKCWDANPEKRPEMDEVVRMLEAVDTSKGGGMIPD  378

Query  258  DQAGGCFCFAPTRGP*GFSTP  196
            D    CFCFAP R    +S+P
Sbjct  379  DHTPACFCFAPARVVVSYSSP  399



>ref|XP_010466567.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=379

 Score =   366 bits (939),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFKIVIQLALDL+RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  185  LFRNRRKKLAFKIVIQLALDLARGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  245  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+S A+IMK+CW+ANP+KRPEM+EVVR++EA+DTSKGGGMIPE
Sbjct  305  SSAVVRQNLRPDIPRCCPTSFATIMKRCWEANPEKRPEMEEVVRMLEAVDTSKGGGMIPE  364

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  365  DQRPGCFCFVSGRGP  379



>ref|XP_008386459.1| PREDICTED: serine/threonine-protein kinase HT1 [Malus domestica]
Length=378

 Score =   365 bits (937),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLS+GLSYLH+KKIVHRDVK ENMLLDT R LKIADFGVAR
Sbjct  184  LIRNRRKKLAFKVVIQLALDLSKGLSYLHTKKIVHRDVKTENMLLDTHRTLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  244  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LAS+M+KCWDA+PDKRPEM+EVV+L+ AIDTSKGGGMIPE
Sbjct  304  SSAVVRQNLRPEIPRCCPSTLASVMRKCWDASPDKRPEMEEVVKLLYAIDTSKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  364  DQSTGCFCFGTPRGP  378



>ref|XP_007201088.1| hypothetical protein PRUPE_ppa007037mg [Prunus persica]
 gb|EMJ02287.1| hypothetical protein PRUPE_ppa007037mg [Prunus persica]
Length=385

 Score =   365 bits (938),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLS+GLSYLHSKKIVHRDVK ENMLLDT R LKIADFGVAR
Sbjct  191  LIRNRRKKLAFKVVIQLALDLSKGLSYLHSKKIVHRDVKTENMLLDTHRTLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  251  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP++LAS+M+KCWD +PDKRPEM+EVV+L+ AIDTSKGGGMIPE
Sbjct  311  SSAVVRQNLRPEIPRCCPTALASVMRKCWDVSPDKRPEMEEVVKLLYAIDTSKGGGMIPE  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  371  DQSTGCFCFGKRRGP  385



>ref|XP_008235378.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
Length=385

 Score =   365 bits (938),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLS+GLSYLHSKKIVHRDVK ENMLLDT R LKIADFGVAR
Sbjct  191  LIRNRRKKLAFKVVIQLALDLSKGLSYLHSKKIVHRDVKTENMLLDTHRTLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  251  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP++L SIM+KCWD +PDKRPEM+EVV+L+ AIDTSKGGGMIPE
Sbjct  311  SSAVVRQNLRPEIPRCCPTALVSIMRKCWDVSPDKRPEMEEVVKLLYAIDTSKGGGMIPE  370

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  371  DQATGCFCFGKRRGP  385



>ref|XP_009367596.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=378

 Score =   365 bits (937),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLS+GLSYLH+KKIVHRDVK ENMLLDT R LKIADFGVAR
Sbjct  184  LIRNRRKKLAFKVVIQLALDLSKGLSYLHAKKIVHRDVKTENMLLDTHRTLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  244  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LAS+M+KCWDA+PDKRPEM+EVV+L+ AIDTSKGGGMIPE
Sbjct  304  SSAVVRQNLRPEIPRCCPSTLASVMRKCWDASPDKRPEMEEVVKLLYAIDTSKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  364  DQSTGCFCFGTPRGP  378



>ref|XP_009371960.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R KKLAFK+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVAR
Sbjct  212  LIRNRHKKLAFKVVVQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVAR  271

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  272  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  331

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIP+CCPSSLA+IM+ CWD N DKRPEM EVV ++EAIDTSKGGGMIPE
Sbjct  332  SSAVVRQNLRPEIPKCCPSSLANIMRMCWDGNADKRPEMGEVVNMLEAIDTSKGGGMIPE  391

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  392  DRSPGCFCFAPTRGP  406



>ref|XP_010525217.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
 ref|XP_010525218.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=394

 Score =   365 bits (938),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA+K+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLDTSRNLKIADFGVAR
Sbjct  200  LIRNRRKKLAYKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVAR  259

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF +V
Sbjct  260  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVQV  319

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP++LA+IMK+CW+ N +KRPEM++VVR++E +DTSKGGGMIPE
Sbjct  320  SSAVVRQNLRPDIPRCCPTALANIMKRCWEGNAEKRPEMEDVVRMLEGLDTSKGGGMIPE  379

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP+RGP
Sbjct  380  DQSSGCFCFAPSRGP  394



>gb|KHG26740.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=390

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  197  LIRNRRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDARRNLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSFAEV
Sbjct  257  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFAEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP SLASIM+KCWDA+PD+RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  317  SSAVVRQNLRPEIPRCCPGSLASIMRKCWDAHPDRRPDMDEVVRLLEAVDTSKGGGMIPD  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  377  DQSPGCFCFT-RRGP  390



>ref|XP_009369877.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   366 bits (939),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R KKLAFK+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVAR
Sbjct  212  LIRNRHKKLAFKVVVQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVAR  271

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  272  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  331

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIP+CCPSSLA+IM+ CWD N DKRPEM EVV ++EAIDTSKGGGMIPE
Sbjct  332  SSAVVRQNLRPEIPKCCPSSLANIMRMCWDGNADKRPEMGEVVNMLEAIDTSKGGGMIPE  391

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  392  DRSPGCFCFAPTRGP  406



>ref|XP_010259112.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=388

 Score =   365 bits (937),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 184/196 (94%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA+KIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVAR
Sbjct  193  LIRNRRKKLAYKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSF+EV
Sbjct  253  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP+S A+IM+KCWDAN D+RPEMDEVVRL+EA+DTS+GGGMIPE
Sbjct  313  SSAVVRQNLRPEIPRCCPNSFANIMRKCWDANADRRPEMDEVVRLLEAVDTSRGGGMIPE  372

Query  258  DQA-GGCFCFAPTRGP  214
            DQ   GCFCF+  RGP
Sbjct  373  DQVPHGCFCFSAARGP  388



>gb|AFK45479.1| unknown [Lotus japonicus]
Length=386

 Score =   365 bits (936),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+K+V+QLAL+LSRGLSYLHS+KIVHRDVK+ENMLLD +RNLKIADFGVAR
Sbjct  192  LIKNRRKKLAYKVVVQLALELSRGLSYLHSQKIVHRDVKSENMLLDGNRNLKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP LSFA+V
Sbjct  252  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPYLSFADV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPS+L+SIM+KCWD NP+KRPEMDEVVR++EA+DTSKGGGMIPE
Sbjct  312  SSAVVHQNLRPEIPRCCPSALSSIMRKCWDGNPNKRPEMDEVVRMLEALDTSKGGGMIPE  371

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF P+RGP
Sbjct  372  DQATGCFCFTPSRGP  386



>ref|XP_008348902.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=382

 Score =   365 bits (936),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R KKLAFK+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVAR
Sbjct  188  LIRNRHKKLAFKVVVQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVAR  247

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  248  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  307

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIP+CCPSSLA+IM+ CWD N DKRPEM  VV+L+EAIDTSKGGGMIPE
Sbjct  308  SSAVVRQNLRPEIPKCCPSSLANIMRMCWDGNADKRPEMGXVVKLLEAIDTSKGGGMIPE  367

Query  258  DQAGGCFCFAPTRGP  214
            D++ GCFCFAPTRGP
Sbjct  368  DRSPGCFCFAPTRGP  382



>ref|XP_006360752.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006360753.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Solanum tuberosum]
 ref|XP_006360754.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Solanum tuberosum]
Length=395

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFKIV QLALDL+RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR
Sbjct  198  LYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEV
Sbjct  258  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEV  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP IP+CCPSS+++IMKKCWDANPDKRPEMDEVV+++EAIDT+KGGGMIPE
Sbjct  318  SSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKGGGMIPE  377

Query  258  DQA-GGCFCFA  229
            DQ   GCFC  
Sbjct  378  DQVIQGCFCIV  388



>emb|CDY34236.1| BnaA01g24530D [Brassica napus]
Length=350

 Score =   363 bits (932),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R++KLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  156  LFRNRRRKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  215

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  216  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  275

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SL+SIMKKCW+ANP+KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  276  SSAVVRQNLRPDIPRCCPTSLSSIMKKCWEANPEKRPEMEEVVKMLEGVDTSKGGGMIPE  335

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  336  DQRPGCFCFVSGRGP  350



>ref|XP_009108716.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brassica 
rapa]
 emb|CDY55265.1| BnaCnng28670D [Brassica napus]
Length=380

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R++KLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  186  LFRNRRRKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  245

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  246  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  305

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SL+SIMKKCW+ANP+KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  306  SSAVVRQNLRPDIPRCCPTSLSSIMKKCWEANPEKRPEMEEVVKMLEGVDTSKGGGMIPE  365

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  366  DQRPGCFCFVSGRGP  380



>ref|XP_004963118.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=366

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+Q+ALDL+RGLSYLH++KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  172  LIKNRRRKLAYKVVVQIALDLARGLSYLHARKIVHRDVKTENMLLDTQRNLKIADFGVAR  231

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  232  VEAQNPKDMTGATGTLGYMAPEVLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  291

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS++A+IM+KCWDANPDKRP+MDEVVRLMEA+DTSKGGGMIPE
Sbjct  292  SSAVVHQNLRPDIPRCCPSAMANIMRKCWDANPDKRPDMDEVVRLMEALDTSKGGGMIPE  351

Query  258  DQAGGCFCFAPTRGP  214
             QAGGC CF   RGP
Sbjct  352  GQAGGCLCFFRARGP  366



>ref|NP_566716.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01250.1| kinase-like protein [Arabidopsis thaliana]
 gb|AAK59509.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34187.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76673.1| protein kinase family protein [Arabidopsis thaliana]
Length=378

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  184  LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP++LA+IMK+CW+ANP+KRPEM+EVV L+EA+DT+KGGGMIPE
Sbjct  304  SSAVVRQNLRPDIPRCCPTALATIMKRCWEANPEKRPEMEEVVSLLEAVDTTKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  364  DQRPGCFCFVSGRGP  378



>gb|ADP37972.1| protein kinase-like protein [Brassica napus]
Length=303

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R++KLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  109  LFRNRRRKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  168

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPD SFA+V
Sbjct  169  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDFSFADV  228

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SL+SIMKKCW+ANP+KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  229  SSAVVRQNLRPDIPRCCPTSLSSIMKKCWEANPEKRPEMEEVVKMLEGVDTSKGGGMIPE  288

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  289  DQRPGCFCFVSGRGP  303



>ref|XP_010232261.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=376

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  182  LIKNRRRKLAYKVVVQLALDLSRGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  241

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  242  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  301

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+LMEA+DTSKGGGMIP+
Sbjct  302  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLMEALDTSKGGGMIPD  361

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  362  GQSSGCLCFTRARGP  376



>ref|XP_003562048.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=376

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  182  LIKNRRRKLAYKVVVQLALDLSRGLSYLHSQKIVHRDVKTENMLLDTQRNLKIADFGVAR  241

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  242  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  301

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+LMEA+DTSKGGGMIP+
Sbjct  302  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLMEALDTSKGGGMIPD  361

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  362  GQSSGCLCFTRARGP  376



>gb|ABK06452.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=389

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  184  LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP++LA+IMK+CW+ANP+KRPEM+EVV L+EA+DT+KGGGMIPE
Sbjct  304  SSAVVRQNLRPDIPRCCPTALATIMKRCWEANPEKRPEMEEVVSLLEAVDTTKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  364  DQRPGCFCFVSGRGP  378



>ref|XP_006838998.1| hypothetical protein AMTR_s00002p00271860 [Amborella trichopoda]
 gb|ERN01567.1| hypothetical protein AMTR_s00002p00271860 [Amborella trichopoda]
Length=398

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  203  LIKNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDASRTLKIADFGVAR  262

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVL+GKPYNR+CDVYSFG+CLWEIYCC++PYPDLSFAEV
Sbjct  263  VEAQNPKDMTGETGTLGYMAPEVLNGKPYNRRCDVYSFGICLWEIYCCEMPYPDLSFAEV  322

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            S+AVVRQNLRPEIPRCCPSSL ++M+KCWDAN +KRP+MDEVVRL+EAIDTSKGGGMIP+
Sbjct  323  SAAVVRQNLRPEIPRCCPSSLVNVMRKCWDANSEKRPDMDEVVRLLEAIDTSKGGGMIPD  382

Query  258  DQAG-GCFCFAPTRGP  214
            DQA  GCFC    RGP
Sbjct  383  DQAAHGCFCLGKHRGP  398



>ref|XP_004247585.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326681.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326682.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326683.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326684.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=395

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKLAFKIV QLALDL+RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR
Sbjct  198  LYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEV
Sbjct  258  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEV  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP IP+CCPSS+++IMKKCWDANPDKRPEMDEVV+++E IDT+KGGGMIPE
Sbjct  318  SSAVVRQNLRPNIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEVIDTNKGGGMIPE  377

Query  258  DQA-GGCFCFA  229
            DQ   GCFC  
Sbjct  378  DQVIQGCFCIV  388



>ref|XP_007050528.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94685.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=424

 Score =   364 bits (935),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  231  LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDPRRTLKIADFGVAR  290

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSFAEV
Sbjct  291  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFAEV  350

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIM+KCWDA+P++RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  351  SSAVVRQNLRPEIPRCCPSSLASIMRKCWDAHPERRPDMDEVVRLLEAVDTSKGGGMIPD  410

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  411  DQAPGCFCFT-ARGP  424



>ref|XP_007050529.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94686.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=432

 Score =   364 bits (935),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  239  LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDPRRTLKIADFGVAR  298

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSFAEV
Sbjct  299  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFAEV  358

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLASIM+KCWDA+P++RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  359  SSAVVRQNLRPEIPRCCPSSLASIMRKCWDAHPERRPDMDEVVRLLEAVDTSKGGGMIPD  418

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  419  DQAPGCFCFT-ARGP  432



>emb|CDP03662.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   363 bits (931),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAFK+VIQLALDLSRGLSYLHSKK VHRDVK+ENMLL+ +R LKIADFGVAR
Sbjct  198  LIRNYRKKLAFKVVIQLALDLSRGLSYLHSKKFVHRDVKSENMLLNANRTLKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA++
Sbjct  258  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADL  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCP +LAS+M+KCWDANPDKRPEMDEVVRL+ AIDTSKGGGM+PE
Sbjct  318  SSAVVNQNLRPEIPRCCPGALASVMRKCWDANPDKRPEMDEVVRLLAAIDTSKGGGMVPE  377

Query  258  DQAGGCFCFAPTRGP  214
            D A GCFCF P RGP
Sbjct  378  DLARGCFCFGPKRGP  392



>ref|XP_010679276.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 [Beta 
vulgaris subsp. vulgaris]
Length=679

 Score =   372 bits (955),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + RK+KLA K+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLDT+RNLKIADFGVAR
Sbjct  484  LIRNRKRKLAIKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDTNRNLKIADFGVAR  543

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  544  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  603

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPE+PRCCP SLASIM+KCWDANPDKRP+MD VVRL+EA DTSKGGGMIP+
Sbjct  604  SSAVVRQNLRPEMPRCCPPSLASIMRKCWDANPDKRPDMDVVVRLLEAFDTSKGGGMIPD  663

Query  258  DQA-GGCFCFAPTRGP  214
            DQA   CFCF PTRGP
Sbjct  664  DQAVQSCFCFGPTRGP  679



>dbj|BAJ94876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  179  LIKNRRRKLAYKVVVQLALDLSRGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  238

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  239  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  298

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS+ A+IM+KCWD NPDKRP+MDEVV+LMEA+DTSKGGGMIP+
Sbjct  299  SSAVVHQNLRPDIPRCCPSAFANIMRKCWDGNPDKRPDMDEVVQLMEALDTSKGGGMIPD  358

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  359  GQSSGCLCFTRARGP  373



>ref|XP_007210513.1| hypothetical protein PRUPE_ppa007019mg [Prunus persica]
 gb|EMJ11712.1| hypothetical protein PRUPE_ppa007019mg [Prunus persica]
Length=385

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRKKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRVVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP+
Sbjct  311  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPQ  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  371  DQSQGCFCFRKMRGP  385



>emb|CBI28728.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  210  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++
Sbjct  270  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADI  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLASIM+KCWD NPDKRP+MDEVVRL+EAIDTSKGGGMIPE
Sbjct  330  SSAVVRQNLRPDIPRCCPSSLASIMRKCWDGNPDKRPDMDEVVRLLEAIDTSKGGGMIPE  389

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C  F+  RGP
Sbjct  390  DQVSSCCFFSVARGP  404



>emb|CAN82019.1| hypothetical protein VITISV_003418 [Vitis vinifera]
Length=368

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  174  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  233

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++
Sbjct  234  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADI  293

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLASIM+KCWD NPDKRP+MDEVVRL+EAIDTSKGGGMIPE
Sbjct  294  SSAVVRQNLRPDIPRCCPSSLASIMRKCWDGNPDKRPDMDEVVRLLEAIDTSKGGGMIPE  353

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C  F+  RGP
Sbjct  354  DQVSSCCFFSVARGP  368



>ref|XP_010651999.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
Length=406

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  212  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  271

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++
Sbjct  272  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADI  331

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLASIM+KCWD NPDKRP+MDEVVRL+EAIDTSKGGGMIPE
Sbjct  332  SSAVVRQNLRPDIPRCCPSSLASIMRKCWDGNPDKRPDMDEVVRLLEAIDTSKGGGMIPE  391

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C  F+  RGP
Sbjct  392  DQVSSCCFFSVARGP  406



>ref|XP_008239746.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=385

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRKKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRVVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP+
Sbjct  311  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPQ  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  371  DQSQGCFCFRKIRGP  385



>gb|KJB23020.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=243

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  50   LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  109

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEV
Sbjct  110  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEV  169

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPSSLASIM+KCWDA+P++RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  170  SSAVVCQNLRPEIPRCCPSSLASIMRKCWDAHPERRPDMDEVVRLLEAVDTSKGGGMIPD  229

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  230  DQARGCFCFT-ARGP  243



>ref|XP_006844952.1| hypothetical protein AMTR_s00058p00169420 [Amborella trichopoda]
 gb|ERN06627.1| hypothetical protein AMTR_s00058p00169420 [Amborella trichopoda]
Length=355

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  161  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVAR  220

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  221  VEAQNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  280

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MKKCWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  281  TSAVVRQNLRPEIPRCCPSSLANVMKKCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPL  340

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  341  DQQKGCLCFRKYRGP  355



>gb|KHN35167.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=711

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 187/194 (96%), Gaps = 0/194 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L+K R++KLA+KIVIQLALDL+RGL+YLHSKKIVHRDVK ENMLL TSRNLKIADFGVAR
Sbjct  191  LFKSRRRKLAYKIVIQLALDLARGLNYLHSKKIVHRDVKTENMLLSTSRNLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  251  VEAMNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPS+LA+IM+KCWDANP+KRPEM+EVVR++EA+DTSKGGGMIPE
Sbjct  311  SSAVVRQNLRPDIPRCCPSALANIMRKCWDANPNKRPEMEEVVRMLEALDTSKGGGMIPE  370

Query  258  DQAGGCFCFAPTRG  217
            DQ+ GCFCFAPTR 
Sbjct  371  DQSSGCFCFAPTRA  384



>ref|XP_003610747.1| Kinase-like protein [Medicago truncatula]
 gb|AES93705.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=390

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA++IV+QLALDLSRGLSYLHS+KIVHRDVK ENMLLD +RNLKIADFGVAR
Sbjct  196  LIRNRRKKLAYRIVVQLALDLSRGLSYLHSEKIVHRDVKTENMLLDGNRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  256  VEALNPSDMTGETGTLGYMAPEVLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LA+IM+KCWDANP KRPEM +VV ++EA+DTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSALANIMRKCWDANPIKRPEMKDVVIMLEALDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  376  DQSSGCFCFAPQRGP  390



>ref|XP_009788249.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=232

 Score =   355 bits (912),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  38   LIKNRRKKLAFKVVVQMALDLARGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYS+G+CLWEIYCCD+PYPDLSF+EV
Sbjct  98   VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSYGICLWEIYCCDMPYPDLSFSEV  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  158  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  217

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  218  DQQQGCFCFRKHRGP  232



>gb|KJB11479.1| hypothetical protein B456_001G261300 [Gossypium raimondii]
Length=381

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV +MEAIDTSKGGGMIP 
Sbjct  307  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMMEAIDTSKGGGMIPH  366

Query  258  DQAGGCFCFAPTRGP  214
            DQA GC CF   RGP
Sbjct  367  DQAQGCLCFRRYRGP  381



>ref|XP_010511655.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
 ref|XP_010488307.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=379

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R+KKLAFKIV+QLALDL+RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  185  LFRNRRKKLAFKIVVQLALDLARGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  245  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SLA IMK+CW+ANP+KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  305  SSAVVRQNLRPDIPRCCPTSLAIIMKRCWEANPEKRPEMEEVVKMLETVDTSKGGGMIPE  364

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF   RGP
Sbjct  365  DQRPSCFCFVSGRGP  379



>ref|XP_004290624.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIV+QLALDLS+GLSYLH+KKIVHRDVK EN+LLD +R LKIADFGVAR
Sbjct  206  LIRNRRKKLAFKIVVQLALDLSKGLSYLHAKKIVHRDVKTENVLLDKNRTLKIADFGVAR  265

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  266  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADV  325

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCP++LASIM+KCWDANPDKRP+M+EVV+L+ A+DTSKGGGMIPE
Sbjct  326  SSAVVRQNLRPEIPRCCPTALASIMRKCWDANPDKRPDMEEVVKLLYAVDTSKGGGMIPE  385

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF+  RGP
Sbjct  386  DQTSACFCFSTPRGP  400



>ref|XP_003523078.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=386

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  312  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSKGGGMIPV  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  372  DQQQGCFCFRKHRGP  386



>emb|CDP02127.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  189  LIKNRRRKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  248

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  249  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  308

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDE V ++EAIDTS+GGGMIP 
Sbjct  309  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEAVSMIEAIDTSRGGGMIPH  368

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  369  DQAQGCFCFRKHRGP  383



>ref|XP_010251291.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=360

 Score =   359 bits (922),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  166  LIKNRRKKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  225

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  226  VEAQNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  285

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA+IMK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  286  TSAVVRQNLRPEIPRCCPSSLANIMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPL  345

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  346  DQPQGCLCFRKYRGP  360



>gb|KJB23019.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=297

 Score =   357 bits (916),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  104  LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  163

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEV
Sbjct  164  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEV  223

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPSSLASIM+KCWDA+P++RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  224  SSAVVCQNLRPEIPRCCPSSLASIMRKCWDAHPERRPDMDEVVRLLEAVDTSKGGGMIPD  283

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  284  DQARGCFCFT-ARGP  297



>tpg|DAA47443.1| TPA: LOW QUALITY PROTEIN: putative protein kinase superfamily 
protein [Zea mays]
Length=273

 Score =   356 bits (913),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+Q+ALDL+RGL+YLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  79   LIKNRRRKLAYKVVVQIALDLARGLNYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  138

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  139  VEAQNPKDMTGATGTLGYMAPEVLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  198

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS +A+IM+KCWDANPDKRP+MD+VVR +EA+DTSKGGGMIPE
Sbjct  199  SSAVVHQNLRPDIPRCCPSPMANIMRKCWDANPDKRPDMDDVVRFLEALDTSKGGGMIPE  258

Query  258  DQAGGCFCFAPTRGP  214
             QAGGC CF   RGP
Sbjct  259  GQAGGCLCFFRARGP  273



>gb|KHN30896.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=429

 Score =   362 bits (928),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVAR
Sbjct  235  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVAR  294

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  295  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  354

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  355  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSKGGGMIPV  414

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  415  DQQQGCFCFRKHRGP  429



>ref|XP_002312543.2| hypothetical protein POPTR_0008s15580g [Populus trichocarpa]
 gb|EEE89910.2| hypothetical protein POPTR_0008s15580g [Populus trichocarpa]
Length=390

 Score =   360 bits (924),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVAR
Sbjct  196  LIRNSRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  256  VEAQNPCDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPNLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA++M+KCWD N +KRPEM EVV+++EA+DTSKGGGMIPE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANVMRKCWDGNAEKRPEMAEVVKMLEAVDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQA  CFC  P RGP
Sbjct  376  DQASVCFCLTPARGP  390



>ref|XP_003527023.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=386

 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  312  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSKGGGMIPV  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  372  DQQQGCFCFRKHRGP  386



>ref|XP_002283073.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
Length=391

 Score =   360 bits (924),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK+ENMLLD  R LKIADFGVAR
Sbjct  197  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKSENMLLDAQRTLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQN ++MTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  257  VEAQNLREMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFAEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDAN +KRP+M+EVV+++EAIDTS+GGGMIPE
Sbjct  317  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANAEKRPDMNEVVKMLEAIDTSRGGGMIPE  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF+  RGP
Sbjct  377  DQTPVCFCFSNVRGP  391



>ref|XP_004508858.1| PREDICTED: dual specificity protein kinase zakA-like [Cicer arietinum]
Length=389

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  195  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  254

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWE YCCD+PYPDLSF+E+
Sbjct  255  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLSFSEI  314

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MKKCWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  315  TSAVVRQNLRPEVPRCCPSSLANVMKKCWDASPDKRPEMDEVVSMLEAIDTSKGGGMIPN  374

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  375  DQQQGCFCFRKHRGP  389



>gb|KJB23017.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=381

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  188  LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  247

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEV
Sbjct  248  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEV  307

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCPSSLASIM+KCWDA+P++RP+MDEVVRL+EA+DTSKGGGMIP+
Sbjct  308  SSAVVCQNLRPEIPRCCPSSLASIMRKCWDAHPERRPDMDEVVRLLEAVDTSKGGGMIPD  367

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF   RGP
Sbjct  368  DQARGCFCFT-ARGP  381



>ref|XP_010024234.1| PREDICTED: serine/threonine-protein kinase HT1 [Eucalyptus grandis]
 gb|KCW60697.1| hypothetical protein EUGRSUZ_H03426 [Eucalyptus grandis]
Length=385

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKL FKIVIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  191  LIRNRRKKLPFKIVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDGQRNLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  251  VEAQNPCDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPE+PRCCPSSLA+IM+KCWD N +KRPEM EVVR++E IDTSKGGGMIPE
Sbjct  311  SSAVVRQNLRPEMPRCCPSSLANIMRKCWDGNAEKRPEMAEVVRMLEVIDTSKGGGMIPE  370

Query  258  DQAGGCFCFAPTRGP  214
            DQA  C CF P RGP
Sbjct  371  DQAPSCICFGPARGP  385



>ref|XP_003525335.1| PREDICTED: dual specificity protein kinase zakA-like [Glycine 
max]
 gb|KHN48600.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=391

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  197  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  257  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MKKCWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  317  TSAVVRQNLRPEVPRCCPSSLANVMKKCWDASPDKRPEMDEVVSMLEAIDTSKGGGMIPL  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  377  DQQQGCFCFRKHRGP  391



>gb|AAR01726.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAT77865.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF97807.1| protein kinase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAH01713.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  185  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  245  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  305  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  364

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  365  GQSSGCLCFTKARGP  379



>ref|XP_010496560.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=287

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  93   LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  152

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  153  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  212

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  213  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPP  272

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  273  DQQQGCFCFRRHRGP  287



>gb|AGG38032.1| mitogen activated protein kinase kinase kinase 27 [Oryza sativa 
Indica Group]
Length=379

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  185  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  245  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  305  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  364

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  365  GQSSGCLCFTKARGP  379



>gb|KEH27357.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=424

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA++IV+QLALDLSRGLSYLHS+KIVHRDVK ENMLLD +RNLKIADFGVAR
Sbjct  230  LIRNRRKKLAYRIVVQLALDLSRGLSYLHSEKIVHRDVKTENMLLDGNRNLKIADFGVAR  289

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  290  VEALNPSDMTGETGTLGYMAPEVLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADV  349

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPS+LA+IM+KCWDANP KRPEM +VV ++EA+DTSKGGGMIPE
Sbjct  350  SSAVVRQNLRPEIPRCCPSALANIMRKCWDANPIKRPEMKDVVIMLEALDTSKGGGMIPE  409

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  410  DQSSGCFCFAPQRGP  424



>ref|XP_007155414.1| hypothetical protein PHAVU_003G199400g [Phaseolus vulgaris]
 gb|ESW27408.1| hypothetical protein PHAVU_003G199400g [Phaseolus vulgaris]
Length=386

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFKIVIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKIVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MKKCWDA PDKRPEMDEVV ++EAIDT+KGGGMIP 
Sbjct  312  TSAVVRQNLRPEMPRCCPSSLANVMKKCWDATPDKRPEMDEVVSMLEAIDTTKGGGMIPH  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  372  DQQQGCFCFRKHRGP  386



>ref|XP_008443512.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
Length=384

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  190  LIKNRRKKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  250  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  310  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPL  369

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  370  DQSQGCFCFRRYRGP  384



>ref|XP_004141085.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN59662.1| hypothetical protein Csa_3G836460 [Cucumis sativus]
Length=385

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRKKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  311  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPL  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  371  DQSQGCFCFRRYRGP  385



>ref|XP_009613289.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  195  LIKNRRKKLAFKVVVQMALDLARGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVAR  254

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYS+G+CLWEIYCCD+PYPDLSF+EV
Sbjct  255  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSYGICLWEIYCCDMPYPDLSFSEV  314

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  315  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  374

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  375  DQQQGCFCFRKHRGP  389



>gb|KHN19315.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=400

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVAR
Sbjct  206  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVAR  265

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  266  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  325

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  326  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSKGGGMIPV  385

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  386  DQQQGCFCFRKHRGP  400



>ref|XP_011087151.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=381

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  187  LIKNRRKKLAFKVVVQMALDLARGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  307  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTLLEAIDTSKGGGMIPV  366

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  367  DQQQGCLCFRTYRGP  381



>gb|KHG06519.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=381

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  307  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMIEAIDTSKGGGMIPH  366

Query  258  DQAGGCFCFAPTRGP  214
            DQA GC CF   RGP
Sbjct  367  DQAQGCLCFRRYRGP  381



>ref|XP_003549630.1| PREDICTED: dual specificity protein kinase zakA-like [Glycine 
max]
Length=392

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA K+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  198  LIKNRRRKLALKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  258  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MKKCWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  318  TSAVVRQNLRPEVPRCCPSSLANVMKKCWDASPDKRPEMDEVVSMLEAIDTSKGGGMIPH  377

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  378  DQQQGCFCFRKHRGP  392



>ref|XP_002314673.2| hypothetical protein POPTR_0010s09360g [Populus trichocarpa]
 gb|EEF00844.2| hypothetical protein POPTR_0010s09360g [Populus trichocarpa]
Length=391

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ + LKIADFGVAR
Sbjct  197  LIRNSRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSHKTLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EAQNP +MTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  257  IEAQNPCEMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLA++M+KCWD N +KRPEMDEVV+++E IDTSKGGGMIPE
Sbjct  317  SSAVVRQNLRPDIPRCCPSSLANVMRKCWDGNAEKRPEMDEVVKMLEGIDTSKGGGMIPE  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF P RGP
Sbjct  377  DQNSGCFCFNPVRGP  391



>gb|KHN18465.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=392

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA K+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  198  LIKNRRRKLALKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  258  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MKKCWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  318  TSAVVRQNLRPEVPRCCPSSLANVMKKCWDASPDKRPEMDEVVSMLEAIDTSKGGGMIPH  377

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  378  DQQQGCFCFRKHRGP  392



>ref|XP_009405934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405935.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405936.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405937.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL +KIVIQ+ALDL+RGLSYLHSKKIVHRDVK ENMLLDT+R LKIADFGVAR
Sbjct  196  LIKNRRRKLPYKIVIQVALDLARGLSYLHSKKIVHRDVKTENMLLDTNRKLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF +V
Sbjct  256  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVDV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDANPDKR EM EVV+L+EAIDTSKGGGM+PE
Sbjct  316  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANPDKRLEMYEVVKLLEAIDTSKGGGMVPE  375

Query  258  DQAGGCFCFAPTRGP  214
            D+A GC CF+  RGP
Sbjct  376  DRAAGCLCFSLARGP  390



>ref|XP_006650329.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=378

 Score =   358 bits (919),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  184  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  304  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  363

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  364  GQSSGCLCFTKARGP  378



>ref|XP_010242982.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=363

 Score =   358 bits (918),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  169  LIKNRRKKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  228

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  229  VEAQNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  288

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  289  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDASPDKRPEMDEVVTMLEAIDTSKGGGMIPL  348

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  349  DQPQGCLCFRKYRGP  363



>gb|EAY91142.1| hypothetical protein OsI_12749 [Oryza sativa Indica Group]
Length=416

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  222  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  281

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  282  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  341

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  342  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  401

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  402  GQSSGCLCFTKARGP  416



>gb|EAZ27891.1| hypothetical protein OsJ_11846 [Oryza sativa Japonica Group]
Length=416

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  222  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  281

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  282  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  341

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  342  SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  401

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  402  GQSSGCLCFTKARGP  416



>gb|KJB72260.1| hypothetical protein B456_011G167400 [Gossypium raimondii]
Length=391

 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VI+LALDLSRGLSYLHSK+IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  197  LIRNRRKKLAFKVVIKLALDLSRGLSYLHSKRIVHRDVKTENMLLDAHRNLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  257  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFVDV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAV RQNLRPEIPRCCP+SLASIM+KCWDANP KRP+MDEVVR +EA++TSKGGGMIP+
Sbjct  317  SSAVARQNLRPEIPRCCPNSLASIMQKCWDANPKKRPDMDEVVRTLEAVNTSKGGGMIPD  376

Query  258  DQAGGCFCFAPTRGP  214
            D    CFC  PTRGP
Sbjct  377  DHTPTCFCLLPTRGP  391



>ref|XP_010678745.1| PREDICTED: serine/threonine-protein kinase HT1-like [Beta vulgaris 
subsp. vulgaris]
Length=366

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V QLALDL+RGLSYLH++KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  172  LIKNRRKKLAFKVVHQLALDLARGLSYLHAQKIVHRDVKTENMLLDKSRTLKIADFGVAR  231

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  232  VEASNPSDMTGETGTLGYMAPEVLNGDPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  291

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MKKCWDANPD+RPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  292  TSAVVRQNLRPEIPRCCPSSLANVMKKCWDANPDRRPEMDEVVSLLEAIDTSKGGGMIPV  351

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF   RGP
Sbjct  352  DQQQSCFCFQRRRGP  366



>ref|XP_007151088.1| hypothetical protein PHAVU_004G016900g [Phaseolus vulgaris]
 gb|ESW23082.1| hypothetical protein PHAVU_004G016900g [Phaseolus vulgaris]
Length=366

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  172  LIKNRRRKLAFKVVVQLALDLARGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVAR  231

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  232  IEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  291

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV +MEAIDTSKGGGMIP 
Sbjct  292  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMMEAIDTSKGGGMIPV  351

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  352  DQPQGCLCFRSYRGP  366



>ref|NP_001131428.2| uncharacterized LOC100192758 [Zea mays]
 gb|ACG32092.1| ATP binding protein [Zea mays]
 gb|ACR36663.1| unknown [Zea mays]
 gb|ACF79829.2| unknown [Zea mays]
 tpg|DAA47442.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=370

 Score =   358 bits (918),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+Q+ALDL+RGL+YLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct  176  LIKNRRRKLAYKVVVQIALDLARGLNYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR  235

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  236  VEAQNPKDMTGATGTLGYMAPEVLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  295

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS +A+IM+KCWDANPDKRP+MD+VVR +EA+DTSKGGGMIPE
Sbjct  296  SSAVVHQNLRPDIPRCCPSPMANIMRKCWDANPDKRPDMDDVVRFLEALDTSKGGGMIPE  355

Query  258  DQAGGCFCFAPTRGP  214
             QAGGC CF   RGP
Sbjct  356  GQAGGCLCFFRARGP  370



>ref|XP_004138114.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004155013.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
Length=379

 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  185  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  245  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDA PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  305  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDATPDKRPEMDEVVSMLEAIDTSKGGGMIPV  364

Query  258  DQAGGCFCFAPTRGP  214
            DQA GC CF   RGP
Sbjct  365  DQAQGCLCFRKYRGP  379



>ref|XP_008451641.1| PREDICTED: serine/threonine-protein kinase HT1, partial [Cucumis 
melo]
Length=265

 Score =   353 bits (906),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K RK+KLAFK+VIQLALDLSRGLSYLHSKKIVHRD+K EN+LLD  + LKI DFGVAR
Sbjct  72   LIKNRKRKLAFKVVIQLALDLSRGLSYLHSKKIVHRDIKTENVLLDAQKTLKIVDFGVAR  131

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYS G+CLWE YCCD+PYPDLSFAEV
Sbjct  132  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSLGICLWETYCCDMPYPDLSFAEV  191

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            S+AVVRQNLRPEIPRCCPSS A+IMK+CWDANP+KRP+MDEVV+L+EAIDTSKGGGMI +
Sbjct  192  STAVVRQNLRPEIPRCCPSSFANIMKRCWDANPEKRPDMDEVVKLLEAIDTSKGGGMITD  251

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF P RGP
Sbjct  252  DQI-SCFCFRPARGP  265



>ref|XP_004241510.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=394

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLH++KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  200  LIKNRRKKLAFKVVVQIALDLARGLSYLHTQKIVHRDVKTENMLLDKTRTVKIADFGVAR  259

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  260  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  319

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  320  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMIEAIDTSKGGGMIPV  379

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  380  DQQQGCFCFRKHRGP  394



>ref|XP_008453100.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
melo]
Length=379

 Score =   357 bits (917),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  185  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  244

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  245  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  304

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDA PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  305  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDATPDKRPEMDEVVSMLEAIDTSKGGGMIPV  364

Query  258  DQAGGCFCFAPTRGP  214
            DQA GC CF   RGP
Sbjct  365  DQAQGCLCFRKYRGP  379



>ref|XP_008374458.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=396

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  202  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRAVKIADFGVAR  261

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  262  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  321

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP+
Sbjct  322  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPQ  381

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF   RGP
Sbjct  382  DQSQGCLCFRKKRGP  396



>ref|XP_002511419.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF52021.1| protein kinase atmrk1, putative [Ricinus communis]
Length=393

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V++LALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  199  LIKNRRKKLAFKVVVELALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  258

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  259  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  318

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAID SKGGGMIP 
Sbjct  319  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDISKGGGMIPA  378

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGC CF   RGP
Sbjct  379  DQQGGCLCFRRVRGP  393



>ref|XP_010496308.1| PREDICTED: serine/threonine-protein kinase HT1 [Camelina sativa]
Length=410

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLH++KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  216  LIKTRRRKLAFKVVIQLSLDLARGLSYLHTQKIVHRDVKTENMLLDKSRTLKIADFGVAR  275

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  276  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  335

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  336  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPP  395

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  396  DQQQGCFCFRRHRGP  410



>ref|XP_011030650.1| PREDICTED: serine/threonine-protein kinase HT1 [Populus euphratica]
Length=391

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ + LKIADFGVAR
Sbjct  197  LIRNSRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSHKTLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EAQNP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  257  IEAQNPCDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCPSSLA++M+KCWD N +KRPEM EVV+++E IDTSKGGGMIPE
Sbjct  317  SSAVVRQNLRPDIPRCCPSSLANVMRKCWDGNAEKRPEMAEVVKMLEGIDTSKGGGMIPE  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF P RGP
Sbjct  377  DQNSGCFCFNPVRGP  391



>ref|XP_011079887.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum]
Length=390

 Score =   357 bits (917),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAF +VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD++R LKIADFGVAR
Sbjct  196  LIRNSRKKLAFGVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDSNRTLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EAQNP+DMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  256  IEAQNPRDMTGNTGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            S+AVV+QNLRPE+PRCCP   ASIM+KCWDA P+ RPEMDEVVRL+EA+DTSKGGGM+P+
Sbjct  316  SAAVVQQNLRPEVPRCCPGGFASIMRKCWDAKPENRPEMDEVVRLLEAVDTSKGGGMVPD  375

Query  258  DQAGGCFCFAPTRGP  214
            D+AGGCFCF   RGP
Sbjct  376  DEAGGCFCFRKARGP  390



>ref|XP_011026861.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Populus 
euphratica]
Length=390

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVAR
Sbjct  196  LIRNSRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  256  VEAQNPCDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPNLSFADV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
             SAVVRQNLRPEIPRCCPSSLA++M+KCWD N +KRPEM EVV+++EA+DTSKGGGMIPE
Sbjct  316  PSAVVRQNLRPEIPRCCPSSLANVMRKCWDGNAEKRPEMAEVVKMLEAVDTSKGGGMIPE  375

Query  258  DQAGGCFCFAPTRGP  214
            DQA  CFC  P RGP
Sbjct  376  DQASVCFCLTPARGP  390



>gb|KHN23551.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=334

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  140  LIKNRRRKLAFKVVVQLALDLARGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVAR  199

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  200  IEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  259

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  260  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPH  319

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  320  DQPQGCLCFRSYRGP  334



>ref|XP_003542696.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=366

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  172  LIKNRRRKLAFKVVVQLALDLARGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVAR  231

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  232  IEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  291

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  292  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPH  351

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  352  DQPQGCLCFRSYRGP  366



>ref|XP_006603815.1| PREDICTED: serine/threonine-protein kinase HT1 [Glycine max]
Length=367

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  173  LIKNRRRKLAFKVVVQLALDLARGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVAR  232

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  233  IEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  292

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  293  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPH  352

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  353  DQPQGCLCFRSYRGP  367



>ref|XP_006299114.1| hypothetical protein CARUB_v10015255mg [Capsella rubella]
 gb|EOA32012.1| hypothetical protein CARUB_v10015255mg [Capsella rubella]
Length=410

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  216  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  275

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  276  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  335

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  336  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMEEVVAMLEAIDTSKGGGMIPP  395

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  396  DQQQGCFCFRRHRGP  410



>ref|XP_002278739.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 emb|CBI34936.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  166  LIKNHRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  225

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  226  MEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  285

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++E IDTSKGGGMIP 
Sbjct  286  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEGIDTSKGGGMIPL  345

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  346  DQPQGCFCFGKYRGP  360



>gb|KJB75695.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
Length=294

 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLA+DL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  100  LIKNRRRKLAFKVVIQLAVDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  159

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  160  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  219

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  220  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPH  279

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  280  DQTQGCLCFRRYRGP  294



>ref|XP_011071834.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=387

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  193  LIKNRRKKLAFKVVVQMALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  253  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  313  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  373  DQQQGCLCFRKYRGP  387



>gb|KJB53126.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=238

 Score =   351 bits (900),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  44   LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  103

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  104  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  163

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  164  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  223

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  224  DQQQSCLCFRRYRGP  238



>ref|XP_006439794.1| hypothetical protein CICLE_v10020546mg [Citrus clementina]
 ref|XP_006476760.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|ESR53034.1| hypothetical protein CICLE_v10020546mg [Citrus clementina]
Length=387

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  193  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKNRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  253  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  313  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPG  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  373  DQPQGCLCFRKHRGP  387



>ref|XP_009408505.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLA+K+V+QLALDLSRGLSYLHS+KIVHRDVK ENMLLD + NLKIADFGVAR
Sbjct  192  LIKNRRKKLAYKVVVQLALDLSRGLSYLHSQKIVHRDVKTENMLLDANSNLKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTG TGTLGYMAPEVL+GKPYNRKCDVYSFG+CLWEIYCCD+PY +LSFAEV
Sbjct  252  VEAQNPRDMTGATGTLGYMAPEVLNGKPYNRKCDVYSFGICLWEIYCCDMPYANLSFAEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SS+VV++NLRPEIPRCCPS++ASIM+KCWDANPDKRP+MDEVVR +EA++TSKGGGMIPE
Sbjct  312  SSSVVQKNLRPEIPRCCPSAMASIMRKCWDANPDKRPDMDEVVRHLEALNTSKGGGMIPE  371

Query  258  DQAGGCFCFAPTRGP  214
            D+A GCFCF   RGP
Sbjct  372  DKAHGCFCFTTKRGP  386



>gb|KDO69703.1| hypothetical protein CISIN_1g018489mg [Citrus sinensis]
Length=355

 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  161  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKNRTVKIADFGVAR  220

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  221  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  280

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  281  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPG  340

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  341  DQPQGCLCFRKHRGP  355



>gb|KJB53123.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
 gb|KJB53124.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=232

 Score =   350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  38   LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  98   VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  158  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  217

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  218  DQQQSCLCFRRYRGP  232



>gb|AES91171.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=392

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL LDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  198  LIKNRRRKLAFKVVIQLVLDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWE YCCD+PYPDLSF+E+
Sbjct  258  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLSFSEI  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++M+KCWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  318  TSAVVRQNLRPEIPRCCPSSLANVMRKCWDASPDKRPEMDEVVTMLEAIDTSKGGGMIPI  377

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  378  DQQQGCFCFRKHRGP  392



>ref|XP_006414642.1| hypothetical protein EUTSA_v10025537mg [Eutrema salsugineum]
 gb|ESQ56095.1| hypothetical protein EUTSA_v10025537mg [Eutrema salsugineum]
Length=362

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKL FK+VI+LALDLSRGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  168  LIRNRRKKLPFKVVIKLALDLSRGLSYLHSEKIVHRDVKTENMLLDAQRNLKIADFGVAR  227

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  228  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  287

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LA+I+KKCWD NP +RPEM+EVV+++E IDT+KGGGMIPE
Sbjct  288  SSAVVLHNLRPEIPRCCPNALANIIKKCWDGNPQRRPEMEEVVKMLEGIDTTKGGGMIPE  347

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  348  DQSSGCFCFAPARGP  362



>ref|XP_002318645.1| kinase family protein [Populus trichocarpa]
 gb|EEE96865.1| kinase family protein [Populus trichocarpa]
Length=381

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V++LALDL+RGL+YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVVELALDLARGLNYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  247  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEMDEVV ++EAID +KGGGMIP 
Sbjct  307  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMDEVVSMLEAIDVTKGGGMIPP  366

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGCFCF   RGP
Sbjct  367  DQQGGCFCFRRNRGP  381



>emb|CBI26291.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVK+ENMLLD  R LKIADFGVAR
Sbjct  262  LIRNRRKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKSENMLLDAQRTLKIADFGVAR  321

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQN ++MTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  322  VEAQNLREMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFAEV  381

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRPEIPRCCPSSLA+IM+KCWDAN +KRP+M+EVV+++EAIDTS+GGGMIPE
Sbjct  382  SSAVVRQNLRPEIPRCCPSSLANIMRKCWDANAEKRPDMNEVVKMLEAIDTSRGGGMIPE  441

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF+  RGP
Sbjct  442  DQTPVCFCFSNVRGP  456



>gb|KCW84187.1| hypothetical protein EUGRSUZ_B01052 [Eucalyptus grandis]
Length=264

 Score =   351 bits (901),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKL FK VIQLALDLSRGL+YLHSKKIVHRDVK ENMLLD+ RNLKIADFGVAR
Sbjct  69   LIRNSRKKLPFKDVIQLALDLSRGLNYLHSKKIVHRDVKTENMLLDSRRNLKIADFGVAR  128

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  129  VEAQNPGDMTGETGTLGYMAPEVLDGKPYNRSCDVYSFGICLWEIYCCDMPYPNLSFADV  188

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCP +LA+IM++CWDANPDKR EMDEVV L+EAIDTSKGGGMIPE
Sbjct  189  SSAVVLQNLRPEIPRCCPGALANIMRRCWDANPDKRLEMDEVVHLLEAIDTSKGGGMIPE  248

Query  258  DQA-GGCFCFAPTRGP  214
            DQA  GCFCF P RGP
Sbjct  249  DQARSGCFCFRPVRGP  264



>ref|XP_007036183.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20684.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=386

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  312  TSAVVRQNLRPEMPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  372  DQQQGCLCFRRYRGP  386



>emb|CDP12370.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  219  LIKNRRKKLAFKVVVQMALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  278

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  279  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  338

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  339  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVYLLEAIDTSKGGGMIPL  398

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  399  DQPQGCLCFRKYRGP  413



>ref|XP_004146993.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004166163.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN44782.1| hypothetical protein Csa_7G387170 [Cucumis sativus]
Length=398

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K RK+KLAFK+VIQLALDLSRGLSYLHSKKIVHRD+K EN+LLD  + LKI DFGVAR
Sbjct  205  LIKNRKRKLAFKVVIQLALDLSRGLSYLHSKKIVHRDIKTENVLLDAQKTLKIVDFGVAR  264

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYS G+CLWE YCCD+PYPDLSFAEV
Sbjct  265  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSLGICLWETYCCDMPYPDLSFAEV  324

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            S+AVVRQNLRP+IPRCCPSS A+IMK+CWDANP+KRP+MDEVV+L+EAIDTSKGGGMI E
Sbjct  325  STAVVRQNLRPDIPRCCPSSFANIMKRCWDANPEKRPDMDEVVKLLEAIDTSKGGGMITE  384

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF P RGP
Sbjct  385  DQI-SCFCFRPARGP  398



>ref|XP_007216049.1| hypothetical protein PRUPE_ppa017603mg [Prunus persica]
 gb|EMJ17248.1| hypothetical protein PRUPE_ppa017603mg [Prunus persica]
Length=374

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  180  LIKNRRKKLAFKLVVQLALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  239

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  240  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  299

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  300  TSAVVRQNLRPEMPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPG  359

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  360  DQPQGCFCFRRYRGP  374



>ref|XP_010532573.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=398

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLA+K+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD SRNLKIADFGVAR
Sbjct  204  LIRNRRKKLAYKLVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDNSRNLKIADFGVAR  263

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF  V
Sbjct  264  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVHV  323

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP++LA+IMK+CWD  P+KRP+M+EVVR++E +DT+KGGGMIP+
Sbjct  324  SSAVVRQNLRPDIPRCCPTALANIMKRCWDGKPEKRPDMEEVVRMLEGLDTTKGGGMIPD  383

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCFA + GP
Sbjct  384  DQISGCFCFAASHGP  398



>gb|KJB75694.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
 gb|KJB75698.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
Length=374

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLA+DL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  180  LIKNRRRKLAFKVVIQLAVDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  239

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  240  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  299

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  300  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPH  359

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  360  DQTQGCLCFRRYRGP  374



>ref|XP_009145271.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 ref|XP_009145272.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 gb|AGA37229.1| mitogen-activated protein kinase kinase kinase Raf39.1 [Brassica 
napus]
 emb|CDY10667.1| BnaA05g16950D [Brassica napus]
 emb|CDY10304.1| BnaC05g29750D [Brassica napus]
Length=378

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L++ R++KLA ++V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  184  LFRNRRRKLAIRVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCC +PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCAMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SL++IMK+CWDANP KRPEM+EVV+++E +DTSKGGGMIPE
Sbjct  304  SSAVVRQNLRPDIPRCCPTSLSNIMKRCWDANPVKRPEMEEVVKMLEGVDTSKGGGMIPE  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  364  DQRPGCFCFVSGRGP  378



>emb|CAN64754.1| hypothetical protein VITISV_010542 [Vitis vinifera]
Length=381

 Score =   355 bits (910),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  VEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEMDEVV ++EAIDTS+GGGM+P 
Sbjct  307  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSRGGGMLPV  366

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  367  DQPQGCFCFRKYRGP  381



>emb|CBI15048.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   353 bits (907),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  155  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  214

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  215  VEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  274

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEMDEVV ++EAIDTS+GGGM+P 
Sbjct  275  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSRGGGMLPV  334

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  335  DQPQGCFCFRKYRGP  349



>ref|XP_002283021.1| PREDICTED: serine/threonine-protein kinase HT1-like [Vitis vinifera]
Length=381

 Score =   355 bits (910),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  VEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEMDEVV ++EAIDTS+GGGM+P 
Sbjct  307  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMDEVVAMIEAIDTSRGGGMLPV  366

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  367  DQPQGCFCFRKYRGP  381



>gb|AES71542.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=363

 Score =   354 bits (908),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALD++RGL+YLHS+KIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  169  LIKNRRRKLAFKVVIQLALDMARGLNYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVAR  228

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  229  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  288

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQN+RPEIPRCCPSS+A++MKKCWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  289  TSAVVRQNVRPEIPRCCPSSVANVMKKCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPF  348

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  349  DQQQGCLCFGKRRGP  363



>gb|KJB40735.1| hypothetical protein B456_007G076700 [Gossypium raimondii]
Length=303

 Score =   352 bits (903),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  109  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  168

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  169  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  228

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEMDEVV ++E IDTSKGGGMIP 
Sbjct  229  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMDEVVSMLEGIDTSKGGGMIPH  288

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  289  DQPQGCLCFRRYRGP  303



>gb|KDP21418.1| hypothetical protein JCGZ_21889 [Jatropha curcas]
Length=446

 Score =   357 bits (916),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 177/195 (91%), Gaps = 4/195 (2%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  256  LIRNRRKKLAFKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVAR  315

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV
Sbjct  316  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEV  375

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SS    QNLRPEIPRCCP  LA IM+KCWDANP KRPEMDEVV+L+EAIDTSKGGGMIPE
Sbjct  376  SS----QNLRPEIPRCCPHPLAGIMRKCWDANPHKRPEMDEVVKLLEAIDTSKGGGMIPE  431

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GCFCF+  RGP
Sbjct  432  GQSTGCFCFSSARGP  446



>ref|XP_002322160.1| kinase family protein [Populus trichocarpa]
 gb|EEF06287.1| kinase family protein [Populus trichocarpa]
Length=380

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V++LALDL+RGL+YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  186  LIKNRRRKLAFKVVVELALDLARGLNYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  245

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PY DLSF+EV
Sbjct  246  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYSDLSFSEV  305

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAID SKGGGMIP 
Sbjct  306  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDVSKGGGMIPP  365

Query  258  DQAGGCFCFAPTRGP  214
            DQ GGCFCF   RGP
Sbjct  366  DQQGGCFCFRRHRGP  380



>gb|KFK37616.1| hypothetical protein AALP_AA3G006100 [Arabis alpina]
Length=409

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  215  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  274

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  275  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  334

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  335  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMEEVVAMLEAIDTSKGGGMIPP  394

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  395  DQQQGCFCFRRHRGP  409



>ref|NP_001142326.1| uncharacterized protein LOC100274496 [Zea mays]
 ref|NP_001232827.1| ATP binding protein [Zea mays]
 ref|XP_008668643.1| PREDICTED: uncharacterized protein LOC100274496 isoform X1 [Zea 
mays]
 gb|ACF88193.1| unknown [Zea mays]
 gb|ACG46627.1| ATP binding protein [Zea mays]
 gb|ACN25983.1| unknown [Zea mays]
 tpg|DAA50370.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA50371.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
 tpg|DAA50372.1| TPA: putative protein kinase superfamily protein isoform 3 [Zea 
mays]
Length=378

 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK+ENMLL   RNLKIADFGVAR
Sbjct  184  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS+ A++M+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  304  SSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  363

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  364  GQSSGCLCFTKARGP  378



>ref|NP_186798.1| Protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAF01534.1|AC009325_4 putative protein kinase [Arabidopsis thaliana]
 gb|AAL15278.1| AT3g01490/F4P13_4 [Arabidopsis thaliana]
 gb|AAM97058.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAN15525.1| putative protein kinase [Arabidopsis thaliana]
 dbj|BAE99178.1| protein kinase like protein [Arabidopsis thaliana]
 gb|AEE73674.1| Protein kinase superfamily protein [Arabidopsis thaliana]
Length=411

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  217  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  276

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  277  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  336

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANP+KRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  337  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPEKRPEMEEVVAMLEAIDTSKGGGMIPP  396

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  397  DQQQGCFCFRRHRGP  411



>gb|KJB53127.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=399

 Score =   355 bits (911),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  205  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  264

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  265  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  324

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  325  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPV  384

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  385  DQQQSCLCFRRYRGP  399



>ref|XP_010034835.1| PREDICTED: serine/threonine-protein kinase HT1-like [Eucalyptus 
grandis]
 ref|XP_010034843.1| PREDICTED: serine/threonine-protein kinase HT1-like [Eucalyptus 
grandis]
 gb|KCW84186.1| hypothetical protein EUGRSUZ_B01052 [Eucalyptus grandis]
Length=386

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L +  +KKL FK VIQLALDLSRGL+YLHSKKIVHRDVK ENMLLD+ RNLKIADFGVAR
Sbjct  191  LIRNSRKKLPFKDVIQLALDLSRGLNYLHSKKIVHRDVKTENMLLDSRRNLKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVLDGKPYNR CDVYSFG+CLWEIYCCD+PYP+LSFA+V
Sbjct  251  VEAQNPGDMTGETGTLGYMAPEVLDGKPYNRSCDVYSFGICLWEIYCCDMPYPNLSFADV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRPEIPRCCP +LA+IM++CWDANPDKR EMDEVV L+EAIDTSKGGGMIPE
Sbjct  311  SSAVVLQNLRPEIPRCCPGALANIMRRCWDANPDKRLEMDEVVHLLEAIDTSKGGGMIPE  370

Query  258  DQA-GGCFCFAPTRGP  214
            DQA  GCFCF P RGP
Sbjct  371  DQARSGCFCFRPVRGP  386



>ref|XP_008230622.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
Length=372

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  178  LIKNRRRKLAFKLVVQLALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  237

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  238  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  297

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPE+PRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  298  TSAVVRQNLRPEMPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPG  357

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  358  DQPQGCFCFRRYRGP  372



>ref|XP_007031440.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007031441.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007031442.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02366.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02367.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02368.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=378

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSY+HSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  184  LIKNRRRKLAFKVVIQLALDLARGLSYIHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  244  LEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  304  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMDEVVSMIEAIDTSKGGGMIPH  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  364  DQPQGCLCFRRYRGP  378



>ref|XP_004298934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=404

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLA DL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  210  LIKNRRRKLAFKVVVQLAQDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  270  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDT+KGGGMIP+
Sbjct  330  TSAVVRQNLRPDIPRCCPSALANVMKRCWDANPDKRPEMDEVVSMIEAIDTTKGGGMIPQ  389

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF   RGP
Sbjct  390  DQSQGCLCFRKKRGP  404



>gb|KJB40732.1| hypothetical protein B456_007G076700 [Gossypium raimondii]
Length=377

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  183  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  242

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  243  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  302

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEMDEVV ++E IDTSKGGGMIP 
Sbjct  303  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMDEVVSMLEGIDTSKGGGMIPH  362

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  363  DQPQGCLCFRRYRGP  377



>gb|KHG08462.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=383

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  189  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  248

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  249  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  308

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEMDEVV ++E IDTSKGGGMIP 
Sbjct  309  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMDEVVSMLEGIDTSKGGGMIPH  368

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  369  DQPQGCLCFRRYRGP  383



>gb|ABK06450.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=422

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  217  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  276

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  277  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  336

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANP+KRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  337  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPEKRPEMEEVVAMLEAIDTSKGGGMIPP  396

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  397  DQQQGCFCFRRHRGP  411



>gb|KHN47176.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=428

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  234  LIKNRRRKLAFKVVVQLALDLARGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVAR  293

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  294  IEASNPHDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  353

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  354  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPH  413

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  414  DQPQGCLCFRSYRGP  428



>emb|CDY37517.1| BnaA05g33820D [Brassica napus]
Length=386

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  192  LIKSRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  252  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM+E V ++EAIDTSKGGGMIP 
Sbjct  312  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMEEAVAMLEAIDTSKGGGMIPP  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  372  DQQQGCFCFRRHRGP  386



>ref|XP_010029202.1| PREDICTED: serine/threonine-protein kinase HT1 [Eucalyptus grandis]
 gb|KCW56061.1| hypothetical protein EUGRSUZ_I01815 [Eucalyptus grandis]
Length=384

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  190  LIKNRRKKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  Y+RKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  250  IEASNPHDMTGETGTLGYMAPEVLNGSAYDRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWD NPDKRP+MDEVV ++EAIDTSKGGGMIP 
Sbjct  310  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDGNPDKRPKMDEVVAMLEAIDTSKGGGMIPL  369

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  370  DQSQGCFCFRKHRGP  384



>ref|XP_011098491.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=366

 Score =   353 bits (905),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLH KKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  172  LIKNRRRKLAFKVVIQLALDLARGLSYLHYKKIVHRDVKTENMLLDKNRTVKIADFGVAR  231

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP +MTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  232  IEASNPNEMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEL  291

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCP+SLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  292  TSAVVRQNLRPEIPRCCPNSLANVMKRCWDANPDKRPEMDEVVSMLEAIDTSKGGGMIPL  351

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCF   RGP
Sbjct  352  DQSQGCFCFRRHRGP  366



>emb|CDY49058.1| BnaC05g48860D [Brassica napus]
Length=386

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  192  LIKSRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  252  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM+E V ++EAIDTSKGGGMIP 
Sbjct  312  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMEEAVAMLEAIDTSKGGGMIPP  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  372  DQQQGCFCFRRHRGP  386



>ref|XP_008782437.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Phoenix dactylifera]
Length=233

 Score =   348 bits (892),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  38   LIKNRRKKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDRTRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  98   VEAQNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++M++CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  158  TSAVVRQNLRPEIPRCCPSSLANVMRRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPL  217

Query  258  DQAGGCF-CFAPTRGP  214
            D+  GC  CF   RGP
Sbjct  218  DEPQGCLGCFRRYRGP  233



>ref|XP_004158316.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
HT1-like [Cucumis sativus]
Length=395

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRKKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  311  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPL  370

Query  258  DQAGGCFCFAPTRG  217
            DQ+ GC CF   RG
Sbjct  371  DQSQGCXCFRRYRG  384



>ref|XP_010695285.1| PREDICTED: serine/threonine-protein kinase HT1-like [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   352 bits (904),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QL+LDL+RGLSYLH+ KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  176  LIKNRRRKLAFKVVVQLSLDLARGLSYLHTMKIVHRDVKTENMLLDKQRNLKIADFGVAR  235

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCC++PYPDLSF+EV
Sbjct  236  VEASNPHDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEIYCCEMPYPDLSFSEV  295

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA +MK+CWDANPDKRPEMDEVV L+EAIDT+KGGGMIP 
Sbjct  296  TSAVVRQNLRPEIPRCCPSSLAHVMKRCWDANPDKRPEMDEVVTLLEAIDTTKGGGMIPI  355

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  356  DQQQGCLCFRSNRGP  370



>ref|XP_004501940.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=391

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGL+YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  197  LIKNRRRKLAFKVVIQLALDLARGLNYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  257  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQN+RPE+PRCCPSSL ++MKKCWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  317  TSAVVRQNVRPEMPRCCPSSLVNVMKKCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPV  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  377  DQQHGCLCFRKRRGP  391



>gb|EYU42556.1| hypothetical protein MIMGU_mgv1a008245mg [Erythranthe guttata]
 gb|EYU42557.1| hypothetical protein MIMGU_mgv1a008245mg [Erythranthe guttata]
Length=380

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+Q+ALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  186  LIKNRRRKLAFKVVVQMALDLARGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVAR  245

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  246  VEASNPHDMTGETGTLGYMAPEVLNGNAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  305

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDA+PDKRPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  306  TSAVVRQNLRPEIPRCCPSALANVMKRCWDASPDKRPEMDEVVSLIEAIDTSKGGGMIPV  365

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF  TRGP
Sbjct  366  DQQQGCLCFRKTRGP  380



>ref|XP_010111765.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXC31627.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=377

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  183  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  242

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+C+WEIYCCD+PYPDLSF+EV
Sbjct  243  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICMWEIYCCDMPYPDLSFSEV  302

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  303  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMDEVVAMLEAIDTSKGGGMIPL  362

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  363  DQPQGCLCFRRYRGP  377



>ref|XP_002882179.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  217  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  276

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  277  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  336

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSL ++MK+CWDANP+KRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  337  TSAVVRQNLRPEIPRCCPSSLVNVMKRCWDANPEKRPEMEEVVAMLEAIDTSKGGGMIPP  396

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  397  DQQQGCFCFRRHRGP  411



>ref|XP_008348029.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=232

 Score =   347 bits (891),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  38   LIKNRRRKLAFKLVVQLALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP +MTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  98   VEASNPNEMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  158  TSAVVRQNLRPEIPRCCPSALANVMKRCWDASPDKRPEMDEVVAMLEAIDTSKGGGMIPG  217

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  218  DQPQGCFCFLKYRGP  232



>ref|XP_009147438.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=408

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  214  LIKSRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVAR  273

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  274  LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  333

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM+E V ++EAIDTSKGGGMIP 
Sbjct  334  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMEEAVAMLEAIDTSKGGGMIPP  393

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  394  DQQQGCFCFRRHRGP  408



>ref|XP_004236113.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
 ref|XP_006345046.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
 ref|XP_010318916.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
Length=391

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+Q+ALD++RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  197  LIKNRRRKLAFKVVVQMALDMARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+C+WEIYCCD+PYPDLSF+EV
Sbjct  257  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICVWEIYCCDMPYPDLSFSEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  317  TSAVVRQNLRPDIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMIEAIDTSKGGGMIPV  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  377  DQQQGCFCFRRHRGP  391



>gb|KJB38187.1| hypothetical protein B456_006G241500 [Gossypium raimondii]
Length=391

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  197  LIRNRRKKLAFKIVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDGHRNLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVL+GKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  257  VEAQNPRDMTGETGTLGYMAPEVLEGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SLA+IMKKCWDANP+KRP M+EVVR++EA++TSKGGGMIP+
Sbjct  317  SSAVVRQNLRPDIPRCCPNSLANIMKKCWDANPEKRPAMEEVVRMLEAVNTSKGGGMIPD  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C C    RGP
Sbjct  377  DQTPTCLCLTSLRGP  391



>gb|KDP45365.1| hypothetical protein JCGZ_09614 [Jatropha curcas]
Length=378

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  184  LIKNRRRKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  244  MEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPD+RPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  304  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDRRPEMEEVVSMIEAIDTSKGGGMIPG  363

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  364  DQPQGCLCFRRCRGP  378



>ref|XP_010094284.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB55558.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=391

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V QLALDLSRGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  197  LIKNRRRKLAFKVVHQLALDLSRGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  257  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  317  TSAVVRQNLRPDIPRCCPSSLANVMKRCWDANPDKRPEMDEVVLMLEAIDTSKGGGMIPG  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  377  DQPQGCLCFRKYRGP  391



>gb|AFK43156.1| unknown [Lotus japonicus]
Length=393

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHS+KIVHRDV+ ENMLLD +R +KIADFGVAR
Sbjct  199  LIKNRRRKLAFKVVIQLALDLARGLSYLHSQKIVHRDVQTENMLLDKTRTVKIADFGVAR  258

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  259  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  318

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MKKCWDA PDKRPEMDEVV +MEAIDTSKGGGMIP 
Sbjct  319  TSAVVRQNLRPEIPRCCPSSLANVMKKCWDATPDKRPEMDEVVSMMEAIDTSKGGGMIPF  378

Query  258  DQAGGCFCFAPTRGP  214
            D   GC CF   RGP
Sbjct  379  DLQQGCLCFRKHRGP  393



>ref|XP_006408511.1| hypothetical protein EUTSA_v10020819mg [Eutrema salsugineum]
 gb|ESQ49964.1| hypothetical protein EUTSA_v10020819mg [Eutrema salsugineum]
Length=414

 Score =   353 bits (907),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  220  LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  279

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  280  LEASNPNDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  339

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+L ++MK+CWDANPDKRPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  340  TSAVVRQNLRPEIPRCCPSALGNVMKRCWDANPDKRPEMDEVVSMLESIDTSKGGGMIPP  399

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  400  DQQHGCFCFRRHRGP  414



>ref|XP_004982354.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=378

 Score =   352 bits (903),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLL   RNLKIADFGVAR
Sbjct  184  LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLTPQRNLKIADFGVAR  243

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  244  VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV  303

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV QNLRP+IPRCCPS+ A++M+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct  304  SSAVVHQNLRPDIPRCCPSTFANVMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD  363

Query  258  DQAGGCFCFAPTRGP  214
             Q+ GC CF   RGP
Sbjct  364  GQSPGCLCFTKARGP  378



>emb|CDY08298.1| BnaA05g13210D [Brassica napus]
Length=364

 Score =   352 bits (902),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VI+LALDLSRGLSYLHS+KIVHRDVK ENMLLD   NLKIADFGVAR
Sbjct  169  LIRNRRKKLAFKVVIKLALDLSRGLSYLHSEKIVHRDVKTENMLLDVQSNLKIADFGVAR  228

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCC++PYPDLSF +V
Sbjct  229  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCEMPYPDLSFVDV  288

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  N+RPEIPRCCP+ LA+IMKKCWD NP +RPEM+EVV+++E IDTSKGGGMIPE
Sbjct  289  SSAVVLHNMRPEIPRCCPTVLANIMKKCWDGNPQRRPEMEEVVKMLEGIDTSKGGGMIPE  348

Query  258  DQA-GGCFCFAPTRGP  214
            DQ  GGCFCFAP RGP
Sbjct  349  DQIPGGCFCFAPARGP  364



>ref|XP_009144699.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Brassica 
rapa]
Length=364

 Score =   352 bits (902),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VI+LALDLSRGLSYLHS+KIVHRDVK ENMLLD   NLKIADFGVAR
Sbjct  169  LIRNRRKKLAFKVVIKLALDLSRGLSYLHSEKIVHRDVKTENMLLDVQSNLKIADFGVAR  228

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCC++PYPDLSF +V
Sbjct  229  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCEMPYPDLSFVDV  288

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  N+RPEIPRCCP+ LA+IMKKCWD NP +RPEM+EVV+++E IDTSKGGGMIPE
Sbjct  289  SSAVVLHNMRPEIPRCCPTVLANIMKKCWDGNPQRRPEMEEVVKMLEGIDTSKGGGMIPE  348

Query  258  DQA-GGCFCFAPTRGP  214
            DQ  GGCFCFAP RGP
Sbjct  349  DQIPGGCFCFAPARGP  364



>gb|KDP31115.1| hypothetical protein JCGZ_11491 [Jatropha curcas]
Length=382

 Score =   352 bits (903),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V++LALDL+RGLSYLHS+KIVHRDVK ENMLL+ +R +KIADFGVAR
Sbjct  188  LIKNRRRKLAFKVVVELALDLARGLSYLHSQKIVHRDVKTENMLLNKNRTVKIADFGVAR  247

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  248  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  307

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAID SKGGGMIP 
Sbjct  308  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSMLEAIDISKGGGMIPA  367

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  368  DQQTGCLCFRRYRGP  382



>ref|XP_010532275.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010532276.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010532277.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Tarenaya hassleriana]
Length=383

 Score =   352 bits (903),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAF +VIQLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  189  LIKNRRRKLAFTVVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  248

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+FAEV
Sbjct  249  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFAEV  308

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDE V ++E IDT+KGGGMIP 
Sbjct  309  TSAVVRQNLRPEIPRCCPSSLAAVMKRCWDANPDKRPEMDEAVSMLEGIDTTKGGGMIPL  368

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  369  DQQQGCLCFRRKRGP  383



>gb|KHG05976.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
 gb|KHG27724.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=391

 Score =   352 bits (904),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct  197  LIRNRRKKLAFKIVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDGHRNLKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVL+GKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct  257  VEAQNPRDMTGETGTLGYMAPEVLEGKPYNRICDVYSFGICLWEIYCCDMPYPDLSFADV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVRQNLRP+IPRCCP+SLA+IMKKCWDANP+KRP MDEVVR++EA++TS+GGGMIP+
Sbjct  317  SSAVVRQNLRPDIPRCCPNSLANIMKKCWDANPEKRPAMDEVVRMLEAVNTSRGGGMIPD  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C C    RGP
Sbjct  377  DQTPTCLCLVSPRGP  391



>gb|EMT33153.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=305

 Score =   349 bits (895),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  110  LIKNRRRKLAFKVVVQLALDLARGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVAR  169

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  170  VEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  229

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct  230  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMAEVVAMIEAIDTSKGGGMIPI  289

Query  258  DQAGGCF-CFAPTRGP  214
            DQ+ GCF CF   RGP
Sbjct  290  DQSQGCFACFRQYRGP  305



>ref|XP_010524307.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=392

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  198  LIKSRRRKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  258  LEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANP+KRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  318  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPEKRPEMEEVVTMLEAIDTSKGGGMIPP  377

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  378  DQQQGCLCFRRHRGP  392



>ref|XP_008782436.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Phoenix dactylifera]
Length=358

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+VIQLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  163  LIKNRRKKLAFKVVIQLALDLARGLSYLHSKKIVHRDVKTENMLLDRTRTVKIADFGVAR  222

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  223  VEAQNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  282

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++M++CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  283  TSAVVRQNLRPEIPRCCPSSLANVMRRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPL  342

Query  258  DQAGGCF-CFAPTRGP  214
            D+  GC  CF   RGP
Sbjct  343  DEPQGCLGCFRRYRGP  358



>ref|XP_010435069.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L   R KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct  170  LIGHRNKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDGQKNLKIADFGVAR  229

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  230  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  289

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LASIMK CWD NP KRPEM+EVV L+E +DT+KGGGMIPE
Sbjct  290  SSAVVLHNLRPEIPRCCPTALASIMKACWDGNPQKRPEMNEVVTLLEQVDTTKGGGMIPE  349

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  350  DQSPGCFCFAPARGP  364



>emb|CDY06483.1| BnaC06g11610D [Brassica napus]
Length=364

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L   R+KKLAFK+VI+LALDLSRGLSYLHS+KIVHRDVK EN+LLD   NLKIADFGVAR
Sbjct  169  LIHNRRKKLAFKVVIKLALDLSRGLSYLHSEKIVHRDVKTENVLLDVQSNLKIADFGVAR  228

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  229  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  288

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP+ LA+IMKKCWD NP +RPEM+EVV+++E IDTSKGGGMIPE
Sbjct  289  SSAVVLHNLRPEIPRCCPTVLANIMKKCWDGNPQRRPEMEEVVKMLEGIDTSKGGGMIPE  348

Query  258  DQA-GGCFCFAPTRGP  214
            DQ  GGCFCFAP RGP
Sbjct  349  DQIPGGCFCFAPARGP  364



>ref|XP_006644420.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=233

 Score =   346 bits (888),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  38   LIKNRRRKLAYKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  98   VEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct  158  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEAIDTSKGGGMIPI  217

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GCF CF   RGP
Sbjct  218  DQPQGCFSCFRRYRGP  233



>ref|NP_193214.1| protein kinase family protein [Arabidopsis thaliana]
 emb|CAB10257.1| kinase like protein [Arabidopsis thaliana]
 emb|CAB78520.1| kinase like protein [Arabidopsis thaliana]
 dbj|BAC42800.1| kinase like protein [Arabidopsis thaliana]
 gb|AAP04028.1| putative kinase [Arabidopsis thaliana]
 gb|AEE83497.1| protein kinase family protein [Arabidopsis thaliana]
Length=364

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + + KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct  170  LIRHKSKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVAR  229

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  230  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  289

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LA IMK CWD NP KRPEM EVV+++E +DTSKGGGMIPE
Sbjct  290  SSAVVLHNLRPEIPRCCPTALAGIMKTCWDGNPQKRPEMKEVVKMLEGVDTSKGGGMIPE  349

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  350  DQSRGCFCFAPARGP  364



>ref|XP_010449990.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L   R KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct  170  LIAHRSKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVAR  229

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  230  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  289

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LASIMK CWD NP KRPEM++VV+++E +DT+KGGGMIPE
Sbjct  290  SSAVVLHNLRPEIPRCCPTALASIMKACWDGNPQKRPEMEDVVKMLEEVDTTKGGGMIPE  349

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  350  DQSPGCFCFAPARGP  364



>gb|ABK06453.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=375

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + + KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct  170  LIRHKSKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVAR  229

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  230  VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  289

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LA IMK CWD NP KRPEM EVV+++E +DTSKGGGMIPE
Sbjct  290  SSAVVLHNLRPEIPRCCPTALAGIMKTCWDGNPQKRPEMKEVVKMLEGVDTSKGGGMIPE  349

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  350  DQSRGCFCFAPARGP  364



>ref|XP_008379254.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=375

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  181  LIKNRRRKLAFKLVVQLALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  240

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP +MTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  241  VEASNPNEMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  300

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDA+PDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  301  TSAVVRQNLRPEIPRCCPSALANVMKRCWDASPDKRPEMDEVVAMLEAIDTSKGGGMIPG  360

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GCFCF   RGP
Sbjct  361  DQPQGCFCFLKYRGP  375



>gb|KEH24853.1| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=375

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  181  LIKNRRRKLAFKVVVQLALDLARGLSYLHMKKIVHRDVKTENMLLDKTRTLKIADFGVAR  240

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  241  IEASNPHDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  300

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  301  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPL  360

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  361  DQQQSCLCFRRYRGP  375



>gb|EYU45671.1| hypothetical protein MIMGU_mgv1a007529mg [Erythranthe guttata]
Length=404

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 182/197 (92%), Gaps = 2/197 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            LYK RKKKL FK V+QLALDL+RGLSYLHSKKIVHRDVKAENMLLD +RNLKIADFGVAR
Sbjct  208  LYKNRKKKLPFKTVVQLALDLARGLSYLHSKKIVHRDVKAENMLLDNNRNLKIADFGVAR  267

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWE YCC++PY DLSFA+V
Sbjct  268  VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWETYCCEVPYTDLSFADV  327

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVVR NLRP IPRCCPSSL +IMKKCWD NPDKRPEM++VV+++EAIDTS+GGGM+PE
Sbjct  328  SSAVVRNNLRPPIPRCCPSSLGNIMKKCWDGNPDKRPEMEDVVKMLEAIDTSRGGGMVPE  387

Query  258  DQA--GGCFCFAPTRGP  214
            D++  G  FCF+ TRGP
Sbjct  388  DKSFLGCFFCFSFTRGP  404



>gb|KJB42143.1| hypothetical protein B456_007G139200 [Gossypium raimondii]
Length=391

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 181/195 (93%), Gaps = 1/195 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L + R+KKLAFK+VIQ+ALDLSRGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVAR
Sbjct  198  LIRNRRKKLAFKVVIQIALDLSRGLSYLHSKKIVHRDVKTENMLLDARRILKIADFGVAR  257

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PY +LSFA+ 
Sbjct  258  VEAQNPQDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYANLSFADF  317

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LASIM+KCWD +P++RP+MDEVVR +EAI+T KGGGMIP+
Sbjct  318  TSAVVRQNLRPEIPRCCPSALASIMRKCWDPHPERRPDMDEVVRSLEAIETRKGGGMIPD  377

Query  258  DQAGGCFCFAPTRGP  214
            DQA GCFCF+  RGP
Sbjct  378  DQASGCFCFS-ARGP  391



>ref|XP_009134038.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 gb|AHL77717.1| mitogen activated kinase kinase kinase Raf33 [Brassica napus]
 emb|CDY68821.1| BnaA03g56980D [Brassica napus]
Length=384

 Score =   350 bits (898),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  190  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  250  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  310  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPA  369

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  370  DQQQGCLCFRRKRGP  384



>ref|XP_002865771.1| hypothetical protein ARALYDRAFT_918001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42030.1| hypothetical protein ARALYDRAFT_918001 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   350 bits (898),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  311  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  371  DQQQGCLCFRRKRGP  385



>ref|XP_008812495.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Phoenix dactylifera]
Length=334

 Score =   348 bits (893),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALD++RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  139  LIKNRRRKLAFKVVVQLALDIARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  198

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  199  VEAQNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  258

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA+IMK+CWDANPDKRPEMD  V L+EAIDTSKGGGMIP 
Sbjct  259  TSAVVRQNLRPEIPRCCPSSLANIMKRCWDANPDKRPEMDGAVALLEAIDTSKGGGMIPL  318

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GC  CF   RGP
Sbjct  319  DQPQGCLSCFRKKRGP  334



>ref|XP_006402198.1| hypothetical protein EUTSA_v10013816mg [Eutrema salsugineum]
 gb|ESQ43651.1| hypothetical protein EUTSA_v10013816mg [Eutrema salsugineum]
Length=382

 Score =   350 bits (897),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  188  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  247

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  248  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  307

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  308  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTSKGGGMIPV  367

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  368  DQQEGCLCFRRKRGP  382



>ref|XP_010028228.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Eucalyptus grandis]
 gb|KCW83441.1| hypothetical protein EUGRSUZ_B00365 [Eucalyptus grandis]
Length=440

 Score =   352 bits (902),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL++GLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct  246  LIKNRRRKLAFKVVVQLALDLAKGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR  305

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVLDG PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  306  VEASNPNDMTGETGTLGYMAPEVLDGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEM  365

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDA  +KRPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  366  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDAQQNKRPEMDEVVSLLEAIDTSKGGGMIPV  425

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GC CF   RGP
Sbjct  426  DQSQGCLCFRRYRGP  440



>ref|NP_199811.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB10286.1| protein kinase [Arabidopsis thaliana]
 gb|AED95882.1| protein kinase [Arabidopsis thaliana]
Length=385

 Score =   350 bits (897),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  311  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  371  DQQQGCLCFRRKRGP  385



>ref|XP_004489293.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=372

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLH KKIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  178  LIKNRRRKLAFKVVVQLALDLARGLSYLHMKKIVHRDVKTENMLLDKTRTLKIADFGVAR  237

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  238  IEASNPHDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  297

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  298  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPL  357

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  358  DQPQSCLCFRRYRGP  372



>emb|CDY21438.1| BnaC03g27590D [Brassica napus]
Length=386

 Score =   350 bits (897),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  312  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPA  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  372  DQQQGCLCFRRKRGP  386



>ref|XP_006280611.1| hypothetical protein CARUB_v10026576mg [Capsella rubella]
 gb|EOA13509.1| hypothetical protein CARUB_v10026576mg [Capsella rubella]
Length=386

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLTFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  252  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  312  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  371

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  372  DQQQGCLCFRRKRGP  386



>ref|XP_010533472.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=391

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  197  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  256

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWE YCCD+PYPDL+F+EV
Sbjct  257  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLTFSEV  316

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANP++RPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  317  TSAVVRQNLRPEIPRCCPSSLAAVMKRCWDANPERRPEMDEVVSMLESIDTSKGGGMIPA  376

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  377  DQQQSCLCFRRKRGP  391



>gb|ABK06451.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=396

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  311  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  371  DQQQGCLCFRRKRGP  385



>ref|XP_010441391.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=387

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  193  LIKNRRRKLTFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  253  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  313  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  373  DQQQGCLCFRRKRGP  387



>ref|XP_010442480.1| PREDICTED: serine/threonine-protein kinase HT1 [Camelina sativa]
Length=387

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  193  LIKNRRRKLTFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  253  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  313  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  373  DQQQGCLCFRRKRGP  387



>ref|XP_004304609.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=384

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R+KKLAFK+V+QLALDL+RGL YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  190  LIKNRRKKLAFKVVVQLALDLARGLGYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  250  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++EA+DT+KGGGM+P 
Sbjct  310  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMDEVVVMLEAVDTTKGGGMLPH  369

Query  258  DQAGGCFCFAPTRGP  214
            D   GC CF   RGP
Sbjct  370  DHPQGCLCFRRYRGP  384



>ref|XP_010482303.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=387

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  193  LIKNRRRKLTFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  253  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  313  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  372

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  373  DQQQGCLCFRRKRGP  387



>ref|NP_001043682.1| Os01g0641000 [Oryza sativa Japonica Group]
 dbj|BAB92793.1| protein kinase 6-like [Oryza sativa Japonica Group]
 dbj|BAF05596.1| Os01g0641000 [Oryza sativa Japonica Group]
 gb|EAY75128.1| hypothetical protein OsI_03022 [Oryza sativa Indica Group]
Length=388

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  193  LIKNRRRKLAYKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVAR  252

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  253  IEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  312

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRP M EVV ++EAIDTSKGGGMIP 
Sbjct  313  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPAMAEVVSMLEAIDTSKGGGMIPT  372

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GCF CF   RGP
Sbjct  373  DQPQGCFSCFGRHRGP  388



>ref|NP_001132838.1| uncharacterized LOC100194330 [Zea mays]
 gb|ACF81853.1| unknown [Zea mays]
 tpg|DAA58377.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=233

 Score =   343 bits (880),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+Q+ALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  38   LIKNRRRKLAFKVVVQIALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  97

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  98   VEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  157

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP+
Sbjct  158  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEAIDTSKGGGMIPK  217

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GC  CF   RGP
Sbjct  218  DQTQGCLSCFRQYRGP  233



>emb|CDM83508.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  190  LIKNRRRKLAFKVVVQLALDLARGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  250  VEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct  310  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMAEVVAMIEAIDTSKGGGMIPI  369

Query  258  DQAGGCF-CFAPTRGP  214
            DQ+ GCF CF   RGP
Sbjct  370  DQSQGCFACFRQYRGP  385



>ref|XP_006446475.1| hypothetical protein CICLE_v10015466mg [Citrus clementina]
 gb|ESR59715.1| hypothetical protein CICLE_v10015466mg [Citrus clementina]
Length=404

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYL SKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  210  LIKNRRRKLAFKVVIQLALDLARGLSYLQSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  270  LEASNPHDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  330  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPV  389

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  390  DQPQGCSCFRKYRGP  404



>ref|XP_003569430.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=387

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  192  LIKNRRRKLAFKVVVQLALDLARGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVAR  251

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  252  VEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  311

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM EVV L+EAIDTSKGGGM+P 
Sbjct  312  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMAEVVSLIEAIDTSKGGGMVPI  371

Query  258  DQAGGCF-CFAPTRGP  214
            DQ+ GCF CF   RGP
Sbjct  372  DQSQGCFNCFRQHRGP  387



>ref|XP_006470349.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
Length=404

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYL SKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  210  LIKNRRRKLAFKVVIQLALDLARGLSYLQSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  270  LEASNPHDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  330  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVTMLEAIDTSKGGGMIPV  389

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  390  DQPQGCSCFRKYRGP  404



>gb|EEE55065.1| hypothetical protein OsJ_02781 [Oryza sativa Japonica Group]
Length=373

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLA+K+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct  178  LIKNRRRKLAYKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVAR  237

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  238  IEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  297

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRP M EVV ++EAIDTSKGGGMIP 
Sbjct  298  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPAMAEVVSMLEAIDTSKGGGMIPT  357

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GCF CF   RGP
Sbjct  358  DQPQGCFSCFGRHRGP  373



>gb|KFK26634.1| hypothetical protein AALP_AA8G274000 [Arabis alpina]
Length=377

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  183  LIKNRRRKLAFKVVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  242

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct  243  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV  302

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  303  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTSKGGGMIPG  362

Query  258  DQAGGCFCFAPTRGP  214
            DQ   C CF   RGP
Sbjct  363  DQQQSCLCFRRKRGP  377



>ref|XP_004969282.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=382

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+Q+ALDL+RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  187  LIKNRRRKLAFKVVVQIALDLARGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  246

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  247  VEASNPGDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  306

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct  307  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEAIDTSKGGGMIPT  366

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GCF C   TRGP
Sbjct  367  DQTQGCFSCLRRTRGP  382



>gb|KDO66226.1| hypothetical protein CISIN_1g015594mg [Citrus sinensis]
Length=404

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+VIQLALDL+RGLSYL SKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  210  LIKNRRRKLAFKVVIQLALDLARGLSYLQSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  269

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  270  LEASNPHDMTGETGTLGYMAPEVLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  329

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  330  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMDEVVAMLEAIDTSKGGGMIPV  389

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  390  DQPQGCSCFRKYRGP  404



>ref|XP_011012834.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
Length=384

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  190  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  249

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP +MTGETGTLGYMAPEVL+G PYNRKCDVYSF +CLWEIYCCD+PYPDLSF+EV
Sbjct  250  LEASNPNEMTGETGTLGYMAPEVLNGNPYNRKCDVYSFSICLWEIYCCDMPYPDLSFSEV  309

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+L ++MK+CWDANPDKRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct  310  TSAVVRQNLRPEIPRCCPSALGNVMKRCWDANPDKRPEMEEVVSMLEAIDTSKGGGMIPS  369

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  370  DQPQGCLCFRRYRGP  384



>ref|XP_004961129.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=391

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+Q+ALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  196  LIKNRRRKLAFKVVVQIALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR  255

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  256  LEASNPSDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  315

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRPEM EVV +MEAIDTSKGGGMIP 
Sbjct  316  TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMMEAIDTSKGGGMIPV  375

Query  258  DQAGGCF-CFAPTRGP  214
            DQ  GC  CF   RGP
Sbjct  376  DQRPGCLSCFRQYRGP  391



>gb|EMS54076.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=426

 Score =   349 bits (895),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  231  LIKNRRRKLAFKVVVQLALDLARGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVAR  290

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  291  VEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  350

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPS+LA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct  351  TSAVVRQNLRPEIPRCCPSALANVMKRCWDANPDKRPEMAEVVAMIEAIDTSKGGGMIPI  410

Query  258  DQAGGCF-CFAPTRGP  214
            DQ+ GCF CF   RGP
Sbjct  411  DQSQGCFACFRQYRGP  426



>ref|XP_010440392.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L   R KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct  170  LIGHRNKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDGQKNLKIADFGVAR  229

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NPKDMTGETG+LGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct  230  VEALNPKDMTGETGSLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV  289

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            SSAVV  NLRPEIPRCCP++LASIMK CWD NP KRPEM+EVV L+E +DT+KGGGMI E
Sbjct  290  SSAVVLHNLRPEIPRCCPTALASIMKACWDGNPQKRPEMNEVVTLLEQVDTTKGGGMIRE  349

Query  258  DQAGGCFCFAPTRGP  214
            DQ+ GCFCFAP RGP
Sbjct  350  DQSPGCFCFAPARGP  364



>ref|XP_011007522.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Populus euphratica]
Length=380

 Score =   347 bits (891),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +K+ADFGVAR
Sbjct  186  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKLADFGVAR  245

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  246  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  305

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA+IMK+CWDANPD+RPEM+ VV ++EAIDTS GGGMIP 
Sbjct  306  TSAVVRQNLRPEIPRCCPSSLANIMKRCWDANPDRRPEMEVVVFMLEAIDTSMGGGMIPL  365

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  366  DQPQGCLCFRRYRGP  380



>ref|XP_009609245.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   346 bits (888),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLAFK+V+QLALDL+RGL+YLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  162  LIKSHRRKLAFKVVVQLALDLARGLNYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVAR  221

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  222  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  281

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            ++AVVRQNLRPEIPRCCPSSLA++MK+CWDA+ DKRPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  282  TTAVVRQNLRPEIPRCCPSSLANVMKRCWDASADKRPEMDEVVSMLESIDTSKGGGMIPV  341

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF   RGP
Sbjct  342  DQRQSCFCFGRHRGP  356



>ref|XP_010101194.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB87868.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=393

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLAFK+V QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  199  LIKNMRRKLAFKVVAQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVAR  258

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  259  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  318

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVV QNLRP IPRCCPSSLA++MK+CWDANPDKRPEMDEVV L+EAIDTSKGGGMIP 
Sbjct  319  TSAVVCQNLRPNIPRCCPSSLANVMKRCWDANPDKRPEMDEVVSLLEAIDTSKGGGMIPG  378

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  379  DQPQGCLCFRKYRGP  393



>ref|XP_010936750.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Elaeis guineensis]
Length=358

 Score =   346 bits (888),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  +KKLAFK+VIQLALDL+RGLSYLHS KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  163  LIKNWRKKLAFKVVIQLALDLARGLSYLHSNKIVHRDVKTENMLLDRTRTVKIADFGVAR  222

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEAQNP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E+
Sbjct  223  VEAQNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEI  282

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA++M++CWDANPD+RPEMDEVV ++EAIDTSKGGGMIP 
Sbjct  283  TSAVVRQNLRPEIPRCCPSSLANVMRRCWDANPDRRPEMDEVVAMLEAIDTSKGGGMIPH  342

Query  258  DQAGGCF-CFAPTRGP  214
            D+  GC  CF   RGP
Sbjct  343  DEPQGCLGCFRKYRGP  358



>ref|XP_009801079.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Nicotiana sylvestris]
Length=359

 Score =   346 bits (888),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K  ++KLAFK+V+QLALDL+RGL+YLHS+KIVHRDVK ENMLLD +R LKIADFGVAR
Sbjct  165  LIKSHRRKLAFKVVVQLALDLARGLNYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVAR  224

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  225  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  284

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            ++AVVRQNLRPEIPRCCPSSLA++MK+CWDA+ DKRPEMDEVV ++E+IDTSKGGGMIP 
Sbjct  285  TTAVVRQNLRPEIPRCCPSSLANVMKRCWDASADKRPEMDEVVSMLESIDTSKGGGMIPV  344

Query  258  DQAGGCFCFAPTRGP  214
            DQ   CFCF   RGP
Sbjct  345  DQRQSCFCFGRRRGP  359



>ref|XP_002300019.1| kinase family protein [Populus trichocarpa]
 gb|EEE84824.1| kinase family protein [Populus trichocarpa]
Length=382

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KLAFK+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +K+ADFGVAR
Sbjct  188  LIKNRRRKLAFKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKLADFGVAR  247

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct  248  IEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV  307

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRPEIPRCCPSSLA+IMK+CWDANPD+RPEM+ VV ++EAIDTS GGGMIP 
Sbjct  308  TSAVVRQNLRPEIPRCCPSSLANIMKRCWDANPDRRPEMEVVVFMLEAIDTSMGGGMIPL  367

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  368  DQPQGCLCFRRYRGP  382



>gb|AAM62495.1| protein kinase [Arabidopsis thaliana]
Length=385

 Score =   347 bits (890),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  798  LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR  619
            L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct  191  LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR  250

Query  618  VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV  439
            VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCC +PYPDL+F+EV
Sbjct  251  VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCXMPYPDLTFSEV  310

Query  438  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE  259
            +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct  311  TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN  370

Query  258  DQAGGCFCFAPTRGP  214
            DQ  GC CF   RGP
Sbjct  371  DQQQGCLCFRRKRGP  385



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195